Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G026806.23ON38338320520.0
KNAG0D02240singletonON35930411431e-156
SAKL0E01342g6.23ON34132810861e-147
CAGL0F01815gsingletonON31429610631e-144
CAGL0I08151gsingletonON38236010641e-143
TDEL0G044606.23ON36930710531e-142
ZYRO0C07722g6.23ON37335110491e-141
NCAS0H008406.23ON36035510281e-138
NDAI0D008306.23ON37430010101e-135
TPHA0M002806.23ON30329410001e-135
NCAS0D021706.23ON3102989971e-134
KAFR0A050806.23ON3112949911e-133
Kpol_1061.27singletonON3063019801e-132
KNAG0M011906.23ON3802949861e-132
Kpol_385.5singletonON3063019671e-130
KLTH0C11154g6.23ON3052999541e-128
NDAI0C026206.23ON3113029521e-127
KLLA0D01243g6.23ON3112969341e-125
Kwal_56.224396.23ON3202979001e-119
KNAG0K01400singletonON3092938981e-119
TDEL0A038805.524ON1696134780.50
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G02680
         (383 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     795   0.0  
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   444   e-156
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   422   e-147
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   414   e-144
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   414   e-143
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              410   e-142
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   408   e-141
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   400   e-138
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   393   e-135
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   389   e-135
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   388   e-134
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   386   e-133
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   382   e-132
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   384   e-132
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   377   e-130
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   372   e-128
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      371   e-127
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   364   e-125
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   351   e-119
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   350   e-119
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....    35   0.50 

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/383 (100%), Positives = 383/383 (100%)

Query: 1   MSSPATENTSIRKNPNTRANKRRANQNVYNAKYTIFGVIGLLACFVFQKIVLEPRRIKWG 60
           MSSPATENTSIRKNPNTRANKRRANQNVYNAKYTIFGVIGLLACFVFQKIVLEPRRIKWG
Sbjct: 1   MSSPATENTSIRKNPNTRANKRRANQNVYNAKYTIFGVIGLLACFVFQKIVLEPRRIKWG 60

Query: 61  LEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFL 120
           LEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFL
Sbjct: 61  LEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFL 120

Query: 121 MLDDFDVTPPAGFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVH 180
           MLDDFDVTPPAGFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVH
Sbjct: 121 MLDDFDVTPPAGFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVH 180

Query: 181 SEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSY 240
           SEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSY
Sbjct: 181 SEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSY 240

Query: 241 DVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIF 300
           DVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIF
Sbjct: 241 DVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIF 300

Query: 301 FDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFE 360
           FDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFE
Sbjct: 301 FDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFE 360

Query: 361 RAENWESNIRKGIKEAEARELRT 383
           RAENWESNIRKGIKEAEARELRT
Sbjct: 361 RAENWESNIRKGIKEAEARELRT 383

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  444 bits (1143), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 202/304 (66%), Positives = 244/304 (80%)

Query: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137
           M  +   RSI NHFIP E  EG GARVKRS+GS +QRRF PFLMLDDF V  P+GFPDHP
Sbjct: 54  MPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHP 113

Query: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197
           HHGQETITYV+ G+IAHEDFTG  G+L PGDLQFMTAG+GIVHSE+PV ME+G   RGLQ
Sbjct: 114 HHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQ 173

Query: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257
           LWVDLP+DLK  EPRYRNLR+ DIP+  P+ENL+V VISGKSY  ES+ DLAYTP+  Y+
Sbjct: 174 LWVDLPKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYY 233

Query: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDS 317
            +  KAGT F QE P DFN FLYV+KG+V+INEK+FK+NTAIFFD DGE + GQ  +DD+
Sbjct: 234 MLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDT 293

Query: 318 EFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAE 377
           EF ++GG+IL+QP+VQ GPFVETD++KL + F ++E Y  GFERA+ W S+I  GI E+E
Sbjct: 294 EFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESE 353

Query: 378 AREL 381
           A++L
Sbjct: 354 AKQL 357

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  422 bits (1086), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/328 (60%), Positives = 253/328 (77%), Gaps = 7/328 (2%)

Query: 57  IKWGLEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRF 116
           + W    +  +N   + QE+ MS++   R+I  HF+  E  EG GARV+RSIG+ + R F
Sbjct: 19  VSWASSKYFMSN---KGQENRMSKV---RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNF 72

Query: 117 APFLMLDDFDVTPPAGFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGR 176
            PFLMLD F+VTPPAGFPDHPHHGQETITYVL GM+AHEDFTG  G+L PGDLQFMTAG+
Sbjct: 73  TPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGK 132

Query: 177 GIVHSEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVIS 236
           GIVHSEIPV ME+G    GLQLWVDLP+ LK  EPRYR+LR A+ PIA P++NLKV VIS
Sbjct: 133 GIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVIS 192

Query: 237 GKSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKEN 296
           G+SY V+S ++LAYTPVH YHF++ K GTPF Q+FP+DFNVF+YV+KG++ +N K F + 
Sbjct: 193 GESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQY 252

Query: 297 TAIFFDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYR 356
           +AIFF  DGE +EG  A+DD+EF LVGG IL QPVVQ GPFVET K++++QVF D++   
Sbjct: 253 SAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGM 312

Query: 357 NGFERAENWESNIRKGIKEAEA-RELRT 383
           NGFERA NW+S+I  GI +  A ++L++
Sbjct: 313 NGFERAHNWKSSISDGISQQNAEKQLKS 340

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  414 bits (1063), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 188/296 (63%), Positives = 241/296 (81%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           RSI  HF+  E  EG GARV+RS+G+ +QR F+PFLMLDDF V  PAGFPDHPHHGQETI
Sbjct: 5   RSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQETI 64

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TYVL+GM+AHEDFTG  G+L  GDLQFMTAG+GIVHSEIPV ME+G +C GLQ WVDLP+
Sbjct: 65  TYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLPK 124

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
           DLK  EPRYRNLR   IP+  P ENL V VISGKSY V+S+ DLAYTP+H+YH++T KAG
Sbjct: 125 DLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNKAG 184

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
           T + QEFPK+FNVF+YV+KG V + +++F E+TA+FF+ DG++++G+FATDD++F ++GG
Sbjct: 185 TQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAIMGG 244

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARE 380
           +IL+Q  +Q GPFVETD++ LM+VF +++   NGFERA+ W+S+I  GI E + RE
Sbjct: 245 QILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  414 bits (1064), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 258/360 (71%), Gaps = 12/360 (3%)

Query: 32  KYTIFGVIGLLACFVFQ-KIVLEPRRIKWGLEDFRQNNFNEEKQEDEMS---------RI 81
           K TI  +   LAC  ++   V E   IK G  + + +  ++ +  D++          RI
Sbjct: 22  KLTIVSLFIALACIYYKFSAVTEVHDIKLGARNDQDSMASQNRDYDQLKDNNDGINDDRI 81

Query: 82  IHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQ 141
              RSI+ HFI  E  EG GARV+RS+G+++ RRF PFLMLDDF V PP GFPDHPHHGQ
Sbjct: 82  Y--RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQ 139

Query: 142 ETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVD 201
           ETITYV  GMIAHED TG  G+L  GDLQFMTAG+GIVHSEIPVT ++G  CRGLQLWVD
Sbjct: 140 ETITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVD 199

Query: 202 LPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTI 261
           LP D+K I+PRYRNLR  + P+A P ENL+V VISGKSY VESL DLAYTPVHLYHF+  
Sbjct: 200 LPSDMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLAN 259

Query: 262 KAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVL 321
           K GT F+Q+ P+DFNVF+YV+KG++ +N+      ++ FFDVDG +I G+  ++D++F +
Sbjct: 260 KTGTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAI 319

Query: 322 VGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381
           + G IL+Q V+Q GPFVET+++KLM+VF +++  +NGFE A +W S+I  GI E EA +L
Sbjct: 320 IAGRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKL 379

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  410 bits (1053), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 242/307 (78%)

Query: 74  QEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGF 133
           Q + MS+ +  RSII +F+  +  EG GA V+RSIG+ + RRF+PFLMLD F V+PPAGF
Sbjct: 54  QSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGF 113

Query: 134 PDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSC 193
           PDHPHHGQETITY+L GM+AHEDF+   GILSPGDLQFMTAG+ I+HSEIPV M++G   
Sbjct: 114 PDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPA 173

Query: 194 RGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPV 253
            GLQLWVDLP+ LK  EPRYR+L+A DIP+  P E+LKV VISG SY V+S  DLAYTPV
Sbjct: 174 VGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPV 233

Query: 254 HLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFA 313
           H YHF T K GT F+QEFP+ FN F+Y++KG++ I EK+F + + +FFD DG+++EG  A
Sbjct: 234 HYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSA 293

Query: 314 TDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGI 373
           +D++EFVL+GGEIL+Q VVQ GPFVET++++L++VF ++++  NGF+R  NW S I  GI
Sbjct: 294 SDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGI 353

Query: 374 KEAEARE 380
            E+EA++
Sbjct: 354 TESEAKK 360

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/351 (55%), Positives = 254/351 (72%), Gaps = 2/351 (0%)

Query: 33  YTIFGVIGLLACFVFQKIVLEPRRIKW--GLEDFRQNNFNEEKQEDEMSRIIHQRSIINH 90
           +T+ G+I   +C          +   +  G E   +   N +  +  MS+ I  RS++ +
Sbjct: 20  FTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINYQFNDGIMSKSISVRSVLKN 79

Query: 91  FIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETITYVLSG 150
           FI  E  EG GARV+RSIG+ + RRF PFLMLDDF V PPAGFPDHPHHGQETITY L G
Sbjct: 80  FIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETITYNLKG 139

Query: 151 MIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQDLKTIE 210
           MIAHEDFTG  G+L PGDLQFMTAG+GIVHSEIPV++E+G +  GLQLWVDLP +LK  E
Sbjct: 140 MIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPAELKNCE 199

Query: 211 PRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQE 270
           PRYR+LR    P     +NL V VISGKSY V+S+ +LAYTPVH YHF+T K GT F QE
Sbjct: 200 PRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKGTEFAQE 259

Query: 271 FPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGGEILNQP 330
           FPKDFNVF Y++KG++ +N+++F E++A+FFD DGE + G   +DD+EFVL+GG+IL+Q 
Sbjct: 260 FPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGGKILDQE 319

Query: 331 VVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381
           V+Q GPFVET +++++ VF +++   NGFE A +W+S I  GI EAEAR+L
Sbjct: 320 VLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKL 370

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/355 (54%), Positives = 247/355 (69%), Gaps = 16/355 (4%)

Query: 27  NVYNAKYTIFGVIGLLACFVFQKIVLEPRRIKWGLEDFRQNNFNEEKQEDEMS-RIIHQR 85
           +V   KY +   + L+   VFQ               F+     ++  ED  +     +R
Sbjct: 18  SVSLGKYILIAALVLVLTVVFQ---------------FKSPTVMDQVNEDSATAESQKER 62

Query: 86  SIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETIT 145
           SI+ HFI  E  EGDGA V+RS+GS++  RF+PFLMLDDF VTPP GFPDHPHHGQETIT
Sbjct: 63  SILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETIT 122

Query: 146 YVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQD 205
           YV  G++AHEDFTG  G+L PGDLQFMTAG+GIVH E+PVTM +     GLQ WVDLP D
Sbjct: 123 YVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPAD 182

Query: 206 LKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAGT 265
           LK  EPRYRNLRA  IP+    +NL V VISGKSYDVES+ DLAYTP+  Y+F++ KAGT
Sbjct: 183 LKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAGT 242

Query: 266 PFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGGE 325
            F QE P DFN F+YV KGA+ I E++FK ++++FF  DG  I G  A+D++EF ++GG+
Sbjct: 243 EFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGGK 302

Query: 326 ILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARE 380
           IL+Q VVQ GPFVET ++KL++VFD++ +  NGFE+A  W+S+I  GI E  ARE
Sbjct: 303 ILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTARE 357

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 238/300 (79%), Gaps = 3/300 (1%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPP-AGFPDHPHHGQET 143
           R+I+ +FIP+E  EG GARV+R+IG++E  RF PFLMLD F VTPP  GFPDHPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 144 ITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLP 203
           ITY+L GMIAHEDFTG  G+L PGDLQFMTAG+GIVHSE+PV M++G    GLQLWVDLP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 204 QDLKTIEPRYRNLRAADIPIAMP--YENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTI 261
           ++LK  EPRYRNLR  +IPI      +++ V VISG +Y V+S+ DLAYTP+H YH+++ 
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 262 KAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVL 321
           KAG  F Q  P DFNVFLYV+KGAV+I+++IFK+NTA+FF+VDG SI+GQ AT+D+EF +
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312

Query: 322 VGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381
           +GG+IL+QP+VQ GPFVET ++ L +VF++++   NGFERA NW S+I  GI E  A  L
Sbjct: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  389 bits (1000), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 178/294 (60%), Positives = 228/294 (77%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           RSI+ HFI  E  EG GARV+RSIG+ + R+F+PFLMLD F+V PPAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TYV  GM+AHEDFTG  GIL PGDLQFMTAG+ + HSE+PV MENG    GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
           +LK  EPRYR+L   +IPIA P ENL++ VISGKSY +ES+ DLAYTPV  Y +   K G
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
           + F Q+F +D+NVFLY++KG+V I  ++F ++++IFF+ DG++++G   +DD+EF ++GG
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEA 378
           +IL Q  VQ GPFVE   +KL++VF ++ESY  GFERA NW S+IR GI E++A
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 230/298 (77%)

Query: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137
           M++ +  RS++  F+  E  EG GA V+RSIGS +QR F+PFL++D+F V+ PAGFPDHP
Sbjct: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60

Query: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197
           HHGQETITYVL GMIAHEDFTG  G+L PGDLQFMTAG+ I+HSEIPV M NG +  G+Q
Sbjct: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120

Query: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257
           LWVDLP+ LK  EPRYRNLRA +IPI  P ++L V V+SGKSY VES+ DLAYTP+  Y 
Sbjct: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180

Query: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDS 317
             T K GT F+QEFP DFNVFLY+IKG+V IN+ +  + + IFF  DG++I+G  A++D+
Sbjct: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240

Query: 318 EFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKE 375
           EFVLVGG+IL+QP++Q GPFVE+D++ L++VF +++   NGFERA  W S I  GI E
Sbjct: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHE 298

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  386 bits (991), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 181/294 (61%), Positives = 229/294 (77%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           R+I  HF+  E  EG GARV+RS+GS  QR F PFL+LD F V+ PAGFPDHPHHGQETI
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TYV +GMIAHEDFTG  GIL PGDLQFMTAG+GI+HSEIPV MENG +  GLQLWVDLPQ
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
           ++K  EPRYRNLR  +IPI  P E+LKV VISG+SY VES+ +LAYTPV  YHF++ K G
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
           T F+Q+ P++FN FLYV+KG+V I ++ F + + IFF+ DG  I+G  + DD+EF ++GG
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEA 378
            IL+QPV+Q GPF+E+ ++KL++VF +F+   NGFERA  W+S+IR GI E + 
Sbjct: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 304

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  382 bits (980), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/301 (59%), Positives = 228/301 (75%)

Query: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137
           MS+  + RSI  HFI  E  EG GARV+RSIG+   R+F+PFLMLD F+V P AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197
           HHGQETITYV  GMIAHEDFTG  G+L  GDLQFMTAG+ I H+E+PV   +G    GLQ
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257
           LWVDLP D+K  EPRYR+LR  DIP A P ++L++ VISG SY V+S+ DLAYTP+  Y 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDS 317
           +   KAGT F Q+F +DFNVF+YV+KGAV I +++F + ++IFF+ DG+++ G  A DD+
Sbjct: 181 YRGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDT 240

Query: 318 EFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAE 377
           EF ++GG+IL+Q  VQ GPFVE  K+KL++VF D++SY NGFERA NW S+IR GIKE +
Sbjct: 241 EFAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDD 300

Query: 378 A 378
           A
Sbjct: 301 A 301

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  384 bits (986), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 229/294 (77%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           R+I  HFI  E  EG GARV+RS+GS  QR F+PFL+LD F V+ PAGFPDHPHHGQETI
Sbjct: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TYV  GMIAHEDF G  G+L PGDLQFMTAG+GI+HSEIPV MENG +  GLQLWVDLP+
Sbjct: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
           D+K   PRYRNLR  +IPIA P E+LK+ VISGKS+ ++S+ +LAYTPV  YH+++ K G
Sbjct: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
           T F+QE P +FNVFLYV+KGAV I+ ++F + + +F++ +G++I G    DD+EF ++GG
Sbjct: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEA 378
            IL+QPV+Q GPFVET ++K+++VF +F+   NGFERA  W+S+IR GI E + 
Sbjct: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  377 bits (967), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 228/301 (75%)

Query: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137
           MS+  + RSI  HFI  E  EG GARV+RSIG+   R+F+PFLMLD F+V P AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197
           HHGQETITYV  GMIAHEDFTG  G+L  GDLQFMTAG+ I H+E+PV   +G    GLQ
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257
           LWVDLP D+K  EPRYR+L+  +IP A P ++L+V VISG SY V+S+ DLAYTP+  Y 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDS 317
           +   KAGT F Q F +DFNVF+YV++GA+ I +++F + ++IFF+ DG+++ G  A D++
Sbjct: 181 YRGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNT 240

Query: 318 EFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAE 377
           EF ++GG+IL+Q  VQ GPFVE  K+KL++VF D++SY NGFERA NW+S+IR GIKE +
Sbjct: 241 EFAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEND 300

Query: 378 A 378
           A
Sbjct: 301 A 301

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  372 bits (954), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 230/299 (76%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           RSI+ +F   E  EG GA+V+RSIGS E R F PFLMLD F+V+PPAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TYVL GMIAHEDFTG  G+L PGDLQFMTAG+GI+HSEIPV +E+G    GLQLWVDLP 
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
            LK  EPRYR+L   +IP   P   L+V VISG+SY V S+++LAYTPVH YH++T K G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
           T F Q FP +FNVF+YV+KG+V++N K F + +++FF+ DG  +EG  ++++SEF+L+GG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILIGG 244

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARELRT 383
           E+L+QP++Q GPFVET KQ + +V  +++S  NGFERA+ W S+I +G+  ++  ++ +
Sbjct: 245 EVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  371 bits (952), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/302 (59%), Positives = 223/302 (73%), Gaps = 1/302 (0%)

Query: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137
           MS++   RS+  +FI  E  EG GA V+RSIGS +QR F+PFL++D F V+ PAGFPDHP
Sbjct: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60

Query: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197
           HHGQETITYVL+GMIAHEDFTG  G+L PGDLQFMTAG+ I+HSEIPV MENG    G+Q
Sbjct: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120

Query: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257
           LWV LP DLK  EPRYRNLR   IPI  P ENL V VISGKSY  ES+ DLAYTP+  Y 
Sbjct: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180

Query: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATD-D 316
           F   K G  F QE P++FN FLY+ KGAV IN  ++ + + +FFD DG+SI+G+ A D +
Sbjct: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240

Query: 317 SEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEA 376
           +EF ++GG IL+QP++Q GPFVETD++ L+QVF +++   NGFERA  W S+I  GI E 
Sbjct: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

Query: 377 EA 378
           + 
Sbjct: 301 DV 302

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  364 bits (934), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 222/296 (75%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           RS++ HF+  E  EG GA VKRSIG+ + R F PFLMLD+FDV+PPAGFP+HPHHGQETI
Sbjct: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQETI 69

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TYVL GM+AHEDFTG  G+L  GDLQFMTAG+ IVHSEIPV M+NG S +GLQLWVDLP 
Sbjct: 70  TYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLPN 129

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
           D+K +EPRYR+LR  +IP+A P +NL V VISG+SY V+SL +LAYTPV  YHF+  K  
Sbjct: 130 DIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKKN 189

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
           T F Q F  DF+ F+Y++KG++ I+++ + E++AIFF  DG+ I G   +D++EF ++ G
Sbjct: 190 TEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIAG 249

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARE 380
           +  NQ VVQ GPFVE+ ++ ++ V  ++++  NGFE A  W   I+ G+ EAE ++
Sbjct: 250 KYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  351 bits (900), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/297 (54%), Positives = 214/297 (72%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           RSI+ +F   E  EG GA+V+RSIG+ + R F PFLMLD F + PPAGFPDHPHHGQET+
Sbjct: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           T++L G +AHEDFTG  G+L  GDLQFMTAG+G VHSEIPV +E+G    G+QLWVDLP 
Sbjct: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
            LK  +PRYR+L+   IP A     L + VISG+SY V+S+ +LAYT VH YH+V  +A 
Sbjct: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
             F Q FP DFNVFLYV+KG + I  + F ++++IFF  DG  + G   ++D EF+L GG
Sbjct: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381
           +IL+QP+VQ GPFVET K+++M+VF +++S  NGFE+A  W S+I  GI E++  + 
Sbjct: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDF 315

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/293 (55%), Positives = 220/293 (75%)

Query: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144
           RS+   F   E  EG GA V+RSIG   QR F+PFL+LD F V+ P+GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204
           TY+  GMIAHEDFTG  GIL PGDLQFMTAG+GIVHSEIPV  ++  +  GLQLWVDLP+
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264
           ++K   PRYRNLRA++IPIA P E+LKV VISGKSY VES+ +LAYTPV  YH+++ K G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324
             F+QE P+++N FLYV++G+V+++ + + + + IF++ +G +I+G     ++EF ++ G
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAE 377
            IL+Q +VQ GPFVET  +K+ +VF +++   NGFE+A NWES+I  GI E +
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKD 298

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score = 34.7 bits (78), Expect = 0.50,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 216  LRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDF 275
            L A    + +P    K+ V   K+ + E L   + T   ++HF+      PF +   KDF
Sbjct: 1099 LIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDF 1158

Query: 276  NVFLYVIKGAVLINEKIFKENTAIF-FDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQ 334
            +   Y  +G +L++   F   T +       E++ G     DSEF      +    V+Q 
Sbjct: 1159 S---YKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGISKRSDSEFPFNASAV---DVIQI 1212

Query: 335  GPFVETDKQKLMQV 348
             P +  D+  L  +
Sbjct: 1213 MPMIIKDRNYLTSI 1226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,628,353
Number of extensions: 2032957
Number of successful extensions: 5218
Number of sequences better than 10.0: 22
Number of HSP's gapped: 5321
Number of HSP's successfully gapped: 22
Length of query: 383
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 272
Effective length of database: 40,753,473
Effective search space: 11084944656
Effective search space used: 11084944656
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)