Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G026506.27ON32132117070.0
KNAG0M012406.27ON31430911571e-160
NCAS0H015106.27ON31329610881e-149
CAGL0E02519g6.27ON31530110761e-147
NDAI0F017406.27ON31331210481e-143
SAKL0E01474g6.27ON31130510371e-141
TDEL0G044206.27ON32231510261e-140
Kwal_56.224546.27ON31527110001e-136
TPHA0M002906.27ON32730010001e-136
ZYRO0C07612g6.27ON3192919981e-135
KLTH0C11044g6.27ON3153059961e-135
YOL002C (IZH2)6.27ON3172859951e-135
Smik_15.1686.27ON3272859811e-133
TBLA0E030606.27ON3193099801e-133
Kpol_1032.96.27ON3182889791e-133
KLLA0D01331g6.27ON3083049741e-132
Skud_15.1606.27ON3273179741e-132
Suva_15.1736.27ON3272859721e-131
Ecym_30316.27ON3283009621e-130
ACL002C6.27ON3292749501e-128
SAKL0C09218g3.90ON3143117558e-99
KLTH0C09504g3.90ON3192807281e-94
Kwal_56.227043.90ON3202987123e-92
TPHA0A006403.90ON3273057115e-92
ZYRO0B06556g3.90ON3183187106e-92
NDAI0A071603.90ON3302977091e-91
CAGL0G04631g3.90ON3163057081e-91
Suva_2.6683.90ON3153107053e-91
TDEL0D053403.90ON3163217011e-90
YDR492W (IZH1)3.90ON3163167002e-90
Skud_4.7663.90ON3163166967e-90
AFR337W3.90ON3173046923e-89
Smik_4.7693.90ON3162946872e-88
KAFR0A081303.90ON3193086863e-88
Ecym_35883.90ON3052696844e-88
NCAS0I025703.90ON3143076836e-88
KLLA0C12441g3.90ON3153036775e-87
Kpol_1053.263.90ON3242746663e-85
TBLA0B022903.90ON3263166542e-83
KNAG0K021603.90ON3232746082e-76
TBLA0B082553.90ON2962904443e-52
NCAS0C049203.90ON3262733628e-40
NDAI0G043003.90ON3182843294e-35
CAGL0I07491g3.90ON3013102655e-26
KLLA0F15510g5.197ON6223192038e-17
Suva_15.643.90ON3122121981e-16
Smik_15.563.90ON3122121943e-16
Skud_15.533.90ON3122121901e-15
YOL101C (IZH4)3.90ON3122121831e-14
TPHA0E031205.197ON5692501744e-13
KAFR0J006705.197ON5092311735e-13
Ecym_71095.197ON5683781664e-12
TBLA0C060505.197ON4373481646e-12
Kpol_2002.945.197ON5772361648e-12
AAL153C5.197ON4193151549e-11
NDAI0I023305.197ON5781991487e-10
KNAG0B051005.197ON5383421452e-09
ZYRO0B10538g5.197ON5312451424e-09
YLR023C (IZH3)5.197ON5432371407e-09
NCAS0D026005.197ON5432411407e-09
Skud_12.915.197ON5422331407e-09
SAKL0G12980g5.197ON5632801381e-08
TDEL0E043205.197ON4502331291e-07
CAGL0D03322g5.197ON5452901256e-07
KLTH0B03498g5.197ON5462871231e-06
Smik_12.865.197ON5422331221e-06
Suva_10.1045.197ON5412431184e-06
Kwal_33.151225.197ON5662411151e-05
KNAG0K006703.90ON3211091032e-04
TBLA0I015702.559ON1285141722.0
KAFR0A080202.8ON97799694.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G02650
         (321 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   662   0.0  
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   450   e-160
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   423   e-149
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   419   e-147
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      408   e-143
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   404   e-141
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   399   e-140
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   389   e-136
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   389   e-136
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   389   e-135
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   388   e-135
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   387   e-135
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   382   e-133
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   382   e-133
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   381   e-133
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   379   e-132
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   379   e-132
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   379   e-131
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   375   e-130
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   370   e-128
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   295   8e-99
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   285   1e-94
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   278   3e-92
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   278   5e-92
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   278   6e-92
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   277   1e-91
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   277   1e-91
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   276   3e-91
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   274   1e-90
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   274   2e-90
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   272   7e-90
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   271   3e-89
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   269   2e-88
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   268   3e-88
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   268   4e-88
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   267   6e-88
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   265   5e-87
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   261   3e-85
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   256   2e-83
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   238   2e-76
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             175   3e-52
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   144   8e-40
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    131   4e-35
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   106   5e-26
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    83   8e-17
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    81   1e-16
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    79   3e-16
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    78   1e-15
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    75   1e-14
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    72   4e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    71   5e-13
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    69   4e-12
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    68   6e-12
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    68   8e-12
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    64   9e-11
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     62   7e-10
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    60   2e-09
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    59   4e-09
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    59   7e-09
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    59   7e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    59   7e-09
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    58   1e-08
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    54   1e-07
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    53   6e-07
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    52   1e-06
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    52   1e-06
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    50   4e-06
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    49   1e-05
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    44   2e-04
TBLA0I01570 Chr9 (342266..346123) [3858 bp, 1285 aa] {ON} Anc_2....    32   2.0  
KAFR0A08020 Chr1 complement(1604597..1607530) [2934 bp, 977 aa] ...    31   4.6  

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/321 (100%), Positives = 321/321 (100%)

Query: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGY 60
           MISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGY
Sbjct: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGY 60

Query: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYID 120
           VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYID
Sbjct: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYID 120

Query: 121 LFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSL 180
           LFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSL
Sbjct: 121 LFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSL 180

Query: 181 FYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNT 240
           FYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNT
Sbjct: 181 FYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNT 240

Query: 241 WHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKA 300
           WHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKA
Sbjct: 241 WHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKA 300

Query: 301 LMCSYEHVHMFVIPSMLNILR 321
           LMCSYEHVHMFVIPSMLNILR
Sbjct: 301 LMCSYEHVHMFVIPSMLNILR 321

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  450 bits (1157), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/309 (69%), Positives = 251/309 (81%), Gaps = 5/309 (1%)

Query: 2   ISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQ-LYNWNEIPDWQKDNEHIISGY 60
           +SSR +R T  +T    ++D    + GE   + +KI + +Y WNEIP+WQKDNEHII GY
Sbjct: 1   MSSRVQRQTVTITEPVVYED----DGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGY 56

Query: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYID 120
           V+ETNSF  C+ SLFYLHNESVNVYSHLIPA+CF     LNK  V  F TT+++DYL+ID
Sbjct: 57  VRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFID 116

Query: 121 LFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSL 180
           LFFLGAFTCLILSSTFHCFKSHSL++ATFGNKLDYLGIVVLI TSMIS+LYYGFYD+  +
Sbjct: 117 LFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVM 176

Query: 181 FYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNT 240
           FY F+F+TLSFG AC  VSLKD FRSRE R YRA LFV FGLSA+LP++ G++ YG    
Sbjct: 177 FYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEA 236

Query: 241 WHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKA 300
           +HRIQ+KW++LEGVFYI GAFLYGIRFPEK +PGKYDIWGHSHQ+FHILVV+AALCH K 
Sbjct: 237 FHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKG 296

Query: 301 LMCSYEHVH 309
           LM SYE VH
Sbjct: 297 LMVSYELVH 305

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  423 bits (1088), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 206/296 (69%), Positives = 236/296 (79%), Gaps = 6/296 (2%)

Query: 15  IDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESL 74
           ID     +    K  TIR      +LY W+EIP+WQKDNEHII+GYV+ETNSF  C +SL
Sbjct: 22  IDDDNVSIKHTKKTTTIR------KLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSL 75

Query: 75  FYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSS 134
           FY+HNE+ NVYSHL+P V F +T L +K  +  F TTT  DYL I+LFFLGAFTCLILSS
Sbjct: 76  FYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSS 135

Query: 135 TFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLA 194
           TFHCFKSHSL+IATFGNKLDYLGIVVLI TSMIS+L+YGFYD    FY F+ +TLSFG A
Sbjct: 136 TFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSA 195

Query: 195 CATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGV 254
           CA VSLKDKFRSRE R YRA LFV FGLSAVLP++ G+ +YG + TW RIQLKWV+LEGV
Sbjct: 196 CAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGV 255

Query: 255 FYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310
           FYIFGAFLYGIRFPEKY  G +DIWGHSHQ+FH+LVV+AA CH KAL+ SYE VHM
Sbjct: 256 FYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHM 311

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 198/301 (65%), Positives = 236/301 (78%), Gaps = 2/301 (0%)

Query: 11  RKVT--IDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFF 68
           RKV   + T  Q ++  +    +R    + +LY W EIP+WQKDNEHI +GYV+ET+S  
Sbjct: 7   RKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVM 66

Query: 69  SCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFT 128
            CI SLFYLHNE+VN+YSHLIPA+ F  T   NK +VP + TTT++DYL ID+FFLGAF+
Sbjct: 67  ECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFS 126

Query: 129 CLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFIT 188
           CLILSSTFHC KSHSLR+A FGNKLDYLGIV LI  SM+S+LYYGF+  P  F +F+ IT
Sbjct: 127 CLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLIT 186

Query: 189 LSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKW 248
           ++FG ACA VSLKD FRSRE R YRA LFV FGLSAVLP++ GL+ YG   TW RIQLKW
Sbjct: 187 MTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKW 246

Query: 249 VLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHV 308
           V+LEGVFYIFGAFLYGIRFPEK +PG +D+WGHSHQ+FHILVV+AALCH KAL+ SY  V
Sbjct: 247 VILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLV 306

Query: 309 H 309
           H
Sbjct: 307 H 307

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 241/312 (77%), Gaps = 5/312 (1%)

Query: 1   MISSRPKRSTRKVTIDTAFQDVVEQ-NKGETIRSLEK--IIQLYNWNEIPDWQKDNEHII 57
           M  +  KR     T  T  + ++   + G++I  +++  + +LY W+EIP+WQKDNEHII
Sbjct: 1   MPKTIQKRGNTSTT--TVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHII 58

Query: 58  SGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYL 117
           SGYV+ETNSF  C+ SLFY+HNES NVYSHL+P V F  T +LNK  +  + TT+++DYL
Sbjct: 59  SGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYL 118

Query: 118 YIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDT 177
            IDLFF GAF CLILSS FHCFKSHSL++AT GNKLDYLGIV+LI TSMIS++Y+GF+D 
Sbjct: 119 MIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDN 178

Query: 178 PSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGF 237
           P  FY F+ +T  FG ACATVSLKD FRSRE R YRA LFV FGLSA+LP++ G ++YG 
Sbjct: 179 PLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGI 238

Query: 238 YNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCH 297
             T+ RIQLKW++LEG FYIFGAFLYG+RFPEKY PG +DIWGHSHQ+FHILVV+AA CH
Sbjct: 239 EETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCH 298

Query: 298 FKALMCSYEHVH 309
            + L+ SYE VH
Sbjct: 299 LRGLLSSYEIVH 310

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  404 bits (1037), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 189/305 (61%), Positives = 232/305 (76%), Gaps = 1/305 (0%)

Query: 5   RPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKET 64
            P+ + R++ I  A   V E+       + +++ +LY+W EIPDWQKDNEHI  GYV+ET
Sbjct: 2   EPEPNRRRLQIKRA-NIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60

Query: 65  NSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFL 124
           NSF  C +SLFY+HNESVN+Y+HL+P +CF    L +K  +  F TTT LDY+ +DLFFL
Sbjct: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL 120

Query: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184
           GAFTCLILSSTFHC K+HSLRIA  GNKLDYLGIV LI +SMIS++YYGF+D+   FY F
Sbjct: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180

Query: 185 AFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRI 244
           + +TL FG+ACA  SL D FRSRE R YRA LFV FGLSAVLP+  G+  YGF  TW ++
Sbjct: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240

Query: 245 QLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304
           Q+KWVLL GVFYI GA LY +R PE+ +PGK+DIWGHSHQ+FHILVVIAALCH KA++ S
Sbjct: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300

Query: 305 YEHVH 309
           YE VH
Sbjct: 301 YELVH 305

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 237/315 (75%), Gaps = 5/315 (1%)

Query: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKG-----ETIRSLEKIIQLYNWNEIPDWQKDNEH 55
           M  S  KRS   +T D       E+  G     +T +  +K  +LY W+EIP WQ+DNEH
Sbjct: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60

Query: 56  IISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLD 115
           I+SGYV ET S F C  SLFYLHNESVN+Y+HL+P + FL     +K  V +F TTT++D
Sbjct: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120

Query: 116 YLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFY 175
           Y+ IDLF L +FTCL LSS FHC K+HS  +ATFGNKLDYLGIVVL+ TSM+S++YYGF+
Sbjct: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180

Query: 176 DTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHY 235
           +TP+LFY+F+FIT +FG ACA VSLK+ FR+RE R YRA +FV FGLSAVLP++ G+++Y
Sbjct: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240

Query: 236 GFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAAL 295
           GF   + RIQ+KWVLL G+FYI GA LYG+RFPEKY PGKYDIWGHSHQLFH+LVV+AAL
Sbjct: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAAL 300

Query: 296 CHFKALMCSYEHVHM 310
           CH   L+ SY  VH+
Sbjct: 301 CHLYGLIKSYNLVHL 315

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 176/271 (64%), Positives = 218/271 (80%)

Query: 39  QLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTS 98
           +LY W+EIP+WQKDNEHI++GY+ ET S  +C++SL YLHNESVN+Y+HLIP  CFL+ +
Sbjct: 40  RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 99

Query: 99  LLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGI 158
           L N+  + ++ TT ++DY+ IDLFFLG FTCL++SSTFHCFK HSL +A  GNKLDYLGI
Sbjct: 100 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 159

Query: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218
           V L+ TSM+S+L+YGF+D    FYVF+ +T+ FGLAC  VSL DKFRSR+ R YRA LFV
Sbjct: 160 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 219

Query: 219 CFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDI 278
            FGLSA+ PVI G+ HYGF  TW RIQLKWV LEGVFYI GA LYG+RFPE+  PG +DI
Sbjct: 220 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 279

Query: 279 WGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           WG SHQLFH+LVVIAA CH +AL+ +Y+ VH
Sbjct: 280 WGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 231/300 (77%), Gaps = 3/300 (1%)

Query: 17  TAFQDVVEQNKGETI---RSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIES 73
           T   D V+ NK       R   ++I + +W+++PDWQKDNEHI  GYVKETNSF +C ES
Sbjct: 27  TIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFES 86

Query: 74  LFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILS 133
           LF+LHNESVN+YSH++P +C L   L++  I+ KF TTT +DY  IDLF  GAF+CLILS
Sbjct: 87  LFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILS 146

Query: 134 STFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGL 193
           S FH  KSHSL +A +GNKLDYLGIV+LI TSMIS+LYYGFYDTP  F++F+ IT+ FG+
Sbjct: 147 SAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGI 206

Query: 194 ACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEG 253
           AC TVSL +KFRSRE R YRATLFVCFGLSAV PV+ G+++YG  +T+ RIQLKW++ EG
Sbjct: 207 ACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEG 266

Query: 254 VFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFVI 313
            FYIFGAFLY +R+PE+  PG +D+WGHSHQ+FH+ VVIAA  HF  L+ +YE+ H  +I
Sbjct: 267 FFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEMLI 326

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  389 bits (998), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 221/291 (75%), Gaps = 4/291 (1%)

Query: 23  VEQNKGETIRSLEKIIQ----LYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLH 78
           +E N+ +T   +E +      LY WNEIPDWQKDNEHI+ GYV+ETNS   C++SL YLH
Sbjct: 21  LEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLH 80

Query: 79  NESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHC 138
           NES+N+Y+H +P +CFL T + +K  +  F TTT +DY+ ID FF GAF+CLILSSTFHC
Sbjct: 81  NESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHC 140

Query: 139 FKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATV 198
           FKSHS R++ FGNKLDYLGIV+LI  SMIS+LYY F+D+  LFY F  I   FG++C   
Sbjct: 141 FKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIA 200

Query: 199 SLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIF 258
           S  D FRSRE R YRA LFV FGLSA+LP++ G+  YGF+ TW RIQ+KWV+LEG+FYIF
Sbjct: 201 SFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIF 260

Query: 259 GAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           GAFLY IRFPE+  PG +D  GHSHQ+FH+LVVIAALCH  ALM SYE VH
Sbjct: 261 GAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 233/305 (76%), Gaps = 5/305 (1%)

Query: 9   STRKVTIDTAFQDVVEQN----KGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKET 64
           + RK         +VE+N    K   ++   K  +LY W+EIP+WQ+DNEHI+ GY+ ET
Sbjct: 7   TQRKPVEVELHHRMVEENSSLLKDSNLKQRTKR-RLYTWDEIPEWQRDNEHIVGGYILET 65

Query: 65  NSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFL 124
            S + C++SL YLHNESVN+Y+HL+P  CFL+ ++ N+ ++ KF TT ++DY+ IDLFFL
Sbjct: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125

Query: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184
           G FTCL++SS FHCFK HSL +A  GNKLDYLGIV L+ TS++S+L+YGF+D    F++F
Sbjct: 126 GGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLF 185

Query: 185 AFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRI 244
           + +T++FGLACATVSL +KFRSRE R YRA+LFV FGLSA+LPVI G  HYG   TW RI
Sbjct: 186 SGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRI 245

Query: 245 QLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304
           QL+WVLL GVFYI GA LYGIRFPE+  PG +DIWGHSHQLFHILVV+AALCH +AL+ +
Sbjct: 246 QLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305

Query: 305 YEHVH 309
           Y+  H
Sbjct: 306 YKLFH 310

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/285 (64%), Positives = 226/285 (79%)

Query: 26  NKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVY 85
           N  E  ++ + + +LY+W+EIP+WQ+DN+ I+ GYVKET+SF    +SLFYLHNESVN+Y
Sbjct: 25  NPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIY 84

Query: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145
           SHLIPA+ F    LL+K+ +  F TTT LD++ IDLF+ GAF CLILSS+FHC KSHSLR
Sbjct: 85  SHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLR 144

Query: 146 IATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFR 205
           IAT GNKLDYLGI +LI TSM+S+LYYG+++  SLF +FA IT+SFG+AC+ VSLKDKFR
Sbjct: 145 IATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFR 204

Query: 206 SRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGI 265
            RE R YRA LFVCFGLS+++P+  GLY Y F   W +IQL WVLL GV YI GA LYG+
Sbjct: 205 KREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGM 264

Query: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310
           RFPEK  PGK+DIWGHSHQLFH LVVIAALCH + L+ SYE VH+
Sbjct: 265 RFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHI 309

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  382 bits (981), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 224/285 (78%)

Query: 26  NKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVY 85
           N  E   + + + +LY+W+EIP+WQ+DN+ I+ GYV+ET+SF    +SLFYLHNESVN+Y
Sbjct: 35  NPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIY 94

Query: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145
           SHL+PA+ F    LL+K+ +  F TTT  D++ IDLF+ GAF CLILSS+FHC KSHSLR
Sbjct: 95  SHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLR 154

Query: 146 IATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFR 205
           IAT GNKLDYLGI +LI TSM+S+L+YG+Y+  SLF +FA IT+SFG+AC+ VSLKDKFR
Sbjct: 155 IATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFR 214

Query: 206 SRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGI 265
            RE R YRA LFVCFGLS+++P+  GLY Y F   W +IQL WVLL GV YI GA LYG+
Sbjct: 215 KREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGM 274

Query: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310
           RFPEK  PGK+DIWGHSHQLFH LVVIA+LCH + L+ SYE VH+
Sbjct: 275 RFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHI 319

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/309 (60%), Positives = 228/309 (73%), Gaps = 4/309 (1%)

Query: 2   ISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYV 61
           +  R   S+ +  ++  + D   Q +  T  S  K  +LY W+EIP WQ DNE+I +GYV
Sbjct: 5   VQRRKLTSSTEEGVELLYGD--NQQQLNTSGSSGK--RLYTWDEIPVWQHDNEYIYTGYV 60

Query: 62  KETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDL 121
           +ETNS      SLFY+HNESVN+Y+HLIPA CFL   L N   V    TTT  DY+ IDL
Sbjct: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120

Query: 122 FFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLF 181
           FF+GAFTCL LSSTFHCFKSHSL+I+ FGNKLDYLGIV+LISTS+IS+LY+G++D P +F
Sbjct: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIF 180

Query: 182 YVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTW 241
           Y+F+ ITL FG+AC   SLKDKFR+RE R YRA LFV FGLS VLP+I G+  YG    +
Sbjct: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240

Query: 242 HRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKAL 301
            R+QLKW++ EGV YIFGAFLYG RFPEK+ PGK DIWG SHQ+FH+LVVIAALCH + L
Sbjct: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300

Query: 302 MCSYEHVHM 310
           + SYE VH 
Sbjct: 301 IGSYELVHQ 309

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  381 bits (979), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 227/288 (78%), Gaps = 1/288 (0%)

Query: 23  VEQNKGETIRS-LEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNES 81
           VE++  ++  S +++ +QL  W  +PDWQKDNEHI+SGYVKETNS  +C+ SL ++HNES
Sbjct: 23  VEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNES 82

Query: 82  VNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKS 141
           VN++SHL+PA CF+ T + +K +V ++ TTT+ DYL +DLF  GAFTCL++SS FHC K+
Sbjct: 83  VNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA 142

Query: 142 HSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLK 201
           HS  +++FGNKLDYLGIVVLI +SM S+LYYGFYD   L++ F+ IT +FGL+CA VSL 
Sbjct: 143 HSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG 202

Query: 202 DKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAF 261
           ++FR+RE R YRA +FV FGLSA+LP+  G  +YG   T  R+QLKWV+LEGVFYIFGA 
Sbjct: 203 ERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGAL 262

Query: 262 LYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           LYG+RFPE+  PG +DIWGHSHQLFHILVV+AALCH + L+ SY  VH
Sbjct: 263 LYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVH 310

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 229/304 (75%), Gaps = 5/304 (1%)

Query: 9   STRKVTIDTAFQDVVEQNKG--ETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66
           STRK ++ T    ++E+  G  +T+R  E+  ++Y+W+EIPDWQKDNEHI+ GYV+ET S
Sbjct: 2   STRKRSVVTEETALIEETPGTKKTVRVYER--RVYSWDEIPDWQKDNEHILHGYVRETQS 59

Query: 67  FFSCIESLFYLHNESVNVYSHLIPAVC-FLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLG 125
           +     SLFYLHNESVN+Y+HLIPAV  F +       ++ ++ TT+ +DY  I+LFF G
Sbjct: 60  WKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFG 119

Query: 126 AFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFA 185
             TCL +SS FH  K HSL IATFGNKLDYLGIVVLISTSMIS+L+YGF+D+  LFY FA
Sbjct: 120 CATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFA 179

Query: 186 FITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQ 245
            +T  FGL C  +SLKDKFRSRE R YRAT+FV FGLSAV P++ G   YG   TW R+Q
Sbjct: 180 GLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQ 239

Query: 246 LKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSY 305
           L WV+ EGV YIFGAFLYG+RFPE+  PGK+DIWGHSHQLFH+LVV+AALCH KAL+ SY
Sbjct: 240 LTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSY 299

Query: 306 EHVH 309
             VH
Sbjct: 300 GLVH 303

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 183/317 (57%), Positives = 238/317 (75%), Gaps = 7/317 (2%)

Query: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKGET------IRSLEKIIQ-LYNWNEIPDWQKDN 53
           +I+  P + +  +    + Q++ ++  G+T      +   +K+++ LY+W+EIP+WQ+DN
Sbjct: 3   LIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDN 62

Query: 54  EHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTV 113
           ++I+ GYV+ET SF    +SLFY+HNESVN+YSHLIPA+ F    LL+K+ +  F TTT 
Sbjct: 63  DYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTW 122

Query: 114 LDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYG 173
            D++ IDLF+ GAF CLILSS+FHC KSHSLRIAT GNKLDYLGI +LI TSM S+LYYG
Sbjct: 123 KDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYG 182

Query: 174 FYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLY 233
           +Y+  SLF +FA IT+SFG+AC+ V+LKDKFR RE R YRA LFVCFGLS+++P+  GLY
Sbjct: 183 YYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLY 242

Query: 234 HYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIA 293
            Y F   W +IQL WVLL GV YI GA LYG+RFPEK  PGK+DIWGHSHQLFH LVVIA
Sbjct: 243 CYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIA 302

Query: 294 ALCHFKALMCSYEHVHM 310
           + CH + L+ SYE VH+
Sbjct: 303 SFCHLRGLLNSYELVHL 319

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  379 bits (972), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 182/285 (63%), Positives = 228/285 (80%)

Query: 26  NKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVY 85
           N  E  ++ + + ++Y+W+EIP+WQ+DN++I+ GYVKET+SF    +SLFY+HNESVN+Y
Sbjct: 35  NPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIY 94

Query: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145
           SHLIPAV FL   LL+KT +  F TTT LD++ IDLFF GAF CLILSS+FHCFKSHSL+
Sbjct: 95  SHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLK 154

Query: 146 IATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFR 205
           IAT GNKLDYLGI +LI TSM+S+LYYG+YD    F +FA IT+SFG+AC+ VSLKDKFR
Sbjct: 155 IATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFR 214

Query: 206 SRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGI 265
            RE R YRA LFVCFGLS+++P+  GLY+Y F   W++IQL WVLL G  YI GA LYG+
Sbjct: 215 KREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGM 274

Query: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310
           RFPEK  PG++DIWGHSHQLFH LVVIA+LCH + ++ SYE VH+
Sbjct: 275 RFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHI 319

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  375 bits (962), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 173/300 (57%), Positives = 224/300 (74%), Gaps = 4/300 (1%)

Query: 10  TRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFS 69
            R +     F+D+   N+  TI  L+   +L++W+EIP+WQ+DNEHI+ GYVKETNSF  
Sbjct: 22  NRTLETSVIFEDL---NQATTI-PLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKE 77

Query: 70  CIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTC 129
            + SL YLHNESVN+Y+HLIP VCF     LNK ++ +F+TTT  DY  ID FF+GAF C
Sbjct: 78  TLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFAC 137

Query: 130 LILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITL 189
           L++S T+HC KSHS  ++  GN+LDY+GIV+LISTSM SLLYYGFY++  +FY F+ +TL
Sbjct: 138 LVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTL 197

Query: 190 SFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWV 249
             G  C  V+L  +FRSR  R YRA++FV FGLS++LP++  + +YG   TW+ +QL W+
Sbjct: 198 LLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWI 257

Query: 250 LLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           +LEGV YIFGAF+YGIRFPE   PG +DIWGHSHQLFH+LVVIAALCHFKA+  SYE VH
Sbjct: 258 ILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  370 bits (950), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 210/274 (76%)

Query: 36  KIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFL 95
           ++  L +W+++PDWQKDNEHI+SGYV+ETNS+     SLFYLHNESVN+YSHLIP +CFL
Sbjct: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL 107

Query: 96  MTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDY 155
             +L NK +V  + TTT  DYL ID+F LGA  CL LS  +HC KSHSL ++ FGNKLDY
Sbjct: 108 FIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDY 167

Query: 156 LGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRAT 215
           +GIV LIS SMIS +YYGFYD+ ++F +F+ +TLS  LACA VSL   FRSRE R YRA 
Sbjct: 168 IGIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAA 227

Query: 216 LFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGK 275
           +F  FGLS +LPVI   ++YG    + RIQLKW+ LEGV YI GA LYG+RFPEK  PG 
Sbjct: 228 IFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGS 287

Query: 276 YDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           +DIWGHSHQLFH+LVVIAALCH +AL+  Y++VH
Sbjct: 288 FDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  295 bits (755), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 143/311 (45%), Positives = 204/311 (65%), Gaps = 11/311 (3%)

Query: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGY 60
           M S+   R  RK T         ++   E+I + +   +L  + E+PDWQKDNE I+ GY
Sbjct: 1   MSSTTTVRQRRKTT---------QKASAESIATAKGRKRLCTFEELPDWQKDNELILDGY 51

Query: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTS--LLNKTIVPKFRTTTVLDYLY 118
           V+ET S   C +SL Y HNE+VN+Y+HL+P V +L+    L +  ++PKF ++T+ DY+ 
Sbjct: 52  VRETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYII 111

Query: 119 IDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTP 178
           I+ F LGAF CL+ SS FHC K HS   +   +K+DY+GI+VLIS SM+S+LYYGF+D  
Sbjct: 112 INFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHL 171

Query: 179 SLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFY 238
             F +F  +T+  G  CA   L D+F S+  R +RA+ FV FG S ++P+I GL  +G  
Sbjct: 172 FHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGIS 231

Query: 239 NTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHF 298
            + HR+QLK+V LE VFYI GA  YG R PE + PGK+D+ GHSHQ+FH++VV+ +LCH 
Sbjct: 232 ESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHL 291

Query: 299 KALMCSYEHVH 309
           +A++ SY  +H
Sbjct: 292 RAVVGSYIFMH 302

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  285 bits (728), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 137/280 (48%), Positives = 192/280 (68%), Gaps = 3/280 (1%)

Query: 43  WNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLL-- 100
           + E+PDWQ+DN+ I++GYV+ETNS   C ESL Y HNE+VN+Y+HLIP+  +L+  +   
Sbjct: 37  FEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFT 96

Query: 101 NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVV 160
           +  ++P+F TTT+ DY+ I+ F LGAF CL+ S+ FHC K HS   +   +K+DY+GI+V
Sbjct: 97  DLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIV 156

Query: 161 LISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCF 220
           LIS S +SLLYYGFYD    F +F    +  G  CA   L D+F ++  RA RA  FV F
Sbjct: 157 LISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTF 216

Query: 221 GLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWG 280
           G S ++P++ GL  +G   +  R+QL++VLLE +FYI GA +YG R PE   PGK+D  G
Sbjct: 217 GFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVG 276

Query: 281 HSHQLFHILVVIAALCHFKALMCSYEHVHMFV-IPSMLNI 319
           HSHQ+FHILVV+ +LCHF+AL+ SY  +H  +  P +LN+
Sbjct: 277 HSHQIFHILVVLGSLCHFRALLGSYFFMHTGISSPGLLNL 316

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  278 bits (712), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 24  EQNKGETIRSLEKIIQ--LYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNES 81
           E   G+  +S E+  +  L  + E+P+WQ+DNE I++GYV+ET S   C+ESL Y HNE+
Sbjct: 17  ELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNET 76

Query: 82  VNVYSHLIPAVCFLMTSLL--NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCF 139
           +N+Y+HLIP+  +L+  +   +  ++P F +TT+ DY+ I+ + LGAF CL+ S+ FHC 
Sbjct: 77  LNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCL 136

Query: 140 KSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVS 199
           K HS   +   +K+DY+GI+VLIS S +SLLYYGF+D    F +F    +  G  CA   
Sbjct: 137 KQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFV 196

Query: 200 LKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFG 259
           L D+F ++  RA RA  FV FG S ++P+I GL  +G   +  R+QL++VLLE  FYI G
Sbjct: 197 LNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGG 256

Query: 260 AFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFVIPSML 317
           A +YG R PE   PGK+D  GHSHQ+FHILVV+ +LCHF+AL+ SY  +H  +  S L
Sbjct: 257 AIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHTGISSSSL 314

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  278 bits (711), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 139/305 (45%), Positives = 199/305 (65%), Gaps = 6/305 (1%)

Query: 7   KRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66
           K S R+ ++      ++E    E + +  K  +LY+++E+P+WQKDNE II GYV+ETNS
Sbjct: 16  KLSRRRFSVSKNGTVLLEST--EIVETYSK--KLYSFHELPEWQKDNELIIQGYVRETNS 71

Query: 67  FFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLL--NKTIVPKFRTTTVLDYLYIDLFFL 124
           +F C  SL Y HNES+N+Y+HLIP + + +  L   +  +VP F +TT++DY+ ID + L
Sbjct: 72  WFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLL 131

Query: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184
           GAF CL+ SS FHC K HS   + F +K+DY+GI+ LIS S+ISLLYYG++D    F VF
Sbjct: 132 GAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVF 191

Query: 185 AFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRI 244
             ITL     C    L ++F ++  R  RA  FV F  SAV+P+  GL  + +    +RI
Sbjct: 192 TLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRI 251

Query: 245 QLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304
           QL++V  E  FY+ GA LYG R PE + PG++D+ G SHQ+FH++VVI +L H KA++ S
Sbjct: 252 QLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGS 311

Query: 305 YEHVH 309
           YE +H
Sbjct: 312 YEFMH 316

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  278 bits (710), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 139/318 (43%), Positives = 201/318 (63%), Gaps = 21/318 (6%)

Query: 2   ISSRPKRSTRKVTIDTA-----FQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHI 56
           +SS  +   R+V I        +++V+E+              LY+++E+P+WQ+DN+ I
Sbjct: 1   MSSITEVKRRRVPIGNGNGEGLYKEVLEEKT------------LYDFHELPEWQQDNDKI 48

Query: 57  ISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCF--LMTSLLNKTIVPKFRTTTVL 114
           ++GY++ET S   C+ SLF  +NE+VN+Y+HL+ AV +  LM  + +  +VP F T+T  
Sbjct: 49  LTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFT 108

Query: 115 DYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGF 174
           DY  I+ + LGAF CL+ SS FH FK HS   +   +K+DY+GI+VLI+ SMISL+YYGF
Sbjct: 109 DYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGF 168

Query: 175 YDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYH 234
           +D    F +F  +TL+   AC    L DKF  ++ R  RA  F+ FGLS V PV  G+  
Sbjct: 169 FDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIK 228

Query: 235 YGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAA 294
           +G      R+QLK++ LE +FYI GA +YG R PE   PG++D WGHSHQ+FH+LVVIA+
Sbjct: 229 FGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIAS 288

Query: 295 LCHFKALMCSY--EHVHM 310
             H KA+M SY  +H H+
Sbjct: 289 FLHLKAVMGSYIFKHSHL 306

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  277 bits (709), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 140/297 (47%), Positives = 204/297 (68%), Gaps = 5/297 (1%)

Query: 20  QDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHN 79
           +D     K +T R   KI  L  ++E+P+WQKDN+ I++GYV+ETNSF  C +SLFYL+N
Sbjct: 34  EDNDTSQKPKTNRRKRKI-HLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNN 92

Query: 80  ESVNVYSHLIPAVCFLMTSL----LNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSST 135
           E++N+Y+HLIP++ +L+ SL    +N   +PKF TT+V+DY+ I++F LGAFTCL+LSS 
Sbjct: 93  ETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSC 152

Query: 136 FHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLAC 195
           FHC K HS +  T  +KLDY+GI++LIS S+I +LY+G++D  S F  F  +T SF + C
Sbjct: 153 FHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVC 212

Query: 196 ATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVF 255
           + + L +KF     R  RA LF+ F  + ++P+I G Y +G+     RI L +VLLE +F
Sbjct: 213 SIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIF 272

Query: 256 YIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFV 312
           YI G  LYG R PE + PG +D++G SHQ+FHI VV+ ++CHF A++ SY  +H  +
Sbjct: 273 YIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMHHLI 329

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  277 bits (708), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 139/305 (45%), Positives = 198/305 (64%), Gaps = 6/305 (1%)

Query: 7   KRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66
           KR+++ V       D      GE     EK+  L+++NE+P+WQKDN+ I+ GYV+ETNS
Sbjct: 9   KRASKSVGESGGRNDGSIHAHGE--EKSEKL--LWHFNELPEWQKDNDKILRGYVRETNS 64

Query: 67  FFSCIESLFYLHNESVNVYSHLIPAVCFLMTSL--LNKTIVPKFRTTTVLDYLYIDLFFL 124
           F  C++SL YL+NESVN+Y+HLIPAV ++  SL   N  ++P + +T+ +DY+ I++FFL
Sbjct: 65  FKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFL 124

Query: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184
           GAF CL+ SS FHC K HS       +KLDYLGI+ LIS S + ++YYG++D  S F +F
Sbjct: 125 GAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIF 184

Query: 185 AFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRI 244
             ITL   + C+   L DKF + E R  RA+ F  FG S ++P+  G   +G      RI
Sbjct: 185 TGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRI 244

Query: 245 QLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304
            L ++ LE +FYI GA +YG RFPE   PGK+D +G SHQ+FHI+VV+ ++CH  A++ S
Sbjct: 245 SLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVES 304

Query: 305 YEHVH 309
           Y  +H
Sbjct: 305 YHLIH 309

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  276 bits (705), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 204/310 (65%), Gaps = 4/310 (1%)

Query: 2   ISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYV 61
           I++  +R+   V   T+    VE  K +     EK+  L++++E+PDWQ+DN+ I++GYV
Sbjct: 3   ITATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKL--LHDFHELPDWQRDNDKILTGYV 60

Query: 62  KETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLM--TSLLNKTIVPKFRTTTVLDYLYI 119
           +ET S+  C+ SLFY +NE+VN+Y+HL+PA+ + +   +L N  ++P F +TT  DY  I
Sbjct: 61  RETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVI 120

Query: 120 DLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPS 179
           ++F +GAF CL+ SS FHC K HS + + F +KLDYLGI+ LIS SMI ++Y+G++D  S
Sbjct: 121 NIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHAS 180

Query: 180 LFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYN 239
            F +F  +TL     C    L DKF +   R +RA  F+ FG S +LP+  GL+ +G   
Sbjct: 181 YFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQG 240

Query: 240 TWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFK 299
             +RI++ +V  E +FYI GA +YG R PE   PGK+D +G SHQ+FHI+VV+ ++CH K
Sbjct: 241 VLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLK 300

Query: 300 ALMCSYEHVH 309
           A++ SY+ +H
Sbjct: 301 AIIDSYKLMH 310

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  274 bits (701), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 205/321 (63%), Gaps = 10/321 (3%)

Query: 2   ISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYV 61
           +SS      RK T+        E  K    +      +LY++NE+P+WQ+DN+ I++GYV
Sbjct: 1   MSSTTTIRQRKTTVQ-------ETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYV 53

Query: 62  KETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTI--VPKFRTTTVLDYLYI 119
           +ET S   C++SL Y +NESVN+Y+HL+ AV + +  L    I  +P F +TT+ DY+ I
Sbjct: 54  RETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIII 113

Query: 120 DLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPS 179
           + + LGAF CL+ SS FHCFK HS   +   +K+DY+GI+ LIS S+ISLLYYG++D   
Sbjct: 114 NFYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVF 173

Query: 180 LFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYN 239
            F +F+ IT+   +AC+   L D+F + + R  RA+ F+ F  S+V+P+  G++ +G+  
Sbjct: 174 YFKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTE 233

Query: 240 TWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFK 299
            +HR+QL++V  E  FY+ GA LYG R PE   PGK+D  G SHQLFH+LVV+ + CH +
Sbjct: 234 VFHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLR 293

Query: 300 ALMCSYEHVHMFV-IPSMLNI 319
           A+M SY  +H  +  P++L +
Sbjct: 294 AVMGSYMFMHAHINAPNILAL 314

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  274 bits (700), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 207/316 (65%), Gaps = 5/316 (1%)

Query: 2   ISSRPKRSTRKVTIDTAFQDV-VEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGY 60
           I++  +R+   V        + VE   G+T+   +K+  L+N++E+P+WQKDN+ I++GY
Sbjct: 3   ITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKL--LHNFDELPEWQKDNDKILTGY 60

Query: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLM--TSLLNKTIVPKFRTTTVLDYLY 118
           V+ET S+  C+ SLFY +NE+VN+Y+HL+PA+ + +   +L N  ++P F +T+  DY  
Sbjct: 61  VRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTV 120

Query: 119 IDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTP 178
           I++F +GAF+CL+ SS FHC K HS + + F +KLDYLGI+ LIS SMI ++Y+G++D  
Sbjct: 121 INIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHI 180

Query: 179 SLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFY 238
           S F +F  +TL     C    L DKF +   R +RA  F+ FG S +LP+  G + +G  
Sbjct: 181 SYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQ 240

Query: 239 NTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHF 298
              +RI++ +V  E +FYI GA +YG R PE   PGK+D +G SHQ+FHI+VV+ ++CH 
Sbjct: 241 GVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHL 300

Query: 299 KALMCSYEHVHMFVIP 314
           KA++ SY+ +H  + P
Sbjct: 301 KAIIDSYKLMHSHIHP 316

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  272 bits (696), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 204/316 (64%), Gaps = 5/316 (1%)

Query: 2   ISSRPKRSTRKVTIDTAFQDV-VEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGY 60
           I++  +R+   V        + VE  + +T    EK+  L+N++E+P+WQKDN+ I++GY
Sbjct: 3   ITTTRRRNQESVCCKATTASIKVEAVQSKTASEKEKL--LHNFDELPEWQKDNDKILTGY 60

Query: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLM--TSLLNKTIVPKFRTTTVLDYLY 118
           V+ET S+  C+ SLFY +NE+VN+Y+HL+PA+ + +   +L N  ++P F +T+  DY  
Sbjct: 61  VRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTV 120

Query: 119 IDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTP 178
           I++F +GAF+CL+ SS FHC K HS   + F +KLDYLGI+ LIS SMI ++Y+G++D  
Sbjct: 121 INIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHV 180

Query: 179 SLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFY 238
           S F +F  +TL     C    L +KF +   R +RA  F+ FG S +LP+  G + +G  
Sbjct: 181 SYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQ 240

Query: 239 NTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHF 298
              +RI++ +V  E +FYI GA +YG R PE   PGK+D  G SHQ+FHI+VV+ +LCH 
Sbjct: 241 GVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHL 300

Query: 299 KALMCSYEHVHMFVIP 314
           KA++ SY+ +H  + P
Sbjct: 301 KAIIDSYKLMHSHIHP 316

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  271 bits (692), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 137/304 (45%), Positives = 196/304 (64%), Gaps = 11/304 (3%)

Query: 7   KRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66
           +R  ++ TI    Q++      E ++  ++I +LY ++E+P WQKDNE I+SGYV+ETNS
Sbjct: 4   ERGMKEQTISEMAQEMA-HTTSEGLK--KRIRKLYTFDELPAWQKDNELILSGYVRETNS 60

Query: 67  FFSCIESLFYLHNESVNVYSHLIPAVCFLM-----TSLLNKTIVPKFRTTTVLDYLYIDL 121
              C+ ++ Y +NES+N+Y+HLIP V +L+       L+   ++P        ++  +  
Sbjct: 61  VKECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAG---EHRMLRF 117

Query: 122 FFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLF 181
           + LGAFTCL  SS FHC K HS   +   +K+DYLGI+  I+ S ISLLYYG++  PS F
Sbjct: 118 YLLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHF 177

Query: 182 YVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTW 241
             F+ +T++   ACA + L D F +   R  RA LF+ FGLS V+PV+ G Y +GF    
Sbjct: 178 VFFSTLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWA 237

Query: 242 HRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKAL 301
            RIQLK+VL E VFYI GA +YG R PE++ PGK+D+ GHSHQ+FH+LVV+  LCHF+A+
Sbjct: 238 ARIQLKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAV 297

Query: 302 MCSY 305
             SY
Sbjct: 298 TGSY 301

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  269 bits (687), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 129/294 (43%), Positives = 196/294 (66%), Gaps = 4/294 (1%)

Query: 23  VEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESV 82
           VE     T+   +K+  L+N++E+P+WQKDN+ I++GYV+ET S+  C+ SLFY +NE+V
Sbjct: 25  VEAVSSTTVSEKKKL--LHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETV 82

Query: 83  NVYSHLIPAVCFLM--TSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFK 140
           N+Y+HL+PAV + +   +L N  ++P F +T+  DY  I++F +GAF+CL+ SS FHC K
Sbjct: 83  NIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMK 142

Query: 141 SHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSL 200
            HS + + F +KLDYLGI+ LIS SMI ++Y+G++D  S F +F  +TL     C    L
Sbjct: 143 QHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVL 202

Query: 201 KDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGA 260
            +KF +   R +RA  F+ FG S +LP+  G + +G     +RI++ +V  E +FYI GA
Sbjct: 203 HEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGA 262

Query: 261 FLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFVIP 314
            +YG R PE   PGK+D  G SHQ+FHI+VV+ ++CH KA++ SY+ +H  + P
Sbjct: 263 VIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHIHP 316

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  268 bits (686), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 132/308 (42%), Positives = 201/308 (65%), Gaps = 7/308 (2%)

Query: 8   RSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSF 67
           R+ ++     + +  + + + ++   +EK I LY+++E+P WQ+DN+ I+ GYV+ETNSF
Sbjct: 8   RTRKRSKSFRSAKSTITRTRSDSSIKIEKRI-LYHFHELPTWQQDNDKILGGYVRETNSF 66

Query: 68  FSCIESLFYLHNESVNVYSHLIPAVCFLMTSLL------NKTIVPKFRTTTVLDYLYIDL 121
             CIESLFYL+NES+N+YSHLIP++ +L  +++          +P + TTT  D+++I++
Sbjct: 67  TKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINI 126

Query: 122 FFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLF 181
           F +GAF CL+ S  FH  K HS     F +++DY+GI+VLIS SM+ +LYYGF+D   LF
Sbjct: 127 FLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLF 186

Query: 182 YVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTW 241
           Y F  +TL+F   C+ + + + F   + R  RA +F  FG S ++P+I G   +G    +
Sbjct: 187 YCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVF 246

Query: 242 HRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKAL 301
            RI LK++  E VFY+ GA LYG R PE   PGK+D++G SHQLFH  VVI ++ HFKA+
Sbjct: 247 QRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAV 306

Query: 302 MCSYEHVH 309
           + SY  +H
Sbjct: 307 IESYILMH 314

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  268 bits (684), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 128/269 (47%), Positives = 184/269 (68%), Gaps = 2/269 (0%)

Query: 39  QLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTS 98
           +LY+++E+P+WQKDNE I  GYV+ETNSF  C++S+ Y +NESVN+Y+HL+P+V + +  
Sbjct: 21  RLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFILL 80

Query: 99  LLNKTI--VPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYL 156
           LL   +   P F  TT+ +Y+ ID +  G F CL+ S+ FHC K HS       +K+DY+
Sbjct: 81  LLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDYI 140

Query: 157 GIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATL 216
           GI+V I++S++S+LYYGFYD  S     + +TL+ G+ C T  L D+F + + R  RA  
Sbjct: 141 GIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAIF 200

Query: 217 FVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKY 276
           F  FG S V+PV+ G+Y +G      RIQLK+VL   +FYIFGA +YG R PE   PGK+
Sbjct: 201 FTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGKF 260

Query: 277 DIWGHSHQLFHILVVIAALCHFKALMCSY 305
           D  GHSHQ+FH+LVV+ ++CHF+A++ SY
Sbjct: 261 DFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  267 bits (683), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 207/307 (67%), Gaps = 8/307 (2%)

Query: 7   KRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66
           +R   KV            +  +T R+ ++  +L+N+NE+P+WQ+DN+ I++GYV+ET S
Sbjct: 8   RRKPTKVQAVAVGSSNKHADGDKTKRNWKR--RLFNFNELPEWQRDNDKILTGYVRETKS 65

Query: 67  FFSCIESLFYLHNESVNVYSHLIPAVCFLMTS--LLNKTIVPKFRTTTVLDYLYIDLFFL 124
           F  C++SL Y +NE++N+Y+HLIPA+ +L  S  L+N  +VP F TT+++DY  I++F +
Sbjct: 66  FKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINVFLM 125

Query: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184
           GAF CLILSS FHC K HS R  T  +KLDY+GI++LIS S+I ++Y+G++D   L+YV 
Sbjct: 126 GAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFD--HLYYVN 183

Query: 185 AFITLSFGLA--CATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWH 242
            FI L+F  A  C+   L +KF     R +RA +F+ F  S  +P++ G Y +GF+  + 
Sbjct: 184 FFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFE 243

Query: 243 RIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALM 302
           R+ LK+V  E +FYI GA LYG R PE + PG +D  G SHQ+FHILVV+ ++CHF+A++
Sbjct: 244 RVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVI 303

Query: 303 CSYEHVH 309
            SY  +H
Sbjct: 304 KSYILMH 310

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  265 bits (677), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 198/303 (65%), Gaps = 4/303 (1%)

Query: 9   STRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFF 68
           +T  +    +  + +EQ     I S  K  +LY ++E+P+WQ+DN+ II+GY++ET S  
Sbjct: 3   ATTTIRHRRSISEKLEQLTPVAISSTIK--RLYRYSELPEWQQDNDKIITGYIRETKSVK 60

Query: 69  SCIESLFYLHNESVNVYSHLIPAVCFL--MTSLLNKTIVPKFRTTTVLDYLYIDLFFLGA 126
            C++SLF  HNES+N+YSHL+P + +L  +  L +  +VP+F  +T++  + I  F LG+
Sbjct: 61  ECVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGS 120

Query: 127 FTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAF 186
             CL  SS FHC K HS       +K+DY+GI+++I+ S+ISLLYYGF+D    F  F  
Sbjct: 121 VLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTV 180

Query: 187 ITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQL 246
            T+  G  C   +L DKF S+  R +RA  +V FGLS ++P++ G + +G Y    R+QL
Sbjct: 181 FTVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQL 240

Query: 247 KWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYE 306
           K+VLLE +FYI GA +YG RFPE   PGK+D  GHSHQ+FHI+VV+ ++CHF+A++ SY 
Sbjct: 241 KYVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYV 300

Query: 307 HVH 309
            +H
Sbjct: 301 FMH 303

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  261 bits (666), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 179/274 (65%), Gaps = 2/274 (0%)

Query: 38  IQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMT 97
           I+L +++E+PDWQKDNE I++GYV+ETNS   C+ SL   +NES+N+YSHLI A+ + + 
Sbjct: 39  IKLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVV 98

Query: 98  SLLNKTI--VPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDY 155
            L    I  +P F +TT +DY+ IDL+ LGAFTCLI SS FHC K HS   +   +K+DY
Sbjct: 99  LLFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDY 158

Query: 156 LGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRAT 215
           +GI+ LI+ S+ISLLYYG+ D    F VF  ITL     C    L  +F S+  R  RA 
Sbjct: 159 IGIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAG 218

Query: 216 LFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGK 275
            F+ F +SAV+P+  G   +GF     RIQL++V  E  FY+ GA LYG R PE   PG 
Sbjct: 219 FFILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGN 278

Query: 276 YDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           +D+ G SHQ+FHI+V++ ++ H KA++ SY  +H
Sbjct: 279 FDLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMH 312

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  256 bits (654), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 131/316 (41%), Positives = 191/316 (60%), Gaps = 8/316 (2%)

Query: 3   SSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVK 62
           SS P    R  +I +      E  K +   +L     LY + E+P WQ+DNE I++GY++
Sbjct: 11  SSSPLTHHRSKSISSILSQAAEDVKQKITDTL-----LYTYEELPSWQQDNEMILTGYIR 65

Query: 63  ETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLL---NKTIVPKFRTTTVLDYLYI 119
           ETNS+  C+ SL + HNE++N+YSH I A  +L+  +    N   +P F TTT+ DYL +
Sbjct: 66  ETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLHDYLVL 125

Query: 120 DLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPS 179
           D++ LGA TCL LSS FHC K HS   +   +K+DY+GI+ LI+ S ISLLY+G+ D  +
Sbjct: 126 DIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFN 185

Query: 180 LFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYN 239
            F  FA  T    + C      +KF +R+ +  RA  F+ F  S ++P+I G+  +GF  
Sbjct: 186 YFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPE 245

Query: 240 TWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFK 299
            W R+QL  + LE + Y+ GA LYG R PE + PGK+D  G+SHQ FHI VV+ +L H +
Sbjct: 246 VWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLR 305

Query: 300 ALMCSYEHVHMFVIPS 315
           AL+ SY  +H F++ +
Sbjct: 306 ALVGSYYFMHSFLLAT 321

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  238 bits (608), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 179/274 (65%), Gaps = 3/274 (1%)

Query: 39  QLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLM-- 96
           +L  + E+P WQ+DN+ I +GYV+ET S   C+ SL Y +NESVN+YSHL+PAV ++   
Sbjct: 46  RLCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGA 105

Query: 97  TSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYL 156
           T  L++  VP+F TTT  DYL I+ F +GA  CL+ SS FHC K HS R     +++DY+
Sbjct: 106 TLALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYM 165

Query: 157 GIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDK-FRSRECRAYRAT 215
           GI++LI+ S I ++Y+G++D      +F  +T++ G+AC+ V L +K F S   +  RA 
Sbjct: 166 GIILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAA 225

Query: 216 LFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGK 275
            F+ F  + ++P+  G   +G      RI LK+V  E VFYI GA LYG R PE + PGK
Sbjct: 226 FFIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGK 285

Query: 276 YDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
            D+WG+SHQ+FH++VV  +LCH KA++ SY  +H
Sbjct: 286 VDLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  175 bits (444), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 157/290 (54%), Gaps = 32/290 (11%)

Query: 38  IQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMT 97
           +QL N+N++PDWQKDN  I++ YV+ETNS F  + S+F  H+ES+N+++HLIPA+ +   
Sbjct: 6   LQLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPALLYAKF 65

Query: 98  SLLNKTIVPKFRTTTVLDYLYIDLFF--LGAFTCLILSSTFHCFKSHSLRIATFGNKLDY 155
           +         +   T L+ +   + F  +    C +LSS FH FK  S++   F  KLDY
Sbjct: 66  T---------YNAITTLEQVSYPIVFYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDY 116

Query: 156 LGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSREC------ 209
           +GI +LI+ +++S+   GF ++        F+T +  L    + L  K   ++       
Sbjct: 117 VGISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDN 176

Query: 210 ---------------RAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGV 254
                          +  RA LF   GLS ++PVI GLY YG    +++I +  V+   +
Sbjct: 177 DGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVL 236

Query: 255 FYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304
            YI G  +Y  + PEK+ PG++D+ G SHQLFHI +V   +CH+ A+  +
Sbjct: 237 CYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTA 286

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  144 bits (362), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 156/273 (57%), Gaps = 13/273 (4%)

Query: 45  EIPDWQKD--NEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCF--LMTSLL 100
           E+P WQK   N  II+GYV+ETNS   C+ ++ Y +N++VN+  + + +  +  L+    
Sbjct: 46  ELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFT 105

Query: 101 NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVV 160
           +  ++P    TT+ DY+ ++ +  GAF    L+S F+  +SHSL       KL +L  + 
Sbjct: 106 DLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFIN 165

Query: 161 LISTSMISLLYYGFYDTPSLFYVFAFITLSFGLAC---ATVSLKDKFRSRECRAYRATLF 217
            ISTS+I+ LYY F+D  ++FY F F+T+S  L     A  +L ++F  R+ R+ R  + 
Sbjct: 166 YISTSIITQLYYTFFD--NVFY-FKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMVS 221

Query: 218 VCFGLS-AVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKY 276
           + F +S  +LP    ++ +  +    R++ K +LLE   Y+F   L  ++ PE+++   +
Sbjct: 222 ITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-F 280

Query: 277 DIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           D  G+S  ++HI +++ +L HFK L+ SY  +H
Sbjct: 281 DFIGNSENIYHICIILGSLLHFKMLLNSYFFMH 313

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  131 bits (329), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 153/284 (53%), Gaps = 11/284 (3%)

Query: 41  YNWNEIPDWQKD--NEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTS 98
           Y   E+P+WQ++  +  +I+G++KETNSF  C+ S  Y HN S+N+  + I A  + M  
Sbjct: 34  YKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLL 93

Query: 99  LL--NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYL 156
               +  ++P F +TT+ DY+ ++L+ L A    ++ + F+  KSHS + A    KL+ +
Sbjct: 94  FFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNI 153

Query: 157 GIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSF--GLACATVSLKDKFRSRECRAYRA 214
           G++  I++S+++LLYY ++D    F  F  +TL       C+ +S  D F ++  R  + 
Sbjct: 154 GLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIIS--DSF-NKMTRIRKN 210

Query: 215 TLFVCF-GLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTP 273
            L + +  L  ++P +  +  +G      RI L  ++LE   Y FG  +   + PE++  
Sbjct: 211 FLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFF- 269

Query: 274 GKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFVIPSML 317
             +D  G+S  ++ + +++ +  HFK LM SY  +H  V P  L
Sbjct: 270 NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHSGVNPPTL 313

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  106 bits (265), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 156/310 (50%), Gaps = 30/310 (9%)

Query: 27  KGETIRSLEKIIQLYNWNEIPDWQK--DNEHIISGYVKETNS-FFSCIESLFYLHNESVN 83
           + +T++S  KI+ L    ++P W +   N  I +GY   TN+ +  C++ L   +N+S++
Sbjct: 2   EKKTVQS--KIVTL---EKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSIS 56

Query: 84  VYSHLIPAVCFLMTSLL-----NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHC 138
           +Y +L   VC L++ ++     +  ++P   +TT+ DY+ I+LF +   T     +    
Sbjct: 57  IYMNL---VCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQL 113

Query: 139 FKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATV 198
            K HS       N+   L +V+L++ S+++LLYY F+D   LF +F   T       + V
Sbjct: 114 LKGHSEYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIV 173

Query: 199 SLKDKFRSRECRAYRATLFVCFG-LSAVLPVICGLYHYGFYNTW--HRIQLKWVLLEGVF 255
            + D+++    R  + +  V FG LS  LP+   +  +G ++++   RI  + +  E V 
Sbjct: 174 IINDQYK----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVL 229

Query: 256 YIFGAFLYGIRFPEKY--TPGK----YDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
           Y   A L   R PE    T G      D  G+S Q+  ++ + A + HF  ++ +YE VH
Sbjct: 230 YSLSAMLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

Query: 310 MFV-IPSMLN 318
             + +P M++
Sbjct: 290 ASIHVPPMIS 299

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 139/319 (43%), Gaps = 49/319 (15%)

Query: 29  ETIRSLEKIIQLYNWN--------------EIPDWQKDNEHIISGYV---KETNSFFSCI 71
           E   S++K IQ YNW+              E+P   ++N +II GY        S  S +
Sbjct: 273 EDPHSIKKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSVV 332

Query: 72  ESLFYLHNESVNVYSHLIPAV--CFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTC 129
            + +  HNE++N++SHL  AV   +L+   L  T V   +   +   L I +F +    C
Sbjct: 333 -NWYGWHNETLNIWSHLFGAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKC 391

Query: 130 LILSSTFHCFKSH-SLRIATFGNKLDYLGIVVLISTSMISLLYYGFYD--TPSL---FYV 183
           L+ SS +H       L +      +DY GI VLI+ S++S  +   Y+  T SL     V
Sbjct: 392 LLSSSVWHTLNGTCCLPLRCKFACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTV 451

Query: 184 FAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCF-GLSAV----LPVICGLYHYG-- 236
           +  ++L  G+  + ++   +F   E R +R   +V   GL  +    L +  G+ H    
Sbjct: 452 YMSLSLCLGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQF 511

Query: 237 FYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALC 296
           F   W+R          ++Y+ G   YG   PE+        W    +L + +   A LC
Sbjct: 512 FKPVWNR--------SLIWYLIGVVFYGSFIPER--------WRTDVELDYTIPTDAELC 555

Query: 297 HFKALMCSYEHVHMFVIPS 315
               ++  ++HVH   +PS
Sbjct: 556 SNLDILTKHKHVHFRAVPS 574

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 101/212 (47%), Gaps = 7/212 (3%)

Query: 104 IVPKFRTTTVL-DYLYIDLFFLGAFTCLILSSTFHCFKSHSLRI-ATFGNKLDYLGIVVL 161
           ++P F TTT + DY+  + + L  F   ++   +H  K+ SL+       K  YL  + L
Sbjct: 89  LIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINL 148

Query: 162 ISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFG 221
           + +S I++LYY FYD    F +F  +    GLA   V L DK  S + R  +   F+   
Sbjct: 149 LISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVS 207

Query: 222 LSAV-LPVICGLYHY-GFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY--TPGKYD 277
           +    LP++  +  + G  N   RI+L  +  E V  +  + +Y  RFPE       K +
Sbjct: 208 VVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEE 267

Query: 278 IWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
            W HS   FH+L+   A  HF  L+ SY  +H
Sbjct: 268 GWNHSEYFFHLLISGTAFYHFFILIQSYILMH 299

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 103/212 (48%), Gaps = 7/212 (3%)

Query: 104 IVPKFRTTTVL-DYLYIDLFFLGAFTCLILSSTFHCFKSHSLRI-ATFGNKLDYLGIVVL 161
           ++P F TTT + DY+  + + L  F   ++   +H  K+ SL+       K  YL  + L
Sbjct: 89  LIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINL 148

Query: 162 ISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFG 221
           + +S I++LYY FYD    F +F  +    GL      L DK  S + R  +   F+   
Sbjct: 149 LISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVS 207

Query: 222 -LSAVLPVICGLYHY-GFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKY--D 277
            +   LP++  +  + G  N   RI++  +  E V  +  + +Y  RFPE +  GK   +
Sbjct: 208 VICCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEE 267

Query: 278 IWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
            W HS  LFH+++  AA  HF  L+ SY  +H
Sbjct: 268 GWNHSEYLFHLIISGAAFYHFFILIQSYILMH 299

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 101/212 (47%), Gaps = 7/212 (3%)

Query: 104 IVPKFRTTTVL-DYLYIDLFFLGAFTCLILSSTFHCFKSHSLRI-ATFGNKLDYLGIVVL 161
           ++P F TTT + DY+  + + L  F   ++   +H  K+ SL+       K  YL  + L
Sbjct: 89  LIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINL 148

Query: 162 ISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFG 221
           + +S I++LYY FYD    F +F  +    GL      L DK  S + R  +   F+   
Sbjct: 149 LISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVS 207

Query: 222 LSAV-LPVICGLYHY-GFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY--TPGKYD 277
           +    LP++  +  + G  N   RI++K +  E V  +  + +Y  RFPE       K +
Sbjct: 208 VVCCSLPLLTAIITFDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEE 267

Query: 278 IWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
            W HS  LFH+++   A  HF  L+ SY  +H
Sbjct: 268 SWNHSEYLFHLVISGTAFYHFFILIQSYILMH 299

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 100/212 (47%), Gaps = 7/212 (3%)

Query: 104 IVPKFRTTTVL-DYLYIDLFFLGAFTCLILSSTFHCFKSHSLRI-ATFGNKLDYLGIVVL 161
           ++P F TTT + DY+  + + L  F   ++   +H  K+ SL+       K  YL  + L
Sbjct: 89  LIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINL 148

Query: 162 ISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFG 221
           + +S I++LYY FYD    F +F  +    GL      L DK  S + R  +   F+   
Sbjct: 149 LISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVS 207

Query: 222 LSAV-LPVICGLYHY-GFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY--TPGKYD 277
           +    LP++  +  + G  N   RI++  +  E V  +  + +Y  RFPE       K +
Sbjct: 208 VVCCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEE 267

Query: 278 IWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309
            W HS  LFH+L+   A  HF  L+ SY  +H
Sbjct: 268 GWNHSEYLFHLLISGTAFYHFFILIQSYILMH 299

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 113/250 (45%), Gaps = 41/250 (16%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFSCIESLFY---LHNESVNVYSHLIPA--VCFLMTSL 99
           E+P   ++N++II GY +  + F+  I S+F    +HNE+ N+++H++ A  + +L+T  
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 100 LNKTIVPKFRTTTVLDYLYIDLFFLGA-FTCLILSSTFHCFK-SHSLRIATFGNKLDYLG 157
             KT +            YI   FLGA   C+  S  +H F  + S+R+      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 158 IVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLF 217
           I +LIS S++S  Y   YD P     +  ++  F +    ++   KF S E R  R   F
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFF 426

Query: 218 VCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEG----------------VFYIFGAF 261
           V      +L  + GL    F N         V LEG                ++YI G F
Sbjct: 427 V------LLAAVGGL---SFVNL--------VCLEGLSRAIWLFSPVTNKSVIYYIIGVF 469

Query: 262 LYGIRFPEKY 271
            YG   PE++
Sbjct: 470 FYGSFIPERF 479

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 108/231 (46%), Gaps = 6/231 (2%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMT---SLLN 101
           ++P   ++N +II+ Y +  +S    + S+F LHNE+ N++SHL+ A+ FL      L N
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 102 KTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHS-LRIATFGNKLDYLGIVV 160
             IV      T    L++ LF   +  C++ S+ +H F   S L++      +DY GI +
Sbjct: 256 SIIVSSSMVPTTAK-LFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISI 314

Query: 161 LISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCF 220
           LI++S++S+ +   YD P++   +   +   G+    ++    F S E R  R   F+  
Sbjct: 315 LITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILL 374

Query: 221 GLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY 271
                  ++  ++          + L       V+Y+ G   YG   PE++
Sbjct: 375 SSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPERF 425

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/378 (20%), Positives = 146/378 (38%), Gaps = 90/378 (23%)

Query: 18  AFQDVVEQNKGETIRSLEKIIQLYNWN--------------EIPDWQKDNEHIISG---Y 60
            + ++ +   G+ +   +   + Y+W               E+P   ++N +II G   Y
Sbjct: 203 GYDELPDATDGDAVSVADGGDKSYSWAKSYMLGRARHLHYYELPQPWRENPYIIYGHRFY 262

Query: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFL--------MTSLLNKTIVPKFRTTT 112
                S  S I +++  HNE++N++SH+  A+  L         + + N T VPK     
Sbjct: 263 HSHKKSLLS-ILNVYGWHNETINIWSHIAGAIILLYIMLRGFPNSDVFNSTQVPKVAKGA 321

Query: 113 VLDYLYIDLFFLGAFTCLILSSTFHCFKSH-SLRIATFGNKLDYLGIVVLISTSMISLLY 171
           +       +F L    C++ S  +H F     L + +  + +DY GI +LI+ S+++   
Sbjct: 322 IY------VFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGITILITASVMTTEA 375

Query: 172 YGFYD-TPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVIC 230
           +  Y   P   Y++  I+L  G+  A  +   +F   + R +R   +V      ++  + 
Sbjct: 376 FTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFYVILAGLGLISFV- 434

Query: 231 GLYHYGFYNTWHRIQLKWVLLEG---VFYIFGAFLYGIRFPEKY---------------- 271
              H   ++ W   +L    L     V+Y+ G   Y    PE++                
Sbjct: 435 ---HLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPERWRSRILLSHPVQNPVDT 491

Query: 272 ---------------------TPGKYDIWG-----------HSHQLFHILVVIAALCHFK 299
                                 P + D  G           HSH L+HI VV+  + H++
Sbjct: 492 NFPSSDSNIPSENIDNIHFKSKPKESDQLGFWSLWWVDYFCHSHFLWHIFVVLGVVGHYR 551

Query: 300 ALMCSYEHVHMFVIPSML 317
           A + +   ++    PS+L
Sbjct: 552 ATL-AMARMNWLDTPSIL 568

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 75/348 (21%), Positives = 139/348 (39%), Gaps = 74/348 (21%)

Query: 18  AFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESL--- 74
           + +D +     +T  +L +     ++ ++P   ++N +II GY +  +S   C+ S+   
Sbjct: 91  SIRDYINTFNWQTAYNLGRSNNTLHYYQLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNY 149

Query: 75  FYLHNESVNVYSHL--------IPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGA 126
           +  HNE++N++SHL        I    +  T +    ++P    TT    L++  F +  
Sbjct: 150 YGWHNETLNIWSHLGGFLTLLYIAVFVYPNTEVYQSELIP----TTAKMLLFV--FLIAG 203

Query: 127 FTCLILSSTFHCFK---SHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYV 183
             C++ S  +H F    S++LR       +DY GI +LI+ S+++  Y      P   ++
Sbjct: 204 MKCMLASVFWHTFDGTCSYTLRPKFCC--VDYTGITILITASILTAEYVSLSHAPIWMFI 261

Query: 184 FAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNT-WH 242
           +  ++L+ G     ++   KF   E R  R   FV       L  +  ++     +  W 
Sbjct: 262 YMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFVTLSAMGCLSFVHLIFTTSLRHACWL 321

Query: 243 RIQLKWVLLEGVFYIFGAFLYGIRFPEKY------------------------------- 271
              +  +    ++Y+ G F YG   PEKY                               
Sbjct: 322 LAPI--ISKSTIWYVIGVFFYGSFIPEKYRSDYILDKTIPTSKQLSCDLSIITKDRHIHF 379

Query: 272 ----TPGK-------------YDIWGHSHQLFHILVVIAALCHFKALM 302
               TP K              D  G SH ++HI V++  + H+KA +
Sbjct: 380 RDQPTPNKNGPRKTGLRSLWWVDYVGQSHTIWHIFVLLGVVGHYKACL 427

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 106/236 (44%), Gaps = 14/236 (5%)

Query: 45  EIPDWQKDNEHIISGY--VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLN- 101
           ++P   ++N +II+GY    + +     + + +  HNE+ N++SHL+ A+ F    L   
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 102 --KTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSH-SLRIATFGNKLDYLGI 158
               IV          Y+ + LF L    C++ S  +H F    S+++      +DY GI
Sbjct: 315 PKSFIVQSPEVPPSAKYI-VYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGI 373

Query: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218
            +LI+ S+++  +   YD  S+  V+  ++L FG     ++   KF S E R  R   F+
Sbjct: 374 TILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI 433

Query: 219 CFGLSAVLPVICGLYHYGF-YNTW--HRIQLKWVLLEGVFYIFGAFLYGIRFPEKY 271
                  L      Y  G  Y  W    +  K +    V+Y+ G F YG   PE++
Sbjct: 434 LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSI----VWYLIGVFFYGSFIPERF 485

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 130/315 (41%), Gaps = 64/315 (20%)

Query: 39  QLYNWNEIPDWQKDNEHIISG---YVKETNSFFSCIESLFYLHNESVNVYSHLIPA--VC 93
            L+ W E+P   ++N +II G   Y     S  S + + +  HNE++N++SHL+ A  + 
Sbjct: 104 HLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWSHLVGAAVLA 161

Query: 94  FLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSH-SLRIATFGNK 152
           +L+     ++ V +      L    I  F      C+  S  +H F     L++ +    
Sbjct: 162 YLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVC 221

Query: 153 LDYLGIVVLISTSMISLLYYGFYD-TPSLFYVFAFITLSFGLACATVSLKDKFRSRECRA 211
           +DY GI +L++ S+++ +    Y  +  L Y +   ++  G A   ++    F   E R 
Sbjct: 222 VDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEARP 281

Query: 212 YRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKW---------VLLEGVFYIFGAFL 262
            R  ++V  GL+A+     GL    F + W  +Q++W         V    V+Y  G   
Sbjct: 282 LRIAVYV--GLAAL-----GL--VSFVHVW--MQVRWASAHLMAPLVYKSLVWYGIGVVF 330

Query: 263 YGIRFPEKYTPGK------------------------------YDIWG-----HSHQLFH 287
           Y    PE++                                  + +W      HSH L+H
Sbjct: 331 YATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWH 390

Query: 288 ILVVIAALCHFKALM 302
           + VV+  + H++A++
Sbjct: 391 VFVVLGVVGHYRAVL 405

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 90/199 (45%), Gaps = 8/199 (4%)

Query: 78  HNESVNVYSHLIPAVCFLMTSLL---NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSS 134
           HNES N+++HL+ A+  +  S+    N  I    +  T    L + LF   A  CL+ S 
Sbjct: 289 HNESSNIWTHLLGAIYLIYLSIYDFPNSEIFQSEKVPTTAK-LIVYLFLFAAIKCLLASV 347

Query: 135 TFHCFKSHS-LRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGL 193
            +H F   S L++ +    +DY GI +LI+ S+++  +   Y +     ++  I+LS G+
Sbjct: 348 FWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGM 407

Query: 194 ACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGF-YNTWHRIQLKWVLLE 252
               ++   KF   E R  R   F+      VL  +   Y     Y TW    +    + 
Sbjct: 408 FGVFMNWSPKFDRPEARPLRIKFFILLASMGVLSFLHLTYLTNLQYATWLLTPVTNKSI- 466

Query: 253 GVFYIFGAFLYGIRFPEKY 271
            V+Y+ G   YG   PE++
Sbjct: 467 -VWYLVGVVFYGSFIPERF 484

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 133/342 (38%), Gaps = 74/342 (21%)

Query: 16  DTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYV---KETNSFFSCIE 72
           D AFQ+             EK++  Y   E+P   ++N +II  Y        S  S I 
Sbjct: 206 DVAFQE-----------GREKLLHYY---ELPFPWRENRYIIHNYRFYDSNVKSLLSAI- 250

Query: 73  SLFYLHNESVNVYSHLIP--AVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCL 130
           + +  HNE+ N++SH +    V +L      +++V +           + +F   A  CL
Sbjct: 251 NWYGWHNETSNIWSHFLGFFYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCL 310

Query: 131 ILSSTFHCFKSHS-LRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITL 189
           I S+ +H F   + L++      +DY GI +LI+ S+++  +    D   +  ++  I+L
Sbjct: 311 IASAFWHTFNGTAFLKMRRRFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISL 370

Query: 190 SFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTW-HRIQLKW 248
           + G+    ++   +F + E R  R   F+      VL  I   Y      +W + + L  
Sbjct: 371 TLGIIGVFLNCSPQFDTPEARPLRIRFFMLLAAMGVLSFINASY----LESWAYAVDLLS 426

Query: 249 VLLEG--VFYIFGAFLYGIRFPEKY----------------------------------- 271
            +     V+Y+ G   YG   PE++                                   
Sbjct: 427 PITNKSIVWYLVGVVFYGSFIPERFRTDVVVDDRIPTTFQLGTDLDIITKDKEIHFRHKP 486

Query: 272 ------TPGKYDIW-----GHSHQLFHILVVIAALCHFKALM 302
                   G +  W     G SH  +HI VV+  + H+KA++
Sbjct: 487 TCCHHPRKGIFSCWWVDYVGCSHTFWHIFVVLGVVGHYKAII 528

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 107/245 (43%), Gaps = 32/245 (13%)

Query: 45  EIPDWQKDNEHIISGY---VKETNSFFSCIESLFYLHNESVNVYSHLIPAVC-------- 93
           ++P   ++N++II GY        SF S I + +  HNE+ N+++HL+  +         
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSII-NWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 94  FLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFK-SHSLRIATFGNK 152
           F  +++     VPK     V       +F   A  C+  S  +H F  +H LR+ +    
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVA------VFLAAAIKCMFASVFWHTFNGTHLLRLRSKFAC 321

Query: 153 LDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAY 212
           +DY GI +LI+ S++++ +   YD       +   +L+ G+   +++   KF   E R  
Sbjct: 322 VDYTGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPL 381

Query: 213 RATLFVCF---GLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEG---VFYIFGAFLYGIR 266
           R   F+     G S+ + ++       F   W         L     V+Y+ G F YG  
Sbjct: 382 RIKFFILLATVGCSSFIRLV-------FLTNWRYAADLLTPLTNKSVVWYLIGVFFYGSF 434

Query: 267 FPEKY 271
            PE++
Sbjct: 435 IPERF 439

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 109/237 (45%), Gaps = 16/237 (6%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFSCIESLFYL---HNESVNVYSHLIPAVCFLMTSLLN 101
           ++P   ++N +II GY +  N+    + S+F     HNE+ N++SHL+ A+  +  ++ +
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 102 KTIVPKFRTTTVLDYLY--IDLFFLGAFTCLILSSTFHCFKSHS-LRIATFGNKLDYLGI 158
                 +R + V       + +F   A  C++ S  +H F   S L++ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218
            +LI+ S+++  +   Y      Y +  I+L+ G+    ++   +F   E R  R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 219 CFGLSAVLPVICGLY----HYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY 271
                 VL  +  ++    HY     +  +  K V    V+Y+ G   YG   PE++
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYA-ATLFSPVTYKSV----VWYLVGVVFYGSFIPERF 450

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 106/241 (43%), Gaps = 18/241 (7%)

Query: 42  NWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYL---HNESVNVYSHLIPAVCFLMTS 98
           N+ ++P   ++N +II  Y +  +S    + S+F     HNE+ N+++HLI  +  +  +
Sbjct: 217 NYYQLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMA 275

Query: 99  LLNKTIVPKFRTTTV--LDYLYIDLFFLGAFTCLILSSTFHCFKSH-SLRIATFGNKLDY 155
           + +      F +  +     L + LF   A  CL  S  +H F    +L++ +    +DY
Sbjct: 276 VYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDY 335

Query: 156 LGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRAT 215
            GI +LI+ S+++  +   Y +     V+  I+LS G+    ++   KF   E R  R  
Sbjct: 336 SGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIK 395

Query: 216 LFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEG-----VFYIFGAFLYGIRFPEK 270
            FV      VL  +    H  F   W      W+L        V+Y  G   YG   PE+
Sbjct: 396 FFVLLASMGVLSFL----HLTFLTDWK--YATWLLAPVTNKSIVWYCIGVVFYGSFIPER 449

Query: 271 Y 271
           +
Sbjct: 450 F 450

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 103/233 (44%), Gaps = 8/233 (3%)

Query: 45  EIPDWQKDNEHIISGYV---KETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLN 101
           ++P   ++N +II GY      + S  S I + +  HNE+ N++SHL+ A+  +  ++ +
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSII-NWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 102 KTIVPKFRTTTVLDYLY--IDLFFLGAFTCLILSSTFHCFKSHS-LRIATFGNKLDYLGI 158
                 +R   V       + +F   A  C++ S  +H F   S LR+ +    +DY GI
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218
            +LI+ S+++  +   Y        +  I+L+ G+    ++   +F   E R  R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 219 CFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY 271
                 VL  +  ++    Y    R+         V+Y+ G   YG   PE++
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYA-SRLFGPVTYKSVVWYLVGVVFYGSFIPERF 449

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 123/280 (43%), Gaps = 56/280 (20%)

Query: 33  SLEKIIQLYNWN--------------EIPDWQKDNEHIISGYV---KETNSFFSCIESLF 75
           S+ + IQL+N++              E+P   ++N  II GY      T S  S + + +
Sbjct: 210 SIGQTIQLFNYDVAFKTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLSIL-NWY 268

Query: 76  YLHNESVNVYSHLIPAV--------CFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGA- 126
             HNE+ N+++HL  ++         F  +S+     VP+F         Y+   FLGA 
Sbjct: 269 GWHNETTNIWTHLFGSLYIAYLAFYEFPQSSVYLSGDVPQFAK-------YMVYLFLGAG 321

Query: 127 FTCLILSSTFHCFKSH-SLRIATFGNKLDYLGIVVLISTSMISLLY---YGFYDTPSLFY 182
           F CL+ S T+H F     L + +    +DY GI VLI+ S+++  +   YG  D P+   
Sbjct: 322 FKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPV 381

Query: 183 VFAFI---TLSFGLACATVSLK-----DKFRSRECRAYRATLFVCFGLSAV--LPVICGL 232
            F+ I    +S  L C  V +      D+  SR  R     L    G  A   L +I   
Sbjct: 382 TFSLIFYMAVSSVLCCFGVFMNWSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNF 441

Query: 233 YHYGFYNTWHRIQLKWVLLEGV-FYIFGAFLYGIRFPEKY 271
            H    ++W    ++ VL + V +Y+ G   YG   PE++
Sbjct: 442 AH----SSW---LIRPVLDKSVCWYLIGVIFYGSFIPERW 474

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 102/233 (43%), Gaps = 8/233 (3%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFS--CIESLFYLHNESVNVYSHLIPAVCFLMTSLLN- 101
           ++P   ++N  II GY    + + S   I + +  HNE+ N+++HL  A+  L  ++ + 
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYDF 195

Query: 102 -KTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSH-SLRIATFGNKLDYLGIV 159
            +T V +     ++    + +F   A  C++ S   H F     L + +    +DY GI 
Sbjct: 196 PRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGIT 255

Query: 160 VLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVC 219
           +LI+ S+++  +   Y+ P     +  ++   G+    ++   KF   E R  R   F+ 
Sbjct: 256 MLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRIKFFIL 315

Query: 220 FGLSAVLPVI-CGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY 271
                 L  +  GL     Y +W    +    L  V+Y+ G   YG   PE++
Sbjct: 316 LAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSL--VWYLLGVAFYGSFVPERF 366

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 119/290 (41%), Gaps = 42/290 (14%)

Query: 45  EIPDWQKDNEHIISGYV---KETNSFFSCIESLFYLHNESVNVYSHLIPAVC-------- 93
           E+P   ++N  II+GY        S  S + + +  HNE+ N+++HL+  +         
Sbjct: 218 ELPFPWRENRCIINGYRFYNSHKKSLLSIV-NWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 94  FLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSL-RIATFGNK 152
           F  + +     VPK     ++ Y+    F + A  CL  S  +H F   SL R+      
Sbjct: 277 FPSSEVFMSEQVPK--AAKLITYV----FLIAAAKCLFSSVFWHTFNGTSLLRLRCKFAC 330

Query: 153 LDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAY 212
           +DY GI +LI+ S+++  +   Y  P     +  ++ + G+    ++   KF   E R  
Sbjct: 331 VDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPL 390

Query: 213 RATLFVCFGLSAVLP-----VICGLYHYGFYNTW--HRIQLKWVLLEGVFYIFGAFLYGI 265
           R   F+      +L       I  L H    +TW    I  K V    V+Y+ G   YG 
Sbjct: 391 RIKFFILLASMGILSFLHLTFITSLSH----STWLLSPITKKSV----VWYLVGVVFYGS 442

Query: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFVIPS 315
             PE++   + DI     Q  H +     L     ++   +H+H    P+
Sbjct: 443 FIPERW---RTDI-----QYDHTIPTSHELSTNVDIINKEKHIHFRETPT 484

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 121/287 (42%), Gaps = 40/287 (13%)

Query: 14  TIDTAFQDVVEQNKGETIRS------LEKIIQL-----YNWNEIPDWQKDNEHIISGYVK 62
            I+ +FQ +  QN  E + +       E  +QL      ++ E+P   ++N  II GY +
Sbjct: 179 AIEKSFQSI--QNDAEAVAASIKFHNYEVALQLGQQRHLHYYELPFPWRENRFIIHGY-R 235

Query: 63  ETNSFFSCIESLFYL---HNESVNVYSHLIPAV--CFLMTSLLNKTIVPKFRTTTVLDYL 117
             NS+   + S+F     HNE+VN+++HL  A+   FL+    ++T V +          
Sbjct: 236 FYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKGFSQTTVYQSELVPTAAKF 295

Query: 118 YIDLFFLGAFTCLILSSTFHCFKS--HSLRIATFGNKLDYLGIVVLISTSMISLLYY--- 172
              +F      C + S  +H F    H L+  +    +DY GI VL++ S+++  +    
Sbjct: 296 MAFVFLTAGLECFLFSVVWHTFNGICH-LKQRSNCACVDYTGITVLVTASILTTEFVTLS 354

Query: 173 GFYDTPSLFYVFAFITLSFGLACATV--SLKDKFRSRECRAYRAT---LFVCFGLSAVLP 227
           G  D    + +  F   S  L    V  +   KF   E R  R     L   FG  + L 
Sbjct: 355 GSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYLLLASFGFFSYL- 413

Query: 228 VICGLYHYGFYNTW--HRIQLKWVLLEGV-FYIFGAFLYGIRFPEKY 271
                 H   +NT       +K V ++ + +YI G   YG   PE++
Sbjct: 414 ------HSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPERW 454

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 104/233 (44%), Gaps = 8/233 (3%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFSCIESLFYL---HNESVNVYSHLIPAVCFLMTSLLN 101
           ++P   ++N +II GY +  N+    + S+F     HNE+ N++SHL+ A+  +  ++ +
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 102 --KTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHS-LRIATFGNKLDYLGI 158
             ++ V K           + +F   A  C++ S  +H F   S L++ +    +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218
            +LI+ S+++  +   Y        +  I+L+ G+    ++   +F   E R  R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 219 CFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKY 271
                 VL  +  ++         R+         V+Y+ G   YG   PE++
Sbjct: 398 LLATMGVLSFLHLIFLTDLRYA-ARLFSPVTYKSVVWYLVGVAFYGSFIPERF 449

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 106/243 (43%), Gaps = 28/243 (11%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFSCIESL---FYLHNESVNVYSHLIPAV--------C 93
           ++P   ++N +II GY +  N+ +  + S+   +  HNE+ N+++HL+ A+         
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 94  FLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHS-LRIATFGNK 152
           F  + +     VP+     V        F   A  C++ S  +H F   S L + +    
Sbjct: 278 FPHSEVWQNPEVPQQARWIVF------AFLAAALKCMLSSVFWHTFNGTSFLGLRSKFAC 331

Query: 153 LDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAY 212
           +DY GI +LI+ S+++  +   Y        +  I+L+ G+    ++   +F   E R  
Sbjct: 332 VDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPL 391

Query: 213 RATLFVCFGLSAVLPVICGLY----HYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFP 268
           R   F+      VL  +  ++    HY  +  +  +  K V    V+Y+ G   YG   P
Sbjct: 392 RIRFFILLATMGVLSFLHLIFLTDLHYAIW-LFSPVTNKSV----VWYLVGVVFYGSFIP 446

Query: 269 EKY 271
           E++
Sbjct: 447 ERF 449

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 109/241 (45%), Gaps = 19/241 (7%)

Query: 45  EIPDWQKDNEHIISGYVKETNSFFSCIESLFYL---HNESVNVYSHLIPA--VCFLMTSL 99
           E+P   ++N  II GY +  NS+   + S+F     HNE+VN+++HL  A  + +L+   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 100 LNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKS--HSLRIATFGNKLDYLG 157
            ++T V +             +F L    C + S  +H F    H L+  +    +DY G
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICH-LQQRSNCACVDYTG 356

Query: 158 IVVLISTSMISLLYY---GFYDTPSLFYVFAFITLS--FGLACATVSLKDKFRSRECRAY 212
           I +L++ S+++  +    G  + P  + +  F T S   G+    ++   KF   E R  
Sbjct: 357 ITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRPL 416

Query: 213 RATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQL-KWVLLEGV-FYIFGAFLYGIRFPEK 270
           R   ++   L A       L+   F+ +    +L K VL + + +Y+ G   YG   PE+
Sbjct: 417 RIAFYL---LLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFYGTFIPER 473

Query: 271 Y 271
           +
Sbjct: 474 W 474

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 104 IVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLIS 163
           +VP+  +TT+ DY+ +++F   AF C        CF +      T G+ L  + ++   +
Sbjct: 118 LVPRHVSTTMTDYVLLNVFLATAFQCAACH-MVQCFTT------TAGSVLSTITMLNHWA 170

Query: 164 TSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAY 212
            S ++LLYY +YD    F + A  T ++ L  A V++     +   R +
Sbjct: 171 CSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQW 219

>TBLA0I01570 Chr9 (342266..346123) [3858 bp, 1285 aa] {ON} Anc_2.559
           YMR012W
          Length = 1285

 Score = 32.3 bits (72), Expect = 2.0,   Method: Composition-based stats.
 Identities = 36/141 (25%), Positives = 66/141 (46%), Gaps = 32/141 (22%)

Query: 31  IRSLEKIIQLYNWNEIPDWQKDNEHIISGYVK----ETNSF-FSCIESLFYLHNESVNVY 85
           +RSL     L ++N +P + +   H++  Y++    E  +F  +CI S FY++N +VN +
Sbjct: 226 VRSL----ALSSYNPVPAFYRTKGHLL--YLQVITLEGETFHITCIPSGFYVNNSTVNRF 279

Query: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145
               P++  L +S+ N+  + K+   T+ D               +LS+    F SH   
Sbjct: 280 D---PSIKILDSSIANEDELIKY---TLFD---------------LLSTVSKKFSSHVND 318

Query: 146 IATFGNKLDYLGIVVLISTSM 166
           +     KLD +  V  +ST +
Sbjct: 319 LDKNLEKLDSVQYVKAVSTYL 339

>KAFR0A08020 Chr1 complement(1604597..1607530) [2934 bp, 977 aa]
           {ON} Anc_2.8 YNL236W
          Length = 977

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 56  IISGYVKETNSFFSCIESLFYLHNESVNVYSHLIP--AVCFLMTSLLNKTIVPKFRTTTV 113
           +I+G   E  + F  +  LF   +    +++H +P   V  L  +LL K    K   TT+
Sbjct: 126 MITGQGLEGATTFEKLTLLF--QDNIYKMHNHAMPLSPVNQLQNTLLEKKQTKKEYNTTI 183

Query: 114 LDYLYI--DLFFLGAFTCLILSSTFHCFKSHSLRIATFG 150
           LD+ +I      +G+  C +  S+  C+++ + +++ FG
Sbjct: 184 LDFHWISSSKAIIGSQFC-VFDSSVKCYRNKAQQVSPFG 221

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.143    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,923,912
Number of extensions: 1464667
Number of successful extensions: 5198
Number of sequences better than 10.0: 78
Number of HSP's gapped: 5268
Number of HSP's successfully gapped: 78
Length of query: 321
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 211
Effective length of database: 40,868,139
Effective search space: 8623177329
Effective search space used: 8623177329
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 66 (30.0 bits)