Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G026606.25ON73573538290.0
KNAG0M012306.25ON73874020610.0
NCAS0H008606.25ON75575520550.0
Kpol_1037.296.25ON74674620210.0
NDAI0D008506.25ON79076920150.0
YOR001W (RRP6)6.25ON73374420010.0
Suva_15.1766.25ON74574019880.0
Skud_15.1626.25ON73473319680.0
TPHA0J003706.25ON74374419590.0
Smik_15.1706.25ON77373719560.0
SAKL0E01452g6.25ON73773719380.0
TDEL0G044406.25ON73575119250.0
ZYRO0C07678g6.25ON74174719100.0
CAGL0E02585g6.25ON73774118840.0
KLLA0D01309g6.25ON74475018520.0
ACL001C6.25ON74575818070.0
TBLA0A071706.25ON77176218060.0
Kwal_56.224476.25ON73574217420.0
Ecym_30306.25ON74754517270.0
KLTH0C11066g6.25ON73574716760.0
YNL273W (TOF1)1.79ON1238155781.1
KAFR0G004208.860ON37446761.4
KNAG0F020906.194ON620140743.1
NDAI0C048408.423ON94868734.6
TBLA0J009605.658ON1018132725.2
NDAI0C032305.94ON103494717.4
TBLA0H036808.555ON183391709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G02660
         (735 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...  1479   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   798   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   796   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   783   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   780   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   775   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   770   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   762   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   759   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   758   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   751   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   746   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   740   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   730   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   717   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   700   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   700   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   675   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   669   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   650   0.0  
YNL273W Chr14 (122883..126599) [3717 bp, 1238 aa] {ON}  TOF1Subu...    35   1.1  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     34   1.4  
KNAG0F02090 Chr6 complement(397433..399295) [1863 bp, 620 aa] {O...    33   3.1  
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    33   4.6  
TBLA0J00960 Chr10 complement(215541..218597) [3057 bp, 1018 aa] ...    32   5.2  
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    32   7.4  
TBLA0H03680 Chr8 (893779..899280) [5502 bp, 1833 aa] {ON} Anc_8....    32   9.6  

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score = 1479 bits (3829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/735 (98%), Positives = 721/735 (98%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI
Sbjct: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120
           DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT
Sbjct: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
           TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA
Sbjct: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240
           HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE
Sbjct: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240

Query: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300
           HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL
Sbjct: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360
           QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA
Sbjct: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360

Query: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420
           YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE
Sbjct: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420

Query: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480
           KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP
Sbjct: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480

Query: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540
           AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS
Sbjct: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540

Query: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQL 600
           QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQL
Sbjct: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQL 600

Query: 601 VSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVV 660
           VSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVV
Sbjct: 601 VSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVV 660

Query: 661 LKKVNRQPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAASNEGPKAA 720
           LKKVNRQPNKTKLEENEKIDFIDYSKSEKIL              QFDPFAASNEGPKAA
Sbjct: 661 LKKVNRQPNKTKLEENEKIDFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASNEGPKAA 720

Query: 721 RKRKSGTRGRNLSYK 735
           RKRKSGTRGRNLSYK
Sbjct: 721 RKRKSGTRGRNLSYK 735

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/740 (53%), Positives = 520/740 (70%), Gaps = 14/740 (1%)

Query: 4   EEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDEN 63
           EEQKKLLS  V TVRASS+L  QDV F+ +LD+ V+ S+ E+ +E+ +M+N I+ SIDEN
Sbjct: 4   EEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDEN 63

Query: 64  YETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKP-TNPPFEYFENATTTE 122
            +   E  E++ ESW+  +N+ DNLFEKSDRS+DI+  G +K        +Y ++    +
Sbjct: 64  SKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGND 123

Query: 123 NIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHP 182
           +   KRI KPQL F  P+DNSES PF PLL EKPNALK + ES +++ + EN+P HY +P
Sbjct: 124 SSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNP 183

Query: 183 YEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHH 242
           Y+YEI NQ YN+ IL+ R PIPS  W E+E VWVD+ E L  +L D+KKY E+AIDLEHH
Sbjct: 184 YDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHH 243

Query: 243 DYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQR 302
           DYR+YYGIVCLMQISTR+TDYLVDTIALR++L +LN+VFTDP V KV HGAFMDIIWLQR
Sbjct: 244 DYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQR 303

Query: 303 DLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYA 362
           DLGLYIVSLFDTFHAS+ALGFP+HSLAYLLE  ANFKTSKKYQLADWR+RPLSK M+ YA
Sbjct: 304 DLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYA 363

Query: 363 RADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKE 422
           RADTHFLLNI+DQ+RN+L++ NKL GVL ESR VAKRRFEYSKFRP++  P+V++ +EKE
Sbjct: 364 RADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKE 423

Query: 423 DPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAG 482
            PWRTLMFQYN+  E+E+L+K L+EWRD IARRDDESPRYIMPNQL+++L AYTPTDP  
Sbjct: 424 SPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVS 483

Query: 483 VISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQI 542
           ++S +  VTD VRSNSK++ANLIK+ +  +K    Q  +  +    E+  +   +T+SQI
Sbjct: 484 LVSVNSYVTDCVRSNSKVLANLIKSFVESSK-LGPQSSYTPNT---ENTSTPFVLTLSQI 539

Query: 543 KETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVS 602
           K+    F ++ E   + +   Q+     RS++FG LSK    + Y + +   V Q  L S
Sbjct: 540 KDIGMRFTKLTENFQSSSC--QKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLES 597

Query: 603 RFNTYTKQVNELTNVRYELPVHKEP----PQLQKDDVEEVKKTIIADSIPAKPEIDLDEV 658
           R   + + +    ++ Y++P   EP    P        E   +   +  P   + D+DE+
Sbjct: 598 RSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDMDEI 657

Query: 659 VVLKKVNRQ-PNKTKLEENEKIDFIDYSKSEKILXXXX--XXXXXXXXXXQFDPFAASNE 715
           VVLKKV R+ P     +E+ + + +DYSK +K+L                +FDPF+A +E
Sbjct: 658 VVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFSAISE 717

Query: 716 GPKAARKRKSGTRGRNLSYK 735
           GPKA +KRK+ T+G+N S+K
Sbjct: 718 GPKAPKKRKAVTKGKNASFK 737

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/755 (53%), Positives = 529/755 (70%), Gaps = 30/755 (3%)

Query: 4   EEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDEN 63
           E++K LL  VVNTVRA+S LAAQDVDFYRS+D +++HS+ + ++++ DM+NS++LSIDEN
Sbjct: 7   EQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDEN 66

Query: 64  YETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTEN 123
            E +D  KE L + WK   N++DNLFEKSDRS+DI+  G          +Y +  +  + 
Sbjct: 67  SEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDL 126

Query: 124 IPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPY 183
            P K+I KPQLKF  PIDN+ESHPFIPLLKEKP ALK ++ES ++I  DE  P HY  PY
Sbjct: 127 TPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPY 186

Query: 184 EYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHD 243
           EYEID+Q YND ILQ ++PIPS SW++ E +WVD V  L  ++ D++  TEIA+DLEHHD
Sbjct: 187 EYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHD 246

Query: 244 YRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRD 303
           YRTYYGI CLMQISTR+ DYL+DT+ALR DL++LN VF +P + KV HGAFMDIIWLQRD
Sbjct: 247 YRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRD 306

Query: 304 LGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYAR 363
           LGLY+V LFDTFHASRA+G P+HSLAYLLE+FA FKTSKKYQLADWR+RPLSKAM AYAR
Sbjct: 307 LGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYAR 366

Query: 364 ADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPN--VYSALEK 421
           ADTHFLLNI+DQ+RN L+E NKL GVL ESRNVAKRRFEYS FRP+V   N  VYS +EK
Sbjct: 367 ADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEK 426

Query: 422 EDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPA 481
           +DPW+T+MFQYNIP ++E LLK L++WRD IARRDDESPR++MPNQL+V+LVAYTP D  
Sbjct: 427 DDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAP 486

Query: 482 GVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRE--------SYRS 533
           GV+S S  VTDYVRSNSKI+ANLIKN L + KD     +F+ +N   E         +  
Sbjct: 487 GVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDN----KFLDNNVAEEGISVVPETGHDL 542

Query: 534 TDKMTVSQIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDI-IEYKNGEK 592
           + K+T+ Q++   S F  +++K    N+ + +  +  +   F  +S   D+ I+Y    K
Sbjct: 543 SQKLTIHQLQNLKSKFQLLSDKFN--NSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK 600

Query: 593 HSVKQQQLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQ-KDDVEEVKKTIIADS----I 647
                +Q   R   +   + +L  V Y +PV +E  Q Q +D++  +     A+     +
Sbjct: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEM 660

Query: 648 PAKPEIDLDEVVVLKKVNRQ---PNKTKLEENEKIDFIDYSKSEKILXXXXXXXXX---- 700
             KPE DLDEV+VL+K N+     NK K  E  +++ IDY K+ K+L             
Sbjct: 661 IEKPE-DLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNN 719

Query: 701 XXXXXQFDPFAASNEGPKAARKRKSGTRGRNLSYK 735
                +FDP++A+NEGP A +KRK+ TRG+N+S+K
Sbjct: 720 GNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/746 (53%), Positives = 528/746 (70%), Gaps = 24/746 (3%)

Query: 7   KKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYET 66
           K+LLS VV+TVRA+S+LAAQDVDFYR+LD E+S S+NE + E+ +M+N+++LSI+EN E 
Sbjct: 7   KELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEE 66

Query: 67  LDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQ 126
           L+ GKE L + WK  SN++DNLFEKSDRSLDI+            F+Y  ++  +++ P 
Sbjct: 67  LESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPS 126

Query: 127 KRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYE 186
           KR+ KPQL+F  P+DNSES PF+PLL +KP+++K+  +S  +I   E +P HYAHPYE E
Sbjct: 127 KRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVE 186

Query: 187 IDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRT 246
           ID Q YN S+LQV EP+ S+ W+ +E  WVD  E+L  ML+ +K+ TEIA+DLEHHDYR+
Sbjct: 187 IDKQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRS 245

Query: 247 YYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGL 306
           YYGIVCLMQISTR+ D+LVDT+ALR++L +LNEVF DP+++KVLHGAFMDIIWLQRDLGL
Sbjct: 246 YYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGL 305

Query: 307 YIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADT 366
           Y+VSLFDT+HASRALGFPRHSLAYLLE++ANFKTSKKYQLADWRVRPLSK M AYARADT
Sbjct: 306 YVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADT 365

Query: 367 HFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWR 426
           HFLLNIYDQ+RN+L+  NKL  VL ESRNVAKRRFEYS+FRP+VPSP V++ +EKE+PWR
Sbjct: 366 HFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWR 425

Query: 427 TLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISA 486
           TL++QYN+PS + +LLK ++EWRDMIARRDDESPRYIMPNQLM++LV YTP DPAGVIS 
Sbjct: 426 TLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISV 485

Query: 487 SQVVTDYVRSNSKIIANLIKNALTRAKD--QNRQLQFVADNHTRESYRSTDKMTVSQIKE 544
           S V+TD+VRSNSK+IANLIK +L   K         F   ++      ++DK+T+SQI+ 
Sbjct: 486 SNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQN 545

Query: 545 TASVFIQIAEKLGTCNND-QQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVSR 603
             ++F +IA        D  ++      SN F S   K +I+ Y + ++H V  +QL  R
Sbjct: 546 MTALFKEIASNPSIIEKDVSKKIDPILFSNIFLS---KNEIVLYDHDKRHVVTNEQLAGR 602

Query: 604 FNTYTKQVNELTNVRYELPV------HKEPPQLQKDDV---EEVKKTIIADSIPAKPEID 654
                  +NE  N    + +      H E P+ ++ +      +     A S       D
Sbjct: 603 AEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFED 662

Query: 655 LDEVVVLKKVNRQPNKTKLEENEKI---DFIDYSKSEKILXXXXXXXXXXXXXXQFDPFA 711
           +++++VLK V ++ N    ++ + +   + IDYSK + IL              + DPF 
Sbjct: 663 MNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTIL---SKEKRENSKKRKGDPFG 719

Query: 712 ASN--EGPKAARKRKSGTRGRNLSYK 735
             N  EGPKAA+KRK   RG+N+S+K
Sbjct: 720 EENGLEGPKAAKKRKQINRGKNVSFK 745

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/769 (52%), Positives = 527/769 (68%), Gaps = 47/769 (6%)

Query: 8   KLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETL 67
           +LL  VV TVRAS  LAAQDVDFYRS+D   + ++ E T +L DM+NS++L++DEN ETL
Sbjct: 27  QLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETL 86

Query: 68  DEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQK 127
           D  KE L ++WK  SN++DNL EKSDRS+D+L         N   +Y +  +  ++   K
Sbjct: 87  DGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSSK 146

Query: 128 R--INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEY 185
           R  I KPQL+F  P+DN+E+HPFIPLLK KPNALK++DES +L+  DENVPEHYA PYEY
Sbjct: 147 RRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEY 206

Query: 186 EIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYR 245
           EIDNQPYND ILQ+ +PIPS+ W ET  +WVD  ESL  M+ D+   TE A+DLEHHDYR
Sbjct: 207 EIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYR 266

Query: 246 TYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLG 305
           TYYGIVCLMQISTR  DY+VDT+ LR+ L+ LNE FT+P + KVLHGAFMDIIWLQRDLG
Sbjct: 267 TYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLG 326

Query: 306 LYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARAD 365
           LYIVSLFDTFHASRALGFP++SLAYLLE+F+NFKTSKKYQ+ADWR+RPLSKAM +YAR+D
Sbjct: 327 LYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSD 386

Query: 366 THFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPW 425
           THFLLNI+DQ+RN+LV+  KL GVL ESRNVAKRRFEY K+RP + S  VYS +EK DPW
Sbjct: 387 THFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPW 446

Query: 426 RTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVIS 485
           +TLM+QYNIP  +E LLK L++WRD IARRDDESPRYIMPNQL+V+LVAY P +PAGV+S
Sbjct: 447 KTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVS 506

Query: 486 ASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRST--------DKM 537
            S +VTD+VRSNSKI+ANLIKN LT+ KD       +      +   ST        +++
Sbjct: 507 VSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQL 566

Query: 538 TVSQIKETASVFIQIAEKL----GTCNNDQQQSK--SFARSNYFGSLSKK--LDIIEYKN 589
           ++ Q+    S F+ +  K+    G  NN +   K  SF       S + +   + I+Y  
Sbjct: 567 SIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYSV 626

Query: 590 G--EKHSVKQQQLVSRFNTYTKQVNELTNVRYELPV----------HKEPPQLQKDDVEE 637
              +K  +  ++L+ R   + + + +L  V Y +P+           ++ P +   + E 
Sbjct: 627 SPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAE- 685

Query: 638 VKKTIIADSIPAKPEIDLDEVVVLKKVNRQPNKTKL------EENEKIDFIDYSKSEKIL 691
                I  ++ ++ + DLDE++VLKK NR   K +       ++  +I+ IDYSK EK+L
Sbjct: 686 -----ITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVL 740

Query: 692 XXX-----XXXXXXXXXXXQFDPFAASNEGPKAARKRKSGTRGRNLSYK 735
                              +FDP+  +NEGP+A +KRK+ TRG+N+S+K
Sbjct: 741 DNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/744 (53%), Positives = 513/744 (68%), Gaps = 21/744 (2%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           M  E    LLS V+N VRA+S+LA+QDVDFY++LD   S  +    D+L DM N IILSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120
           DE++E+ +  +E++++ W +  NI+DNL E SD SLD L      K      +Y    + 
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
               P KR+ KPQLKF  PIDNSESHPFIPLLKEKPNALK + ES +L++ DEN P HY 
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240
           HPYEYEID+Q Y+  ILQ+RE IPSKSW ++  +WVD    L  ML D+K   EIA+DLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300
           HHDYR+YYGIVCLMQISTRE DYLVDT+ LR +L +LNEVFT+PS+VKV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360
           QRDLGLY+V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR+RPLSK MTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420
           YARADTHFLLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK+RP  PS  VYS +E
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480
           KE PW+ LM+QYNIP ERE L++ L++WRD+IARRDDESPR++MPNQL+  LVAYTPTD 
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540
            GV+S +  VT++VR N+K++ANLI++AL   K+ N +   +  + T+      + ++V 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKL-----DIIEYKNGEKHSV 595
           QI++    F  +      CN++  +S++   +N    L K L     DI   K+G  + V
Sbjct: 541 QIRDVMERFSVL------CNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKV 594

Query: 596 KQQQLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEID- 654
           K + +  R   +   +  L ++ +E+    E P +    +EE+K    A +    PEID 
Sbjct: 595 KTEDIRIRAQNFKSALANLEDIIFEI----EKPLVVPVKLEEIKTVDPASAPNHSPEIDN 650

Query: 655 LDEVVVLKKVN---RQPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFA 711
           LD++VVLKK N   +QP K K    EK D +DYSK   IL              +FDP +
Sbjct: 651 LDDLVVLKKKNIQKKQPAKEK-GVTEK-DAVDYSKIPNILSNKPGQNNRQQKKRRFDPSS 708

Query: 712 ASNEGPKAARKRKSGTRGRNLSYK 735
           + + GP+AA+KR+   +G+NLS+K
Sbjct: 709 SDSNGPRAAKKRRPAAKGKNLSFK 732

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/740 (52%), Positives = 523/740 (70%), Gaps = 19/740 (2%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           M  E    LLS VVN +RA+S+LAAQDVDFYR+LD + S  +   + +L +MVN I+LSI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120
           DE++++L+  +EE+++ WK   NI+DNL EKSD SLD L   +    +    +Y  + + 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
            ++ P KR+ KPQLKF  PIDNSESHPFIPLLKEKPNALK + +S ++I ++EN P HY 
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240
           HPYEYEID+Q YN +ILQ++  IPSK W  +E +W+++  +L  ML D+K   EIA+DLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300
           HHDYR+YYG+VCLMQ+STRE DYLVDT+ LR DL +LNEVFT+PS+VKV HGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360
           QRDLGLY+V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR+RPLSK MTA
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420
           YARADTHFLLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK+RP  PS  VYS  E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480
           KE+PWR LM+QYNI  ERE+L+K L+EWRD+IARRDDESPR+IMPNQL+  LVAYTP D 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540
            GV+S S  VTD+VR N+KI+ANLIK+AL   KD +++   +  +  + +  S + +TVS
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSA--SLEAITVS 556

Query: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSL--SKKLDIIEYKNGEKHSVKQQ 598
           QI++    F   +    T   + +   S A S  FG +   ++ DI+   +G  H VK +
Sbjct: 557 QIRDIMDRFSVFSSNSVT---EDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVE 613

Query: 599 QLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEV 658
            +  R   +   +  L ++++E+   ++P  ++K ++ +++ T      P K E D DEV
Sbjct: 614 DMRDRAQRFNSALVGLEDIKFEV---EKPVNVEKSEMVKIETT---PEPPTKIE-DPDEV 666

Query: 659 VVLKKVNRQPNKTKLEENEKI---DFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAASNE 715
           VVLKK  ++ +K ++ +   +   + +DYSK   +L              +FDP    +E
Sbjct: 667 VVLKK--KRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSE 724

Query: 716 GPKAARKRKSGTRGRNLSYK 735
           GP+A +K++  TRG+N+S+K
Sbjct: 725 GPRAPKKKRPTTRGKNVSFK 744

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/733 (52%), Positives = 510/733 (69%), Gaps = 14/733 (1%)

Query: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68
           L S +V  VRA+S+LA+QDVDFY++L+ E S+ +   +D+L DMVN IILSIDE++E+ +
Sbjct: 9   LFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFE 68

Query: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128
             ++E++  WK   NI+DNL E SD SLD L   A  K +    +Y  + +  +++  KR
Sbjct: 69  LKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKR 128

Query: 129 INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188
           + KPQLKF   IDNSESHPFIPLLKEKPNALK + ES +L  ++EN P HY HPY YEID
Sbjct: 129 LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYAYEID 188

Query: 189 NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248
           +Q Y+  +LQ+++ IPSKSW ++E +W+D    L  ML D+K  +EIA+DLEHHDYR+YY
Sbjct: 189 HQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYY 248

Query: 249 GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308
           GIVCLMQ+STRE DYLVDTI LR+ L +LNEVFTDP +VKV HGAFMDIIWLQRDLGLY+
Sbjct: 249 GIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYV 308

Query: 309 VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368
           V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR RPLSK MTAYARADTHF
Sbjct: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHF 368

Query: 369 LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428
           LLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK RPR PS  VYS +EKE+PWR L
Sbjct: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVL 428

Query: 429 MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488
           M+QYNI SE+E+L+K L+ WRD IARRDDESPR++MPNQL+  LVAY P D  GV+S + 
Sbjct: 429 MYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTN 488

Query: 489 VVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETASV 548
            VT++VR N+K++ANLI+NAL   KD N++   +  + ++    S + +T+SQI++    
Sbjct: 489 GVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITISQIRDIMER 548

Query: 549 FIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEY-KNGEKHSVKQQQLVSRFNTY 607
           F  ++   G  NN  +   S +      +L  +   I Y K G  + VK + + +R   +
Sbjct: 549 FSLLSNS-GVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDIKARAQKF 607

Query: 608 TKQVNELTNVRYEL--PVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVVL---K 662
              +  L N+ +EL  PV   P  ++K +  E++    A  +P+K E   D+++VL   K
Sbjct: 608 NSALAGLENIMFELEKPV-TVPASVEKGEAVEIES---APELPSKAE-SFDDIIVLKKKK 662

Query: 663 KVNRQPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAASNEGPKAARK 722
              +QP K K  +    + +DYSK   +L              +FDP +  +EGP+AA+K
Sbjct: 663 MHKKQPAKGK--DMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKK 720

Query: 723 RKSGTRGRNLSYK 735
           ++   RG+N+S+K
Sbjct: 721 KRPAPRGKNMSFK 733

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/744 (51%), Positives = 511/744 (68%), Gaps = 22/744 (2%)

Query: 8   KLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETL 67
           +LL  VV++VRA+S LAAQDVDFYRSLD E++ S+   + ++ DM+NSII S+DEN E L
Sbjct: 5   ELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGL 64

Query: 68  DEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQK 127
            EGKE L ESWK + N++D+LFE +D S+D L   ++K   +P  +Y  ++   E+    
Sbjct: 65  VEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVT 124

Query: 128 RINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEI 187
           R++KPQL F  P+DNSE+HPF PLL +KPNA+  +DE  K+++  E+ P+HY  PYE EI
Sbjct: 125 RLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEI 184

Query: 188 DNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTY 247
           D Q YN+ +LQ  +PIPSK W ETE +WVDN ESL  MLN++K  TE+A+DLEHHD+R+Y
Sbjct: 185 DKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSY 244

Query: 248 YGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLY 307
           YGI CLMQISTR TDYLVDTIALR+ L+VLN VFTDP + K+LHGAFMDIIWLQRDLGLY
Sbjct: 245 YGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLY 304

Query: 308 IVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTH 367
           IVSLFDT+HASRALGFPRHSLAYLLE FA+FKTSK+YQLADWR RPLSKAM AYARADTH
Sbjct: 305 IVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTH 364

Query: 368 FLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRT 427
           FLLNI+DQLRN L++ +KL  +L+ESR VAKRRFEYSK++P +PS  V+S  E + PWR+
Sbjct: 365 FLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRS 424

Query: 428 LMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISAS 487
           +++QYNIPS++ +L+K L+EWRD IARRDDESPRYIMPNQL+ +LV Y PT+PAGVIS +
Sbjct: 425 MIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVN 484

Query: 488 QVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETAS 547
           +++TD VRSN+K IANLIK+ L   K+ N     V+    ++   S++ ++ SQIK   S
Sbjct: 485 RMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVS-TTAKDKETSSNDLSTSQIKFIVS 543

Query: 548 VFIQIAEKLGTCNND------QQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLV 601
            F  I EK  + N++      ++   S   S  F S   + DII Y  G KH + +QQL 
Sbjct: 544 QFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNS---RDDIITYDKGTKHLITEQQLS 600

Query: 602 SRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPA----KPEIDLDE 657
            R       + +   + + + V     +  K    E ++ I    +PA    + + DLDE
Sbjct: 601 DRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDE 660

Query: 658 VVVLK----KVNRQPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAAS 713
           ++VLK    + NRQ        +     IDYSK +KIL              ++DPF+A 
Sbjct: 661 IIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKIL--SQDNRRRTPNKRKYDPFSAD 718

Query: 714 N--EGPKAARKRKSGTRGRNLSYK 735
           N     + A++R+   + RN+S+K
Sbjct: 719 NNENALQGAKRRRPTAKNRNVSFK 742

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/737 (52%), Positives = 506/737 (68%), Gaps = 23/737 (3%)

Query: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68
           LLS VVN +RA+S+LA QDVDFY++LD E    +   +D+L DM N IILSIDE++E+ +
Sbjct: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108

Query: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128
              E+++  W    NI+DNL E SD SLD L      KP     +Y  + +     P KR
Sbjct: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKR 168

Query: 129 INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188
           + KPQLKF  PIDNSESHPFIPLLKEKPNALK + +S +LI  D+N P HY HPYEYEID
Sbjct: 169 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEID 228

Query: 189 NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248
           +Q Y  +ILQ+R+ IPSKSW+++E +W+D +  L  ML ++K   EIA+DLEHHDYR+YY
Sbjct: 229 HQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYY 288

Query: 249 GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308
           GIVCLMQISTRE DYLVDT+ LR  L +LNEVFTDPS+VKV HGAFMDIIWLQRDLGLY+
Sbjct: 289 GIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYV 348

Query: 309 VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368
           V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M AYARADTHF
Sbjct: 349 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHF 408

Query: 369 LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428
           LLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK+RPR+PS  VYS +EKE PWR L
Sbjct: 409 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVL 468

Query: 429 MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488
           M+QYNI SE+E+L+K L++WRD+IARRDDESPR++MPNQL+  LVAYTP D  GVIS + 
Sbjct: 469 MYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTN 528

Query: 489 VVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETASV 548
            +T++VR N+K++ NLIKN+L   KD  ++   V  + +  +  S + +T+ QI++    
Sbjct: 529 GITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMER 588

Query: 549 FIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDI----IEYK-NGEKHSVKQQQLVSR 603
           F      L   N    ++K+ A  +    L + L +    I YK NG  + VK + + +R
Sbjct: 589 F----SVLSNSNVSNCRAKNGATPSIL--LGRILPLEENDIAYKNNGLPNRVKFEDIRAR 642

Query: 604 FNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEI--DLDEVVVL 661
             ++   ++ L +   E+    E P +   +V+++++ I  + +P       + D++VVL
Sbjct: 643 AQSFNSALSNLEDCMLEV----EKPHILPTNVKKIER-INTEDVPKHSATIENPDDIVVL 697

Query: 662 KKVN---RQPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAASNEGPK 718
           KK N    Q    K    EK   IDYSK   +L              + DP    ++GP+
Sbjct: 698 KKKNIHRTQSMNAKDTMGEKA--IDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPR 755

Query: 719 AARKRKSGTRGRNLSYK 735
           AA+K++  TRGRN+S+K
Sbjct: 756 AAKKKRPATRGRNVSFK 772

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/737 (51%), Positives = 513/737 (69%), Gaps = 17/737 (2%)

Query: 8   KLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETL 67
           KLLS++V TVRA+S L+AQD+DF++SLDS +S S+   + +L +++N ++LSIDEN +T+
Sbjct: 8   KLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDTI 67

Query: 68  DEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQK 127
           + GK+   ESWK + +I+DNLFEKSD + D LK  +  +  N   +Y ++++ +   P K
Sbjct: 68  EYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQ-GNSNVQYLDDSSRSNLNPSK 126

Query: 128 RINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEI 187
           RI KPQL F  PIDN+ESHPF PLL+ KP+AL+ + E  K     EN+P HY HPY YEI
Sbjct: 127 RIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEI 186

Query: 188 DNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTY 247
           D Q YN+SILQ+R+PIPS+ W +T+ VWVD  ESL  +LN+++   EIA+DLEHHDYR+Y
Sbjct: 187 DTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSY 246

Query: 248 YGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLY 307
           YGIVCLMQISTRE D+LVDTIALR +L VLNE+FTDPSV+KV HGAFMDIIWLQRDLG+Y
Sbjct: 247 YGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIY 306

Query: 308 IVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTH 367
           +VSLFDT+HASR+LG PRHSLAYLLE+FA FKTSKKYQLADWR+RPL+K M AYARADTH
Sbjct: 307 VVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTH 366

Query: 368 FLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRT 427
           FLLNIYDQLRN L+E NKL  VL++SRNVAKRRFEY+ FRP++ S +V+S +EK++PWR 
Sbjct: 367 FLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWRN 426

Query: 428 LMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISAS 487
           LM+QYNIP  RE L++ L+EWRD IARRDDESPRY+MPNQL+V+LVA  PTDPAGV+S S
Sbjct: 427 LMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVS 486

Query: 488 QVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETAS 547
             +TDYVRSNSK+++NLIK  L   K+ +        +   E   S   +++SQI+    
Sbjct: 487 NFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQ-VLSISQIQNMCL 545

Query: 548 VFIQIAEKLGTCNNDQQQ----SKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVSR 603
            F  +A K+   N+        S  F   + F +    L    Y    K  + + QL  R
Sbjct: 546 QFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVL----YSKNSKIVIDENQLQER 601

Query: 604 FNTYTKQVNELTNVRYELPVH---KEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVV 660
               ++++ E+    + L V+   KE  ++ KD  E+      +++ P   E + DE++V
Sbjct: 602 KLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPL--ETNKDEIIV 659

Query: 661 LKKVNRQP--NKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAASNEGPK 718
           LKK  R    ++ K+  +  ++ +DY  +EK+L              +FDP+ + N GP+
Sbjct: 660 LKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSENVGPQ 719

Query: 719 AARKRKSGTRGRNLSYK 735
           +A+KRK  T G+N+S+K
Sbjct: 720 SAKKRKKPTPGKNMSFK 736

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/751 (51%), Positives = 515/751 (68%), Gaps = 41/751 (5%)

Query: 5   EQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENY 64
           E+ +LL  VV+T+RASS LAAQDVDF+RSL   +  S++E +  +  ++NS++ SID+N 
Sbjct: 5   EEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNS 64

Query: 65  ETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENI 124
           E L EGKE L E WK  SN++DNLFE SD S DIL      +      ++ +N+++ ++I
Sbjct: 65  EPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSI 124

Query: 125 PQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYE 184
           P KRI+KPQL F  P++N+E  PF+PLLKEKP AL+ +   + ++  ++ VPEHYA PYE
Sbjct: 125 PSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYE 182

Query: 185 YEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDY 244
           YEI++Q Y +S++   EPIPSK W  TE +WVDN+E L  M++D+K  TEIA+DLEHHDY
Sbjct: 183 YEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDY 242

Query: 245 RTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDL 304
           R+YYGIVCLMQISTRE DYL+DTIALR+DL++LNEVF +P ++KV HGAFMDIIWLQRDL
Sbjct: 243 RSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDL 302

Query: 305 GLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARA 364
           GLY+VSLFDTFHASRA+G PRHSLAYLLE+FANFKTSKKYQLADWR+RPLSKAM AYARA
Sbjct: 303 GLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARA 362

Query: 365 DTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDP 424
           DTHFLLNIYDQLRN L+E NKL GVL ESRNVAKRRFEYSKFRP  PSP VY  ++K DP
Sbjct: 363 DTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDP 422

Query: 425 WRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVI 484
           W+ LMFQY+I   RE+L+K L++WRD IARRDDESPRY+MPNQL+V L    PT+P  VI
Sbjct: 423 WKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVI 482

Query: 485 SASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKE 544
           S + +VTD+VRSNS ++A+LIKN L  +  ++ +  F ADN++ +   +   +TV QI++
Sbjct: 483 SVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTD---AASLLTVPQIQK 539

Query: 545 TASVFIQIAEKLGTCNNDQQQSKSFA-----------RSNYFGSLSKKLDIIEYKNGEKH 593
            A+ F  ++       N+ +  +S +             NY G+    +D I  K   K 
Sbjct: 540 LAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGN---NMDHITKKELGKR 596

Query: 594 SVKQQQLVSRFNTYTKQVNELTNVRYELPVHKE--PPQLQKDDVEEVKKTIIADSIPAKP 651
           + K  Q + +F+  T     +  +  E    +E  PP       EEVK++      P+ P
Sbjct: 597 AAKALQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPA-----PEEVKES------PSPP 645

Query: 652 EIDLDEVVVL----KKVNRQPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQF 707
           + D+DE++ L    K+ ++ P +  + E E I  +DY+K++K+L                
Sbjct: 646 KEDMDEIITLKKIKKQKSQSPKELGISERE-IPAVDYTKTKKVLATNQDKNKDKKKRKF- 703

Query: 708 DPFAASN---EGPKAARKRKSGTRGRNLSYK 735
           DP+AASN   + P+A +KRK   R RN+S+K
Sbjct: 704 DPYAASNHSSDAPRAPKKRKPVNRERNVSFK 734

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/747 (53%), Positives = 521/747 (69%), Gaps = 19/747 (2%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           M  E  ++LL  VV TVRA++ LAAQDVDFYRSLD  V+ S+++ ++EL  M+NS +L I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120
           D+N   L+ GKE+L +S K  SN++DNLFEKSDRSLDIL+  A  +       Y ++A  
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDR-KGAALMYLDDAAR 119

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
           ++ IP KRI KPQ++F  PIDN+E+HPF PLL+ KP+AL+ + +  +L+ +DE++PEHY 
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240
            PYEYEI+NQ YN+SIL++ EPIPSK W  +E VWVDN ESL+ ML D+KK TEIA+DLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300
           HHDYR+YYGIVCLMQ+STR+TDYLVDT+ALR+DL VLNEVF +P +VKV HGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360
           QRDLGLYIVSLFDT+HASRALGFPRHSLAYLLE FA+FKTSKKYQLADWRVRPLSKAM+A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420
           YARADTHFLLNIYDQLRN+L+  NKL GVL ESRNVAKR F+YSK+RP+VP+ +VYS ++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480
           + D W+ LM QYNIP E+E L+K L+EWRD IARRDDESPRY+MPNQL+  LV YTP DP
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540
            GVIS S  VTD+VR+N+K +ANLI  +L +  D    ++  +  H ++ +  +  +TV 
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQH-KDQHDLSQVLTVG 538

Query: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQL 600
           QI+   S F  +++     +     S S +   +   L      + Y    K  V  +Q+
Sbjct: 539 QIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQI 598

Query: 601 VSRFNTYTKQVNEL-----TNVRYE---LPVHKEPPQLQKDDVEEVKKTIIADSIPAKPE 652
             R    ++ +  +     T ++ E     +  EP   +K  V E  ++   ++   +PE
Sbjct: 599 EKRKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKK--VSENDESKKEEAKETEPE 656

Query: 653 IDLDEVVVLKKVNRQPNKTKLE-ENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFA 711
            D +E++ LKKV  +  K+K   E+E  + IDY KS+KIL               FDP+A
Sbjct: 657 EDKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETEKKSKSTKKRA--FDPYA 714

Query: 712 ASNE---GPKAARKRKSGTRGRNLSYK 735
           ASN+    PK  +KR+   RG++ S+K
Sbjct: 715 ASNDAGNAPKPKKKRRMA-RGKSASFK 740

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/741 (51%), Positives = 509/741 (68%), Gaps = 27/741 (3%)

Query: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68
           +L  V+ TVRAS+ LA+QDV+F++S+D+ V++S+ +    +  ++N+I+LSID N E LD
Sbjct: 9   VLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLD 68

Query: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128
              E L E  K  SN++D LFEK+DRSLDIL   +         ++ ++    EN P +R
Sbjct: 69  GTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 128

Query: 129 INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188
           I+KPQL F  P+DNSESHPF PLL EKPNALK+I+EST+L+ + E++PEH+  PYEYEI 
Sbjct: 129 ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEIL 188

Query: 189 NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248
           NQ YN+ IL+ +EPIPS SW +T  +WVDN+ SL  M+ ++KK +EIA+DLEHHD+R+YY
Sbjct: 189 NQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYY 248

Query: 249 GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308
           G+VCLMQISTR  DY+VDTIALR+DLK+LNEVFT+P + KV HGAFMDIIWLQRDLGLYI
Sbjct: 249 GLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYI 308

Query: 309 VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368
           VSLFDTFHAS+ALG P+HSLAYLLE++ANFKTSKKYQLADWR RPLSKAM AYARADTHF
Sbjct: 309 VSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHF 368

Query: 369 LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428
           LLNI+DQ+RN L+ + KL GVL ESRNVA RRFEYSK++P++P  N+++ +EKE PWRTL
Sbjct: 369 LLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWRTL 428

Query: 429 MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488
           M+QYNIP ++E L++ L+EWRDM+ARRDDESPRY+MPNQL+V+LVAY P DP  V+S S 
Sbjct: 429 MYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSVSS 488

Query: 489 VVTDYVRSNSKIIANLIKN-----ALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIK 543
           VVTD+VR NSK +ANLIK       L   K  N +L    D    E       +   +I+
Sbjct: 489 VVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDE----LQFLPSHKIE 544

Query: 544 ETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKL----DIIEYKNGEKHSVKQQQ 599
                F +I  +L      +Q   S         LS+ L      ++Y NG   SV++ +
Sbjct: 545 LMTGAFKEIENQLTQATKSKQAMTSSV------VLSEILLHPEHAVKYHNGSACSVEESE 598

Query: 600 LVSRFNTYTKQ--VNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDE 657
           L  R+ +Y K   +    N+   L        L+ ++    KK+     IP K E D+DE
Sbjct: 599 LKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHN-KKSDQIQVIPEKQE-DMDE 656

Query: 658 VVVL--KKVNRQPNKTKLEENEKIDF-IDYSKSEKILXXXXXXXXXXXXXXQFDPFAASN 714
           +VVL  KK++    K K ++ + ++  +DYSK+  IL               FDP++++ 
Sbjct: 657 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVFDPYSSTG 715

Query: 715 EGPKAARKRKSGTRGRNLSYK 735
           EGPKAA+KR+  T+G+ +S+K
Sbjct: 716 EGPKAAKKRRLVTKGKKISFK 736

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/750 (49%), Positives = 513/750 (68%), Gaps = 22/750 (2%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           M  E++  LLS +V TVR+SS LAAQD+DFY+SLDS ++ S+ + +  +  ++N ++LSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120
           D N + + +GK+   +SWKS+SNI+DNLFEKSD +LD ++ G       P  +Y  +   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
           + N P KRI KPQL F  P+DN+E HPF PLL+ KP++L+  + S K++  +E++P HY 
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240
           HPYEYEID+Q YNDSIL   EPIPSK W ETE +WVD VE LN M +++ K TE+AIDLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300
           HHDYR+YYGIVCLMQIS RE D++VDTIALR +L +LN++FTDP+V KVLHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360
           QRDLGLYIV LFDT+HASR LGFP+HSLAYLLE FANFKTSKKYQLADWR+RPL+K M A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420
           YARADTHFLLNI+D+LRN L+E NK+  VL+ESR VAKRRFEYS FRP+VPS  V+S +E
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480
           K++PW+ +MFQYNIP+ +E LL+ L+EWRD IARRDDESPRY+MPNQL+V+LVA  PT+P
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAK-DQNRQLQFVADNHTRESYRSTDKMTV 539
             V+S S  V++++R+NSK+IANLIK  L   K + N     + ++         + +T 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 540 SQIKETASVFIQIAEKLGT--CNNDQQQSKSFARSNYFGSLSKKLDI---IEYKNGEKHS 594
           SQIK   ++F  +A ++ +   NN+Q   KS      F  +S  LD+   + Y    +  
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSV----LFNGIS-NLDVNTAVRYTPKTRTL 595

Query: 595 VKQQQLVSRFNTYTKQV-NELTNVRYE---LPVHKEPPQLQKDDVEEVKKTIIADSIPAK 650
           + Q +L+ R +  T+ +  E T+ + +   LP +++    Q  + E   + I +D  P++
Sbjct: 596 IPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSD--PSQ 653

Query: 651 PEID--LDEVVVLKKVNRQPNKTK--LEENEKIDFIDYSKSEKIL-XXXXXXXXXXXXXX 705
            EI+   DEV+ L+K   Q N  +  +      + +DY+    +L               
Sbjct: 654 EEIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKR 713

Query: 706 QFDPFAASNEGPKAARKRKSGTRGRNLSYK 735
           +FDP++  + GP+  +K+    +G+N+S+K
Sbjct: 714 RFDPYSVEHVGPQPIKKKSKPAKGKNVSFK 743

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/758 (48%), Positives = 497/758 (65%), Gaps = 36/758 (4%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           M   ++  L   +V+T+RA++ L+AQD+DFYRSL   V   +++ +  +  ++N ++LS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120
           DEN   L  G++   +SWK LSN++DN+FEKSD + D +K G+  +      +Y  +++ 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
            ++ P KRI KPQL F  P+DN+E HPF PLLKEKP+ALK ++ES  L   +ENVP HY 
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240
           HPYEYEID QPYNDS+L+VRE I  + W  TE +WVDNVESL+ ML+++K+  E+A+DLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300
           HHDYR+YYGIVCLMQIS+R  D+LVDTIALR+DL VLN +  DP+VVKV HGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360
           QRDLGLY+VSLFDT+HASRALGFP+HSLAYLLE FA FKTSKKYQLADWRVRPL K +  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420
           YAR+DTHFLL+IYD LRN LV+  KL  VLN SRNVAKRRFEY+ FRPR+P  NVYS +E
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480
             +PWR LM+QYN+P  +E LLK L+EWRD +ARRDDES RY+MPNQL+V+LV+ +P++ 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540
           AGV+S S  VTDYVRSN++ +ANLIK  L   K        VA+  + E   S    T+S
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTAS---VAEFSSSERALSNPAATLS 537

Query: 541 -----QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSV 595
                 + +     +  A+K       Q  S     S+    L+     +EY NG+KH +
Sbjct: 538 LHMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSD----LATGPSAVEYTNGQKHVI 593

Query: 596 KQQQLVSR----FNTYTKQ-VNELTNVRYELPVHK---EPPQLQKD----DVEEVKKTII 643
               L +R       +T Q V  +T++  E P H+   E PQ+ +D    + +E +  + 
Sbjct: 594 GDNVLQTRKHALLQKFTSQPVEPVTDI--EAPSHQSSSENPQVSEDISPSEPQESQNEVQ 651

Query: 644 ADSIPAKPEIDLDEVVVLKKVNR-QPNKTKLEENEKIDFIDYSKSEKILXXXXXXXXXXX 702
            D    +P+ +  E+VVL+K  +    K K   +   + +DYS ++++L           
Sbjct: 652 KD----EPDFEKSEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRG 707

Query: 703 -----XXXQFDPFAASNEGPKAARKRKSGTRGRNLSYK 735
                   +FDP+   N  P   +K+   ++G+++S+K
Sbjct: 708 DKDRPRKRKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/762 (48%), Positives = 499/762 (65%), Gaps = 56/762 (7%)

Query: 7   KKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYET 66
           ++LL ++V  VRAS+ LAAQDVDFY+SLD +VS S+N+  ++  D+ NS++LSIDEN   
Sbjct: 32  EELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSP 91

Query: 67  LDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEY-----FENATTT 121
           L+EGK+ + + W   SNI+DNL EKSD  +D L      KP N   +Y      +N + T
Sbjct: 92  LEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALS-----KPNNFNGKYNETTFLDNNSRT 146

Query: 122 ENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAH 181
            + P KRI KPQL F  P+DN++S PF PLL EKPNALK + +S  L+     VP HY  
Sbjct: 147 NSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQ 206

Query: 182 PYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEH 241
           PYEYEIDNQ YN+ ++++R+P P K W  T  +W+D  ESL  +L D++K +EIA+DLEH
Sbjct: 207 PYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEH 266

Query: 242 HDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQ 301
           HD R+YYGI CLMQISTRE DY+VDTI+LR+DL VLNE+FT+P++ KV HGA MDIIWLQ
Sbjct: 267 HDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQ 326

Query: 302 RDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAY 361
           RDLGLYIVSLFDTFHAS+ALG  RHSLAYLLE +A+FKTSKKYQLADWR RPL+  M AY
Sbjct: 327 RDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAY 386

Query: 362 ARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEK 421
           AR+DTHFLLNI+DQLRN L++ NKL GVL+ESRNVAKRRFEY KFRP VP PN+Y+ +EK
Sbjct: 387 ARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEK 446

Query: 422 EDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPA 481
           E PW++L+ QYNI  E+E L++ L+EWRDMIARRDDESPRYIMP Q++++L++YTPTD +
Sbjct: 447 EAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSS 506

Query: 482 GVISASQVVTDYVRSNSKIIANLIKNALTRAKD-QNRQLQFVADNHTRESYRSTDKMTVS 540
           GVIS S +VT++VRSNS  +ANLIK AL   K   N        N +R        ++++
Sbjct: 507 GVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISIT 566

Query: 541 QIKETASVFIQIAEKLGTCN--NDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQ 598
           +I      F  +++   T        +  S   SN   S  K   I +Y   +  S K +
Sbjct: 567 EINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPK---ISDYSKDKTTSFKSE 623

Query: 599 QLVSRFNTYTKQVNELT---NVRYELPVHK---------------EPPQLQKDDVEEVKK 640
            +++R    ++ +  L+   +  Y+ PV                 EP   QK   +E+ +
Sbjct: 624 DMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINE 683

Query: 641 TIIADSIPAKPEIDLDEVVVLKKVNRQPNKTKLE-ENEKIDFIDYSKSEKILXXXXXXXX 699
                        D +E++VLKKVNR+  K K + + +    +DYSK++KI         
Sbjct: 684 -------------DNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETIN 730

Query: 700 XXXXXXQ-FDPFAASNEG-----PKAARKRKSGTRGRNLSYK 735
                 + FDP+  +N+G     P+A +KR++ TRG+N+SYK
Sbjct: 731 GNSKKRKSFDPY--NNDGDTDKVPRALKKRQTNTRGKNISYK 770

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/742 (46%), Positives = 480/742 (64%), Gaps = 23/742 (3%)

Query: 4   EEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDEN 63
           +++  +L+ VV T+RASS ++AQDVDFY+SLDS +S S++E + +L  ++N +++SID+N
Sbjct: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDN 66

Query: 64  YETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTEN 123
            + ++ G+  L  SW ++  ++D LFEKS+ +L  +K        N   +Y +++    +
Sbjct: 67  NDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNN-LQYLDDSQPLTD 125

Query: 124 IPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPY 183
               +I KPQ  F  P+DN+ESHPF PLL +KPNAL+ +D+  +L   +E +P HY HPY
Sbjct: 126 TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185

Query: 184 EYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHD 243
           EYEID+Q Y++S+L++R PIPSK W ET+  WVDN+ +LN M+ ++ K  E+AIDLEHHD
Sbjct: 186 EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245

Query: 244 YRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRD 303
           YRTYYGI CLMQISTRE D+LVDTIALR+ L VLNE+FT+P V+KV HGAFMD+IWLQRD
Sbjct: 246 YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305

Query: 304 LGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYAR 363
           LGLY+VSLFDTFHASR LGFP+HSLAYLLE +A+FKTSKKYQLADWR+RPLSK + AYAR
Sbjct: 306 LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365

Query: 364 ADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKED 423
           ADTHFLLNIYDQ+RN L+E  KL   L+ SR VAKRRFEY+KFRP V +  VYS +E+ED
Sbjct: 366 ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425

Query: 424 PWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGV 483
           PWR+L+F YNIP  +  LLK L+EWRD IARRDDESPRY+MPNQL+V LV   PTD  G+
Sbjct: 426 PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485

Query: 484 ISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVAD--NHTRESYRSTD-KMTVS 540
           +S +  VT++VRSN+K ++ LIK  L   +D         D  NH   +    D K++  
Sbjct: 486 LSVTSFVTEHVRSNAKSLSQLIKKTLASPQD------LFTDQINHMDSNKSMVDSKLSPG 539

Query: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFAR--SNYFGSLSKKLDIIEYKNGEKHSVKQQ 598
            +K     F Q   K            +  R  S + G        + Y+  + H ++  
Sbjct: 540 DVKANHQNFDQYTRK---SRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPT 596

Query: 599 QLVSRFNTYTKQVNELTNV--RYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLD 656
            L  R     + +    NV  + ++ V K P     D+++E +   ++D   ++ + D D
Sbjct: 597 VLDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKD 656

Query: 657 EVVVLKKVNRQPNKT---KLEENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFDPFAAS 713
           E+VVLK+    P  +   K  E    + +D+  ++KI+              +FDP+A  
Sbjct: 657 EIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIM--TATASVPRKSTKRFDPYAIQ 714

Query: 714 NEGPKAARKRKSGTRGRNLSYK 735
             GP   ++RK  TRG   S+K
Sbjct: 715 ASGPDGVKRRKK-TRGIQKSFK 735

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/545 (57%), Positives = 411/545 (75%), Gaps = 2/545 (0%)

Query: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60
           M  + +  LL+ ++ TVRA+S+LAAQD+DF R LD+ V   ++E +  +  ++N +ILS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPT--NPPFEYFENA 118
            +    L+ GK+ L  +WK LSNI+DNLFEKSD SLD+L+       +  +   +Y    
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 TTTENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEH 178
           +  +    +RI KPQL+F  P+DNSE HPF PLLK KP+ALK ++E + L    E VP H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 179 YAHPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAID 238
           Y HPYEYEIDNQPY+DS+L ++EPI   +W E E +WVDN+ +LN MLN +K   EIA+D
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 239 LEHHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDII 298
           LEHHDYR+YYG+VCLMQISTRE+D+LVDTIALR DL+VLNE+FTDPS++KV HGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 299 WLQRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAM 358
           WLQRDLGLY+VSLFDT+HASRALGFP+HSLAYLLE FANFKTSKKYQLADWR+RPLSK M
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 359 TAYARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSA 418
             YARADTHFLLNIYD+LRN L++ +KL GVL+ SRNVAKRRFEY+ FRP+V SP V+S 
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 419 LEKEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPT 478
           +EK+DPWRTLM QYN+P  +E L++ L++WRDM+AR+DDES RY+MPNQL+V+LV   P+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 479 DPAGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMT 538
           DP+G+++    + D+VR+N++++ N+I   +   K  + + Q + +  T        +M+
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 539 VSQIK 543
           VS IK
Sbjct: 541 VSLIK 545

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/747 (47%), Positives = 489/747 (65%), Gaps = 36/747 (4%)

Query: 5   EQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENY 64
           E   +L+ V+ T+RASS + AQDV FY++LD  ++ S+N ++  L  ++N I+LS+DEN 
Sbjct: 8   EDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENN 67

Query: 65  ETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKK--KPTNPPFEYFENATTTE 122
           + +++G E L  +W ++  ++D LFEKS+ +L     G K+     +   +Y +++ +  
Sbjct: 68  DIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL---AAGEKRDNGELSKTVQYLDDSPSLH 124

Query: 123 NIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHP 182
           +   K+I KPQL F  PIDNSESHPF PLLK+KP+AL+++DES +L    E+VP HY  P
Sbjct: 125 DGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQP 184

Query: 183 YEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHH 242
           YEYEID+Q YN+S+LQ+ EP+PS  W ETE  WVDN ++L  MLN++    EIAIDLEHH
Sbjct: 185 YEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHH 244

Query: 243 DYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQR 302
           DYRTYYGI CLMQISTRE D+L+DTIALR+DL +LNEVFTDP + KVLHGAFMDIIWLQR
Sbjct: 245 DYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQR 304

Query: 303 DLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYA 362
           DLGLYIVSLFDT+HASR LG P+HSLAYLLE +A+FKTSKKYQL+DWRVRPL KA+ AYA
Sbjct: 305 DLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYA 364

Query: 363 RADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKE 422
           RADTHFLLNIYD +RN L+E NKL  VL++SRNVAKRRFE++ FRP++ + +V+S +E+E
Sbjct: 365 RADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIERE 424

Query: 423 DPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAG 482
           DPWRTLMFQYNIP  +  L++ L+EWRDM+ARRDDESPRY++PNQL+V+L    PT PA 
Sbjct: 425 DPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPAL 484

Query: 483 VISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQI 542
           +++ S  VT+++R N+K +A LIK +L  + ++  QL   A N  + S  S  KM+   I
Sbjct: 485 IMATSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSA-NTVQNS--SPTKMSSEDI 541

Query: 543 KETASVFIQIA-----EKLGTC----NNDQQQSKSFARSNYFGSLSKKLDIIEYKNGE-- 591
           ++ + +F +       EK   C     +   Q K      Y      +  ++++ + E  
Sbjct: 542 EKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENR 601

Query: 592 KHSVKQQQLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKP 651
           +H V ++    R +    QV+ +          KE      +  EE  K        A+ 
Sbjct: 602 RHQVSKKYEAER-DIARPQVH-IRAASSHAVCDKEAGAEDNESAEEENK--------ARK 651

Query: 652 EIDLDEVVVLKKVNRQPNKTKL---EENEKIDFIDYSKSEKILXXXXXXXXXXXXXXQFD 708
           E ++DEV+VLK+     +K +    +    I+ +D   + KIL              +FD
Sbjct: 652 E-EMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL--EAPSNNVRRPKKRFD 708

Query: 709 PFAASNEGPKAARKRKSGTRGRNLSYK 735
           P+A    GP + +KRK  T+G   S++
Sbjct: 709 PYATLAAGPPSVKKRKK-TKGLQKSFR 734

>YNL273W Chr14 (122883..126599) [3717 bp, 1238 aa] {ON}  TOF1Subunit
           of a replication-pausing checkpoint complex
           (Tof1p-Mrc1p-Csm3p) that acts at the stalled replication
           fork to promote sister chromatid cohesion after DNA
           damage, facilitating gap repair of damaged DNA;
           interacts with the MCM helicase
          Length = 1238

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 66/155 (42%), Gaps = 24/155 (15%)

Query: 67  LDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKT------GAKKKPTNPPFEYFENATT 120
           LD+GK EL          +D L +    +LDI K+       A K+  NPP EYF     
Sbjct: 825 LDDGKTEL----------LDQLLKHITHTLDIFKSWLTVNVNAGKETVNPPNEYFTLTGV 874

Query: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180
             N P  + +K     +  I  S     IP    +P  L    E + L  S E V ++ +
Sbjct: 875 LNNDPIFK-DKDYRALLLLIGYS-----IPRKINEPCFLPGTVEVSDLTVSCELVKKYLS 928

Query: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVW 215
            P+E   +  P +  +L+VR    S S +E +G W
Sbjct: 929 TPFETP-NGLPSSSYLLRVRSEKDSFSHNEQDG-W 961

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 328 LAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHFLLNIY 373
           L  L  E  NF  + +YQ+A W+ R  ++  + +   D HF  NI+
Sbjct: 117 LMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>KNAG0F02090 Chr6 complement(397433..399295) [1863 bp, 620 aa] {ON}
           Anc_6.194
          Length = 620

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 22/140 (15%)

Query: 345 QLADWRVRPLSKAMTAYARADTHFLLNIYDQLRNRL-VETNKLVGVLNESRNVAKRRFEY 403
           ++  W  +PL   +  Y R +  F L + D L   + V +N  V   NE+  +A    + 
Sbjct: 237 RICQWG-KPL--GLDGYVRVEVGFELVLCDFLDGSVEVVSNISVKAPNEALGIAPPANKS 293

Query: 404 SKFR-PRVP---------SPNVYSALEKEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIA 453
           S+   P  P         +P   + L+KED W+ L+ +Y+        ++G F+W    A
Sbjct: 294 SEAGWPIAPDGSFLEDQLTPEQKAVLDKEDEWQHLIKKYSS-------MQG-FDWLLAGA 345

Query: 454 RRDDESPRYIMPNQLMVTLV 473
           R D   P+ ++  + MVT +
Sbjct: 346 RHDTGEPKVVLDYRYMVTGI 365

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
           Anc_8.423
          Length = 948

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 34/68 (50%), Gaps = 13/68 (19%)

Query: 123 NIPQKRINKPQLK---FVPPIDNSESHPFIPLLKEKPNALKTI---DESTKLINSDENVP 176
           NIPQ     PQ     F+PPI N  S P IP +   PN L  I   +EST   N    VP
Sbjct: 282 NIPQ-----PQPTNNTFIPPIPNMNSIPNIPQVASMPN-LANIPKPNESTTSTNPGMFVP 335

Query: 177 EHY-AHPY 183
           E++ A P+
Sbjct: 336 ENFVAGPF 343

>TBLA0J00960 Chr10 complement(215541..218597) [3057 bp, 1018 aa]
           {ON} Anc_5.658 YOR058C
          Length = 1018

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 14/132 (10%)

Query: 479 DPAGVISASQVVTDYVRSNSKIIANLIKNALT---RAKDQNRQLQFVADNHTRESYRSTD 535
           DP  + S + +  DY+ +NS +     K+ +    + + +  ++    D+ +++ YR   
Sbjct: 93  DPQNLASLTPIKIDYLNTNSPLSYQSSKSIIAIPKKMEGKKSKVDDSIDSISKQVYRENL 152

Query: 536 KMTVSQIKETASVFIQIAEKLGTCNNDQQQSKS-----FARS--NYFGSLSKKLDIIEYK 588
               +Q+ +  +    I  K+G  NN+  Q++S     F++S  NY+ S ++K++ +  K
Sbjct: 153 NSISNQMIKLMNDLNHIYNKIGYTNNEIHQNESVIFNHFSKSIENYYSSANEKMNALSLK 212

Query: 589 NGEKHSVKQQQL 600
           N     +KQQ L
Sbjct: 213 ND----LKQQYL 220

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 160 KTIDESTKLINSDENVPEHYAHPYEYEIDNQPYNDSI----LQVREPIPSKSWSETEGVW 215
           K IDES  LI  D+N  EH    + + +D+  ++DSI    L+ +  I + + S  +  +
Sbjct: 214 KYIDESPHLITEDQNNSEHLDDIWRFVLDDVVFSDSIKYQFLKNKRFILAMNLSMNKNTY 273

Query: 216 VDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYYG 249
              ++ + +    I +Y E + D+E  D   Y G
Sbjct: 274 SFFLQLIKNCGGSIVRYIEES-DIETCDGNCYIG 306

>TBLA0H03680 Chr8 (893779..899280) [5502 bp, 1833 aa] {ON} Anc_8.555
           YPL082C
          Length = 1833

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 38  VSHSINEVTDELNDMVNSIILSIDENYETLDEGKEE--LTESWKSLSNIVDNL------- 88
           V + +N+  D++  +  SI++ I   +  L+  K +  LT +W SLS + D+L       
Sbjct: 419 VIYGLNQTDDDIKSVATSILIPITNEFINLNNEKIDVVLTTTWASLSQLDDDLSSSVGSV 478

Query: 89  ------FEKSDRSLDILKTGAKKKPTNPPFE 113
                   + ++ LDILK  A + P+   F+
Sbjct: 479 MDLLSNLCQHEKILDILKLKAVQFPSEWSFK 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,875,235
Number of extensions: 3904535
Number of successful extensions: 13897
Number of sequences better than 10.0: 190
Number of HSP's gapped: 14517
Number of HSP's successfully gapped: 197
Length of query: 735
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 618
Effective length of database: 40,065,477
Effective search space: 24760464786
Effective search space used: 24760464786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)