Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G036703.483ON57257230120.0
KNAG0A079203.483ON57857626690.0
Kpol_480.193.483ON57457126480.0
TDEL0D055203.483ON57357226240.0
NDAI0B058103.483ON57757626170.0
Suva_16.4743.483ON57257126080.0
CAGL0I10648g3.483ON57457226060.0
TPHA0D042003.483ON57457126050.0
NCAS0F035103.483ON57557225980.0
YPR145W (ASN1)3.483ON57257225960.0
Smik_16.3963.483ON57257125940.0
Suva_7.4103.483ON57257225830.0
Skud_16.4393.483ON57257225820.0
Skud_7.4353.483ON57257125610.0
SAKL0F02970g3.483ON57357225520.0
YGR124W (ASN2)3.483ON57257125500.0
Smik_6.2203.483ON57257125480.0
Kwal_55.211873.483ON57357125390.0
KLLA0B10868g3.483ON57457125350.0
TBLA0C044303.483ON58057825310.0
KLTH0F14630g3.483ON57357125150.0
ZYRO0B04136g3.483ON57257124830.0
AFR303W3.483ON57157124710.0
Ecym_12443.483ON57357123820.0
ZYRO0A00528g8.875ON5121031448e-09
TPHA0C049508.875ON525891242e-06
ADL350C8.875ON508891233e-06
Kpol_455.78.875ON518941215e-06
Skud_13.468.875ON5191011199e-06
KNAG0J002008.875ON5151081181e-05
KAFR0L021108.875ON514951162e-05
NCAS0C001908.875ON5171051153e-05
NDAI0K001808.875ON522941153e-05
TDEL0B004408.875ON516941134e-05
YML096W8.875ON525951134e-05
Suva_13.528.875ON519991135e-05
Smik_13.398.875ON521961126e-05
TBLA0C063008.875ON518941109e-05
KLLA0D10285g8.875ON5151141091e-04
Ecym_81558.875ON5131631091e-04
SAKL0D00352g8.875ON515871091e-04
Skud_7.311singletonON8189972e-04
Kwal_27.97058.875ON5151051072e-04
KLTH0E16412g8.875ON51595990.002
CAGL0H06963g8.875ON51778960.004
SAKL0E13200g2.59ON15283693.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03670
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1164   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1032   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1024   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1015   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...  1012   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1009   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1008   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...  1008   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1005   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1004   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1003   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   999   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   999   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   991   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   987   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   986   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   986   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   982   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   981   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   979   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   973   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   961   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   956   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   922   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    60   8e-09
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    52   2e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    52   3e-06
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    51   5e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    50   9e-06
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    50   1e-05
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    49   2e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    49   3e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    49   3e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   4e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    48   4e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    48   5e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    48   6e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   9e-05
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    47   1e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    47   1e-04
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    47   1e-04
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    42   2e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    46   2e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    43   0.002
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    42   0.004
SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285) ...    31   3.4  

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/572 (97%), Positives = 560/572 (97%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/576 (84%), Positives = 529/576 (91%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFA FRHEDV +FK +ALQLSKRIRHRGPDWSGN++KNSTIM HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCG+Y L VNGEIYNHIQLRE+ P+Y++K+LSDCEPIIP+YL+ D+DAPK LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+KKDRI+AARDPIG+TTLYMGRSSM PKTVFFASELKCL DDCD+I+AFPPGH+
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TPNW+DE KIP+TPVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAE----EGSHLAGIDDEGHLRTSGWSRLHSFAIGLPG 296
             IA+IAARETE AN+ELD  +Y E    EG HLAGIDDEG+L ++ WSRLHSFAIGLPG
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL+AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILW 476
           LEARVPFLD+EFLDLCMNIDP DKLINQKEGRIEKYILRKAFDT D+P  KPYLP+EILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWID LKDTAE VISDEMFA PK+HWG D+PTTKEA+WYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           QPTAAETVMRWIPKADWGCAEDPSGR+A+IHE+H++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1024 bits (2648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/571 (84%), Positives = 520/571 (91%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAA++HE+  +FK +ALQLSKRIRHRGPDWSGNVVKNSTI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCG+Y LCVNGEIYNHIQLRE  PDYK+KTLSDCEPIIPLYL+ DIDAPK LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+KKDRI+AARDPIG+TTLYMGR+S SPKTVFFASELKCL DDCDSI+AFPPGH+
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+P+WIDE +IPT PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETE A +E+D + Y  E  HL GIDD+G+L T+GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMNIDP +K+IN  EGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE+VISDE+F+ PK HWG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           AETVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 524/572 (91%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAA +HEDV ++K KALQLSKRIRHRGPDWSGNV++N+T++VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCGNYTLCVNGEIYNHI+LRE+F DYKF TLSDCEPIIPLY + DID PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+K+DRI+AARDP+G+TTLYMGR+S+SPKTVFFASELKCL DDCD+IVAFPPGHI
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+ PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETE AN E+DA +Y  E  HLAGIDD G+L ++GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGSIHHEHTFTLQEG+DALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMNIDP DK+IN++EGR+EKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE+VISD++FA PKS WG D+PTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           A+TVMRW+PKADWGCAEDPSGR+AQIH++H++
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVK 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/576 (82%), Positives = 516/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV +FK +ALQLSKRIRHRGPDWSGNV+KN+TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQ+REQFPDY FKTLSDCEPIIPLYL+ DID PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYDSK+DRI+AARDPIG+TTLYMGR+S +P+TVFFASELKCL DDCDSI+AFPPGH+
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYFTP+W+DE +IP   +D TAIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRE--LDASQYAEEGS--HLAGIDDEGHLRTSGWSRLHSFAIGLPG 296
             IASIAARETE AN +  LD     +E S  HL G+DDEGHL   GWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILW 476
           LEARVPFLDR+FL LCMNIDP +K+INQ EGRIEKYILRKAFDT DDP AKPYLP+EILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWID LKDTAE+VISD MF NPK HWG DIPTTKEAYWYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           Q TAA+TVMRWIPKADWGCAEDPSGRYA+IHEKH+ 
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/571 (83%), Positives = 515/571 (90%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV  +K KALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSP  +Y LCVNGEIYNHIQLRE+ PDY+FKTLSDCEPIIP+YL+ DIDAPK LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARET  A  +++ S Y  +  HLAG+DDEG+L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMNIDP++K+I  KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE VISDEMFANPK+ WG DIPTTKEAYWYRLKFD LFPQ T 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRW+PKADWGCAEDPSGRYAQIHEKHI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/572 (83%), Positives = 514/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAA++H+DV +FK KALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G+YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIP YL  DIDAPK LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+K+DRI+AARDP+G+TTLYMGR S SPKTVFFASELKCL DDCD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYFTP+WIDE++IPTTPV++  IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQY-AEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPD 299
             IASIAARETE AN E DA+   A     LAGID++GHL T+GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQK 479
           RVPFLD+EFL LCMNIDP DK+I+Q  GRIEKYILRKAFDT D+P  KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPT 539
           EQFSDGVGYSWID LKDTAE+VISD MF+NPK  WG+DIPTTKEAYWYRLKFDALFPQ T
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AAETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           AA TVMRWIPKADWGCAEDPSGRYA+IHE+H+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/571 (83%), Positives = 516/571 (90%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIF  ++HE+  +FK +ALQLSKRIRHRGPDWSGNVVKNSTIM HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G++ LCVNGEIYNHIQ+REQFPDY+FKTLSDCEPIIPLY++   +APK LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCDSIVAFPPGH+
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TP+WIDEN+I   P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETE A +   +   +   + L GIDD G+LR+SGWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           IAAKKVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFLDLCMNIDP++K+INQKEGRIEKYILRKAFDT D+P+ KPYLPDEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE+VISDE+F NP+ HWG DIPTTKEAYWYRLKFDALFPQPTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/572 (82%), Positives = 515/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAFRHEDV ++K KALQL+KRIRHRGPDWSGNVVKN+TI+ HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQ+RE+  DY+FKTLSDCEPIIPLYL+ D+DAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+K+DRI+AARDPIG+TTLYMGR S +P+TV+FASELKCL DDCDSIVAFPPGH+
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF P+W+DE++IP+TPVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDAS-QYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPD 299
             IASIAARETE A +++D   +  E   HL G+DDEGHL T GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L AA+KVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQK 479
           RVPFLD+EFL LCMNIDP DK+I+Q  G+IEKYILRKAFDT DDP  KPYLP EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPT 539
           EQFSDGVGYSWID LKDTAE+VISD MF NPK HWG D+PTTKEAYWYRLKFDAL+PQ T
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 AAETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           AA+TVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/572 (82%), Positives = 514/572 (89%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAFRHEDV  +K KALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G Y LCVNGEIYNHIQLRE+  DY+F TLSDCEPIIP+YL+ DIDAPK LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  +++ S Y  +  HLAGIDD+G L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMNIDPN+K+I  KEGRIEKYILRKAFDT  +P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE VISDEMFA+PK+ WG DIPTTKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           A+TVMRWIPKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/571 (82%), Positives = 516/571 (90%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV ++K KALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSP  +Y LCVNGEIYNHIQLRE+ P+Y+FKTLSDCEPIIP+YL+ DIDAPK LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  ++D S Y  +  HLAG+DD+G L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLD+EFL LCMNIDPN+K+I  KEGRIEKYILRKAFDT  +P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE VISDEMFA+PK+ WG DIP+TKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRWIPKADWGCAEDPSGRYAQIHEKHI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/572 (83%), Positives = 511/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+  FK KALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G+Y L VNGEIYNHIQLREQ  DYKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           A+ LYDSKKDR++AARDPIGV TLYMGR S SPKTV+FASELKCL D CDSI+AFPPGH+
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTP+W+DE ++PTTPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN E +    AE+ S LAGIDD+GHL TSGWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETETANVEANEEASAEK-SKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLD++FL LCMNIDP DK+IN KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID L+DTAE+VISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           A+TVMRW+PKADWGCAEDPSGRYAQIHEKH+ 
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/572 (81%), Positives = 514/572 (89%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAA++HEDV  +K KALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSP  +Y LCVNGEIYNHIQLRE+ PDY+FKTLSDCEPIIP+YL+ DI+APK LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  +++ S Y  +  HLAG+DD+G+L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMNIDP +K+I  KEGRIEKYILRKAFDT  +P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE VISDEMFA+PK+ WG DIPTTKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           A+TVMRW+PKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/571 (82%), Positives = 506/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+ SFK KALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PI S  G Y L VNGEIYNHIQLRE+   YKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           A+ LYD+KKDR++AARDPIGV TLYMGRSS SPKTV+FASELKCL D CDSI++FPPGH+
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTPNW+DE +IP+ PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN + D    +     LAGIDD+GHL TSGWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKANADADGDA-SVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDR+FL LCMNIDP DK+IN KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID L+DTAE+VISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/572 (81%), Positives = 504/572 (88%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFA ++HE V  FK KALQLSKRIRHRGPDWSGNVVKN+TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G+YTLCVNGEIYNHI+LRE+   Y FKTLSDCEPIIPLY + DID PK LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+KKDRI+AARDPIG+TTLYMGRSS SP TVFFASELKCLVDDCD I AFPPGH+
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TP+W+DE +IP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN++LD   Y +E  HLAG+DD+G+L  +GWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFI SIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDR+FLD+CMNIDP +K+INQ EGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE  ISDE FA PK  WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HIQ
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/571 (82%), Positives = 508/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+ +FK KALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G Y L VNGEIYNHIQLRE   DYKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           A+ LYDSKKDRI+AARDPIGV TLYMGRSS SP+TV+FASELKCL D CDSI++FPPGH+
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTP+W+DE +IP+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN + +     +E   LAGIDD+GHL TSGWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLD++FL LCMNIDPN+K+I  KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID L+DTAE+ ISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 509/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAF+H+D+ SFK KALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G Y L VNGEIYNHIQLRE+  DYKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           A+ +YD+KKDRI+AARDPIGV TLYMGRSS SPKTV+FASELKCL D CDSI+AFPPGH+
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN +++     +E   LAGIDD+GHL TSGWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLD++FL LCMNIDP DK+I  KEG+IEKYILRKAFDT ++P  KPYLP+EILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID L+DTAE+VISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 505/571 (88%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIF  FRHEDV  FK  ALQL+KRIRHRGPDWSGNV++NST++ HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           P+ S   +Y L VNGEIYNHIQLRE+F DY FKTLSDCEPIIPLY +  IDAPK LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+KKDR++AARDPIG+TTLYMGR S SPKTV+FASELKCL D+CDSI+AFPPGH+
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TPNW+DEN+IP+ P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN E++  +Y  E  HLAG+DD G L ++GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFLDLCMN+DP +K+INQ EGRIEKYILRKAFDT D+P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKDTAE  ISDE F  PK+ WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/571 (81%), Positives = 505/571 (88%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DV ++K KALQLSKRIRHRGPDWSGN+VKNSTI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITS  G+YTL VNGEIYNHI LRE+   Y FKTLSDCEPIIPLY + DIDAPK LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYDSKKDRI+AARDPIG+TTLYMGRSS SPK+V+F+SELKCL DDCD I+AFPPGH+
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTP+W+DE++IPTTPVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE  N ELD   Y  +   LAG+D++GHL  +GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVA FIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDR+FL LCMNIDPNDK+I   EG+IEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE  ISDE FA PK+ WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+H+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/578 (79%), Positives = 507/578 (87%), Gaps = 7/578 (1%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAA++H +V +FK +ALQL+KRIRHRGPDWSGNVVKN+T+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PITSPCGNY L VNGEIYNHIQLRE+  DYK+KTL DCEPIIP+YL+ D+DAP  LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           A+ LYDS+KDR++AARDP+G+TTLYMGR+S +PKTV+FASELKCLVDDCDSI+AFPPGH+
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKI RYF PNWIDE+ IPTTPVD   +R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQY-------AEEGSHLAGIDDEGHLRTSGWSRLHSFAIG 293
             IASIAARETE    E +   Y       A+    L G+DD G+L+T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPGAPDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LPGAPDL AA+KVA FIGSIHHEH FT+QEG+DALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDE 473
           AWGLEARVPFLDR+FL+LCMNIDPNDK+I  KEG+IEKY+LRKAFDT D+P  KPYLP+E
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKDTAE+VISDEMFANPK HWG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           LFPQ TAA+TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/571 (80%), Positives = 497/571 (87%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIF  FRH+ V  FK  AL+L KRIRHRGPDWSGN++KNST+M HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           P  S   NY L VNGE+YNHIQLRE+F  Y FKTLSDCEPIIPLY +  IDAPK LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+KKDRI+AARDPIG+TTLYMGR S SPKTV+FASELKCL D+CDSI+AFPPGH+
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF P+WIDE++IP+ P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETE AN ++D  +Y  E  HLAG+DD G+LR++GWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMN+DP +K+IN  EGRIEKYILRKAFDT D+P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE  ISDE F  PK+ WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 500/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFAAFRH DV  ++  ALQLSKRIRHRGPDWSGNVVKNSTI+VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PI SPCGNYTLCVNGEIYNHIQLRE+  DY F++LSDCEPIIPLYL+  +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYDSK+DRI+AARDPIG+TTLYMG+SS SPKT FFASELKCL+DDCD IVAFPPGH+
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P W+DE+ +P+TP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETE AN ELD   Y  E  HLAGID +G+L T GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA+KVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDR+FL+LCM +DPN+K+I  +EGRIEKYILRKAFDT D+P+ KPYLP++ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE+ ISDEM A P+  WG D PTTKEAYWYRLKFD  FP+ +A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPK-SA 539

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGC  DPSGR+A+IHE+HI
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 498/571 (87%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFA +R +D+ SFK  AL+LSKR+RHRGPDWSGNV+KN TI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PI SP GNY LCVNGEIYNHI LRE+  DY+F +LSDCEPIIPLYL+ D++ P+ LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD ++DRI+AARDPIGVTTLYMG+SS SP+T +FASELKCLVD+CD I AFPPGH+
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF P+WIDE +IP+ PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IASIAARETE ANRE  A     +G HLAG+DD G L T GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANRE--AGDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDREFL LCMNIDP +K+I  ++GRIEKYILRKAFDT D+P   PYLP+EILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE+ ISDE FANP   WG DIPTTKEA+WYRLKFDALFPQPTA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/571 (75%), Positives = 487/571 (85%)

Query: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60
           MCGIFA +R + + SFK  ALQLSKRIRHRGPDWSGNVVKN TI VHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120
           PI S  GNY LCVNGEIYNHI LR+   DY F TLSDCEPIIPL+ +  ++ P  LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180
           AW LYD+K DRI+AARDPIGVTTLYMG+ S SP+T +FASELKCLV++CD I++FPPGH+
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF P+W+ ++  PT PVDY  +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN+E+D  +Y  +  +L G+DDE HL  SGWS+LHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSIHHEHTFT+QEG+DALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480
           VPFLDR+FL+LCMNIDP +K+I  KEG+IEKYILRKAFDT D+P  +PYLP EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540
           QFSDGVGYSWID LKD AE  ISDE FA PK  WG DIP+TKEAYWYR+KFDALFPQPTA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKA+WGC+EDPSGR+A+IHEKHI
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRK 456
           A G+E R PFLDR  ++  M   P    IN K   I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP----INWK---INKLILRK 471

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 25/168 (14%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDI---DAPKSLDGMFAWTLY 125
           Y L  NGE+YN     E+  D      +D   +  L   D +   +    L+G FA+T+Y
Sbjct: 88  YILQFNGELYN-----EEILD------NDTSFVASLLENDKMSVFEVISFLEGEFAYTIY 136

Query: 126 DSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFAS---ELKCLVDDCDSIVAFPPGHIYD 182
           D  + ++   RD IG  +L   R   +   ++ AS   + +   D    IV     +IYD
Sbjct: 137 DMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV-----YIYD 190

Query: 183 SETDKITRYFTP--NWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEV 228
            E   + +   P  N    ++I     ++  I H+L + ++  ++  V
Sbjct: 191 VEDKSLNQQMLPILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLDLCMNIDPNDKLINQK 445
           +E R PFLD   ++      P +  IN+K
Sbjct: 446 IEVRYPFLDEYVVNFSTKEIPINYKINKK 474

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 15/81 (18%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPII-----PLYLRDDIDAPKSLDGMFAWT 123
           Y L  NGE+YN+          +   +SD    +      L  +D I+  ++L+G FA+T
Sbjct: 89  YILQFNGELYNN----------EIHGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYT 138

Query: 124 LYDSKKDRILAARDPIGVTTL 144
           ++DSKK  +   RD IG  +L
Sbjct: 139 IFDSKKKLVYFGRDTIGKRSL 159

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLDLCMNID---PNDKLINQKEGR 448
           FLD + +   + +     NDK+I +K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRK 456
           FLD E +   ++  P    +N+  G + K  L K
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNK--GILRKLALEK 481

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMFAWTLYDSK 128
           Y L  NGE+YN  ++      Y    L  C+        D +   + LDG FA+T+YD K
Sbjct: 92  YVLQFNGELYNS-EISGNDTQYIVSLLKSCDG-------DVVSLVRKLDGGFAYTIYDLK 143

Query: 129 KDRILAARDPIGVTTL 144
           +  I   RD IG  +L
Sbjct: 144 EGNIYFGRDTIGKRSL 159

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 417 LEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKA 457
           +E R PFLD   ++L     P    IN K   + K ILRK 
Sbjct: 446 VEVRYPFLDEYVINLSTLEIP----INYK---VNKLILRKV 479

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 57/123 (46%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYNHIQ 82
           I  RGP++S   V    I  H+      + S  +P T    N    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREQFPDYKFKTLSDCEPIIPLY-LRDDIDAPKSLDGMFAWTLYDSKKDRILAARDPIGV 141
             ++  D+   +L     +  L   R+ +D  +SL+G +A+T+YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 355 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 414 AWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTK 461
           + G+E R PFLD   +       P    IN K   I K ILR    TK
Sbjct: 439 SNGVEIRYPFLDSSVVKFSTEDLP----INYK---INKLILRDLAATK 479

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 40/89 (44%), Gaps = 12/89 (13%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKS 115
           QP T       G Y L  NGE+YN  ++      Y    L+  E  IP       D    
Sbjct: 76  QPFTKQSLVVDGRYVLQFNGELYND-EIEFNDTQYIADMLARGEASIP-------DIIAR 127

Query: 116 LDGMFAWTLYDSKKDRILAARDPIGVTTL 144
           LDG FA+T+YD++  +    RD IG  +L
Sbjct: 128 LDGEFAYTIYDTEDQKYYFGRDAIGKRSL 156

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKA 457
           FLD   +       P    IN K   + K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIP----INYK---VNKLILRKV 474

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKF--KTLSDCEPIIPLYLRDDIDAPKSLDGMFAWTLYD 126
           Y L  NGE+YN  ++++   D +F    LS           D I     LDG FA+T+YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSS--------TDVIHTLTQLDGEFAYTIYD 138

Query: 127 SKKDRILAARDPIGVTTL 144
            ++ +I   RD IG  +L
Sbjct: 139 LRETKIYFGRDSIGKRSL 156

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 9/105 (8%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRK 456
               G+E R PFLD E +       P    IN K   + K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIP----INYK---VNKMILRK 475

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMFAWTLYDSK 128
           Y L  NGE+YNH ++      Y    L +  P IP  +       K L+G FA+++YD +
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAII-------KKLNGEFAYSIYDIQ 141

Query: 129 KDRILAARDPIGVTTL 144
                  RD +G  +L
Sbjct: 142 NGTFYFGRDTVGKRSL 157

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRK 456
           FLD + +       P    IN K   I K ILRK
Sbjct: 455 FLDIDVIKFSTEELP----INYK---INKLILRK 481

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 53/119 (44%), Gaps = 19/119 (15%)

Query: 27  IRHRGPDWSG-NVVKNSTIMVHERLAIVGLDSGAQPITSPC----GNYTLCVNGEIYNHI 81
           I  RGP++S   V K  +I     +      S  +P T  C      Y +  NGE+YN  
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFSSVL-----SLREPFTKQCVEIKDRYVVQFNGELYND- 102

Query: 82  QLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMFAWTLYDSKKDRILAARDPIG 140
           +++     Y  + L + + II        D  + LDG FA+T+YD +       RDPIG
Sbjct: 103 EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPIG 153

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRK 456
           FLD + +       P    IN K   + K ILR+
Sbjct: 449 FLDHDVIKFSTEEIP----INYK---VNKMILRR 475

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 96/219 (43%), Gaps = 35/219 (15%)

Query: 27  IRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQPITS---PCGN-YTLCVNGEIYNHIQ 82
           I+ RGPD+S   V +     H       + S  +P TS     GN + L  NGE+YN  +
Sbjct: 47  IKSRGPDYSSLRVSSE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQ-E 101

Query: 83  LREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMFAWTLYDSKKDRILAARDPIGVT 142
           +     D +F      E        D     + L G FA+TLYD ++ +    RD +G  
Sbjct: 102 ITAHDNDTQFIVSKLQEG-----YHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGKR 156

Query: 143 TLYMGRSSMSPKTVFFASELKCLV---DDCDSIVAFPPGHIYDSETDKI-------TRYF 192
           +L    S+++ +   + S +   +    DC + V +    +YD+E+  +       ++YF
Sbjct: 157 SLSYHLSAITGE--LYISSVSGAIPGFKDCIAGVVY----VYDTESKTLDDSIKLESQYF 210

Query: 193 TPNWIDENKIPTTPVDYTA--IRHSLEKAVRKRLMAEVP 229
               +DE     T +D T   +   L  AVRKR+++  P
Sbjct: 211 ITKKLDEE---LTCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKA 457
           FLD   + L     P    IN K   + K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIP----INFK---VNKLILRKV 479

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 60  QPITSPCGN----YTLCVNGEIYN-HIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPK 114
           QP T    N    Y L  NGE+YN  I   +    Y    L + +  + +     ID  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 SLDGMFAWTLYDSKKDRILAARDPIGVTTL 144
           SL+G +A+T+YD    ++   RDPIG  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKA 457
            R PFLD   +       P    IN K   I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSAVDIP----INFK---INKLILRNV 479

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 71/168 (42%), Gaps = 28/168 (16%)

Query: 27  IRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQPIT----SPCGNYTLCVNGEIYNHIQ 82
           I  RGP++S   V  +    ++      + S  QP T    S    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREQFPDYKFKTLSDCEPIIPLYLR-----DDIDAPKSLDGMFAWTLYDSKKDRILAARD 137
             ++  D      +D + I  L        D ID  + L+G +A+T+YD K  +    RD
Sbjct: 100 --KEISDDD----NDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHIYDSET 185
           PIG  +L     S++P    + +     ++     +    G +Y+ +T
Sbjct: 154 PIGRRSL---SYSVTPNNELYVASATGAIEGFQDCIG---GIVYEYDT 195

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKA 457
           PFLD   +       P    IN K   + K ILRK 
Sbjct: 451 PFLDEYVIKFSTVEIP----INYK---VNKLILRKV 479

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 56/127 (44%), Gaps = 22/127 (17%)

Query: 27  IRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYNHIQ 82
           I  RGP++S       T+  +       + S  +P T    N    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNK-E 101

Query: 83  LREQFPD--YKFKTLSDCEPIIPLYLRDD---IDAPKSLDGMFAWTLYDSKKDRILAARD 137
           +     D  Y    L D E        DD   ID  KSL+G +A+T+YD K  +    RD
Sbjct: 102 VSHWGNDSLYIASLLKDLE--------DDGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRD 153

Query: 138 PIGVTTL 144
           PIG  +L
Sbjct: 154 PIGRRSL 160

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRK 456
           FLD   +    +  P    IN K   I K ILRK
Sbjct: 451 FLDEHVIKYSTHDIP----INYK---INKLILRK 477

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 17/82 (20%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDD------IDAPKSLDGMFAW 122
           Y L  NGE+YN   +            +D + I+ L L  +      I   K+LDG FA+
Sbjct: 90  YVLQFNGELYNDEIIH-----------NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAF 138

Query: 123 TLYDSKKDRILAARDPIGVTTL 144
           ++YD K  R+   RDPIG  +L
Sbjct: 139 SIYDLKNKRLYFGRDPIGKRSL 160

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 353 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKST 412
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  K++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 413 MAWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSA 466
              G+E R PFLD   +   +++  N K+       + K ILR  F +++   A
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDLPLNYKVNKHILRVMAKDILRLDFISEEPKRA 492

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 69/163 (42%), Gaps = 20/163 (12%)

Query: 297 APDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPM------- 349
           APD I +K+  K +  ++ +    L E   + DD + H            T M       
Sbjct: 301 APDRILSKRSVKILRKLYPQTKIKLVEVDVSYDDYLKHKPVVIDLMYPKDTEMDLSIAIA 360

Query: 350 FLLSRK-----------IKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV 397
           F  + K           I  Q   +VL SG G+DE++GGY  F    S      E  K++
Sbjct: 361 FYFASKGHGSLQEGDKTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQI 419

Query: 398 KNLHLADCLRANKSTMAWGLEARVPFLDREFLDLCMNIDPNDK 440
            N++  +  R +K     G+E R PFLD E ++L  ++  N K
Sbjct: 420 NNIYDRNLDRDDKCMACNGIEIRYPFLDEEVINLSTSLPINYK 462

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDREFLDLCMNIDPNDKLINQK 445
            R PFLD + +     +  N K +N+K
Sbjct: 445 VRYPFLDEKVVQFSTELPINYK-VNKK 470

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 13/121 (10%)

Query: 69  YTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMFAWTLYDSK 128
           + L  NGE+YN      Q  D  F        +I  Y  D   A + ++G FA+T++D +
Sbjct: 91  FVLQYNGELYNS---SIQHNDTLF-----IASLIERYQDDIPKAIREMEGEFAYTIFDKQ 142

Query: 129 KDRILAARDPIGVTTL-YMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHIYDSETDK 187
            +++   RD IG  +L Y   S  S   +   S      +DC+    +    IYDS+T  
Sbjct: 143 CEKLYFGRDTIGKRSLSYKFDSETSKLFISSVSGTSEGFEDCEGGTIY----IYDSKTGN 198

Query: 188 I 188
           +
Sbjct: 199 L 199

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 14/89 (15%)

Query: 102 IPLYLRDDIDAPKSLDGMFAWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASE 161
           +P YL  DIDAPK L+ MFA++    +K              ++ G S +  +T F  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LVDDCDSIVAFPPGHIYDSE 184
             L C    L   CD+  +F PG ++DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 10/105 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTK 461
           +E R PFLD   ++    +  N K        + K ILR   + K
Sbjct: 442 VEVRYPFLDDRVIEFSTQLPINYK--------VNKMILRMVAEKK 478

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 38/89 (42%), Gaps = 13/89 (14%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKS 115
           +P+T  C      + L  NGEIYN   +      Y    LS  + + P  +R        
Sbjct: 78  EPLTKQCIDINDRFVLQYNGEIYNS-SIAHNDTQYIATELSIVQNV-PTVIR-------K 128

Query: 116 LDGMFAWTLYDSKKDRILAARDPIGVTTL 144
           L G FA+T+YD     I   RD +G  +L
Sbjct: 129 LSGEFAYTVYDRATGEIFFGRDGVGKRSL 157

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKA 457
           FLD + +     +  N K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKS 115
           +P T  C      + L  NGEIYN   +      Y  + L + + I P  +R       +
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDI-PSVIR-------T 128

Query: 116 LDGMFAWTLYDSKKDRILAARDPIGVTTL 144
           L G FA+T+YD     +   RDPIG  +L
Sbjct: 129 LSGEFAYTIYDKLTGEVFFGRDPIGRRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDREFLDL 431
           + G+E R PFL  E ++ 
Sbjct: 442 SNGVEVRYPFLAEEVVEF 459

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 22/131 (16%)

Query: 23  LSKRIRHRGPDW-SGNVVKN-STIMVHERLAIVGLDSGAQPITSP---CGN-YTLCVNGE 76
           + K +R RGP++ S   +K+ ++I +   L++       QP T      GN Y L  NGE
Sbjct: 39  IVKLVRCRGPNYCSMRQIKDVNSIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGE 92

Query: 77  IYNHIQLREQFPDYKFKT--LSDCEPIIPLYLRDDI-DAPKSLDGMFAWTLYDSKKDRIL 133
           +YN  ++ E   D +F +  L  C         DDI +    LDG FA+T+ D + + I 
Sbjct: 93  LYND-EIIESGNDTQFLSGLLKKCIS------EDDIFNILHGLDGEFAFTIQDLENNLIY 145

Query: 134 AARDPIGVTTL 144
             RD IG  +L
Sbjct: 146 FGRDTIGKRSL 156

>SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285)
           [459 bp, 152 aa] {ON} highly similar to uniprot|Q07648
           Saccharomyces cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr)
           deacylase functions in protein translation may affect
           nonsense suppression via alteration of the protein
           synthesis machinery ubiquitous among eukaryotes
          Length = 152

 Score = 31.2 bits (69), Expect = 3.4,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 32/83 (38%), Gaps = 11/83 (13%)

Query: 452 YILRKAFDTKDDPSAKPYLPDEILWRQKEQFSDGVGYSWIDCLKDTAEKVISDEMF---- 507
           Y+L     T+D+      L  +I     + F D  GY W   +KD   +++S   F    
Sbjct: 27  YMLLVGISTEDNTEDAEKLSKKI--ASLKVFDDDTGYGWKKSIKDVEGEILSVSQFTLMA 84

Query: 508 -----ANPKSHWGKDIPTTKEAY 525
                  P  H  +  PT KE Y
Sbjct: 85  RTKKGTKPDFHMAQKGPTAKELY 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,011,624
Number of extensions: 2649765
Number of successful extensions: 6003
Number of sequences better than 10.0: 47
Number of HSP's gapped: 6070
Number of HSP's successfully gapped: 64
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)