Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G025006.65ON28928912581e-176
NCAS0F003306.65ON2812176323e-81
KNAG0M010206.65ON2792566239e-80
ZYRO0D14190g6.65ON2952236179e-79
Kpol_1042.116.65ON2921706152e-78
TBLA0G005506.65ON3182186052e-76
Smik_15.3526.65ON2881725794e-73
SAKL0A08426g6.65ON2991725771e-72
NDAI0J013206.65ON3342185773e-72
YOR174W (MED4)6.65ON2841805594e-70
Skud_15.3366.65ON2861725585e-70
CAGL0L04620g6.65ON2642605532e-69
AGR270W6.65ON2942465534e-69
Suva_8.2276.65ON2872215517e-69
TPHA0F025906.65ON3061765251e-64
KLTH0G15444g6.65ON2632225062e-62
Kwal_56.232426.65ON2561725027e-62
KLLA0F20185g6.65ON2851715048e-62
TDEL0G040606.65ON2201634613e-56
Ecym_31246.65ON2741704377e-52
NDAI0F002905.702ON155442750.73
TPHA0D037406.311ON231738731.2
NDAI0A004601.46ON576112702.6
SAKL0G12650g5.213ON62792703.0
CAGL0B04939g1.386ON60097676.0
TPHA0E039701.9ON74782677.1
KAFR0D006701.76ON1388106669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G02500
         (289 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   489   e-176
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   248   3e-81
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   244   9e-80
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   242   9e-79
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   241   2e-78
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   237   2e-76
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   227   4e-73
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   226   1e-72
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   226   3e-72
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   219   4e-70
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   219   5e-70
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   217   2e-69
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   217   4e-69
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   216   7e-69
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   206   1e-64
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   199   2e-62
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   197   7e-62
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   198   8e-62
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   182   3e-56
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   172   7e-52
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    33   0.73 
TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {...    33   1.2  
NDAI0A00460 Chr1 complement(80213..81943) [1731 bp, 576 aa] {ON}...    32   2.6  
SAKL0G12650g Chr7 complement(1078086..1079969) [1884 bp, 627 aa]...    32   3.0  
CAGL0B04939g Chr2 complement(480761..482563) [1803 bp, 600 aa] {...    30   6.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...    30   7.1  
KAFR0D00670 Chr4 (111615..115781) [4167 bp, 1388 aa] {ON} Anc_1....    30   9.1  

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  489 bits (1258), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 246/289 (85%), Positives = 246/289 (85%)

Query: 1   MNDLTLGHRKXXXXXXXGEXXXXXXXXXXXXDSASGASPAITKVGIYSDLSQYEETLSRL 60
           MNDLTLGHRK       GE            DSASGASPAITKVGIYSDLSQYEETLSRL
Sbjct: 1   MNDLTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRL 60

Query: 61  IQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILE 120
           IQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILE
Sbjct: 61  IQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILE 120

Query: 121 TLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIG 180
           TLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIG
Sbjct: 121 TLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIG 180

Query: 181 PNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPE 240
           PNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPE
Sbjct: 181 PNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPE 240

Query: 241 KKDSSSRRGSYIFAGQSGXXXXXXXXXXXXXXXXXXVXXXXXXFNPDDF 289
           KKDSSSRRGSYIFAGQSG                  V      FNPDDF
Sbjct: 241 KKDSSSRRGSYIFAGQSGKNAEHKNNEENKEEADNAVDLDLDLFNPDDF 289

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  248 bits (632), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 154/217 (70%), Gaps = 10/217 (4%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           I+KV IYSDL  YE+ L+ L+ S+D +KPD   A+ELI++D  LF +LDSF +YD+I + 
Sbjct: 41  ISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNS 100

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           LK    +  E   +TKEIL  LNECH+ LN LP + QV FEM T+L+QR KINSSVLLDY
Sbjct: 101 LKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDY 160

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDD 220
           ATKLSKFTKIPPTFDKGSIGPNNF+WPAEDALRRGMLALA+ H DELTK  G        
Sbjct: 161 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPGAHEG---- 216

Query: 221 NSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQS 257
                 E + +  G  PI +++  ++RR S+ F+G++
Sbjct: 217 ------EEELIPKGSEPIAQEEPVTTRRESFTFSGKT 247

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  244 bits (623), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 127/256 (49%), Positives = 168/256 (65%), Gaps = 9/256 (3%)

Query: 34  ASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQ 93
           A+  +  + KV IYS + +YE+TL+ L++S+D+YKPD  +AQ L+D D +LF SLD F +
Sbjct: 33  AAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKE 92

Query: 94  YDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKIN 153
           YD IS+RL + + +      KT++ILE LNECH+ LN LP ++QV FEM+T+LEQR+KIN
Sbjct: 93  YDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKIN 152

Query: 154 SSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGV 213
           SS LLDYATKLSKFT+IPPTFDKGSIGPNNF+WPAEDALR+GMLA+AA H+ ELT+I G 
Sbjct: 153 SSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPG- 211

Query: 214 EMSLSDDNSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGXXXXXXXXXXXXXXX 273
                DD   A D+ K  +  + P P    +  RR S++F   S                
Sbjct: 212 ----QDD---AEDKKKQTEKPDVPEPAPV-TEERRSSFVFGDTSTADDQKSSSAHSDHDD 263

Query: 274 XXXVXXXXXXFNPDDF 289
              +      FNPD+F
Sbjct: 264 DDAMDLDLDLFNPDEF 279

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  242 bits (617), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 120/223 (53%), Positives = 157/223 (70%), Gaps = 13/223 (5%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           ++KV IY+DL+QYEE L+ L++S+D +KPD KI  ELI++D  L+ SLDSF +YDRI S 
Sbjct: 43  LSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSE 102

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           L   +K+  E   KTKE+LETL+EC+  LN LP ++QV FE  ++L+QR K+NSSVLL+Y
Sbjct: 103 LNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNY 162

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG-------- 212
           ATKLSKFTKIPPTFDKG+IGPNNFVWPAEDALRRGMLA+A+ H+ E+T+I G        
Sbjct: 163 ATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGEPEEEEAD 222

Query: 213 --VEMSLSDDNSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIF 253
              +    D N    +E K+   GE P       + RR S++F
Sbjct: 223 ATEKQGSGDKNGKEGEETKT---GERPASPGAHGNERRQSFVF 262

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  241 bits (615), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 110/170 (64%), Positives = 144/170 (84%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           ++KV IY+D+S+YE TL +L++S+D +KPD K+A +LID+D +LF SLDSFV+YD+IS++
Sbjct: 42  LSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTK 101

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           L++ +K+  E   KTKEIL TLNECH  LN LP ++QV FE + +L+QR KINS +LLDY
Sbjct: 102 LEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDY 161

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKI 210
           ATKLSKFTKIPPTF+KGSIGPNNF+WPAEDALRRGMLA+A+ H+ ELTK+
Sbjct: 162 ATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTKL 211

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  237 bits (605), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 119/218 (54%), Positives = 160/218 (73%), Gaps = 4/218 (1%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           ++K+  Y+DL QYEETLS+L  S+D YKPD + A +LIDID KL+++LDSFV+YD IS++
Sbjct: 37  LSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTK 96

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           LK  E   K    KTK +L++LN+CH  LN LP ++QV FE NTML+QR+KINS VLLDY
Sbjct: 97  LKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDY 156

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGV---EMSL 217
           ATKL+KFTKIPPTF+K ++GPNNF+WPAEDALRRGMLA+A++HT+ELT + G    E + 
Sbjct: 157 ATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGDEENS 216

Query: 218 SDDNSIALDEIKSVDAG-EGPIPEKKDSSSRRGSYIFA 254
            D + +  D++ + D   +  I  +     RRGS+ F 
Sbjct: 217 KDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFG 254

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  227 bits (579), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 135/172 (78%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           ++KV +Y DL +YE+TL +L++S+D +KPD  +A++LI ID  LFN++D   +YD I   
Sbjct: 37  LSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRN 96

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           L+  +K  +E   KTK ILE +NECH+ L  LP ++QV FE NT+L+QR KINS+ LLDY
Sbjct: 97  LRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDY 156

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG 212
           ATKLSKFT+IPPTFDKGSIGPNNF+WPAEDALRRGMLA+A+ H+ ELT++ G
Sbjct: 157 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG 208

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  226 bits (577), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 101/172 (58%), Positives = 135/172 (78%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           +++V +Y+D+ +YEETL +L+ S+D +KPD K+AQELI+ D KLF +L+ F +YD+I  R
Sbjct: 44  LSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGR 103

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           L D EKQ +E   KT +ILE LN CH  LN LP ++QV  E +TML+QR+KI S VLLDY
Sbjct: 104 LNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDY 163

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG 212
           A KL+KFT++PPTFDKG +GPNNF+WPAEDA+RRGMLA+A+  + ELT+I G
Sbjct: 164 AMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  226 bits (577), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 157/218 (72%), Gaps = 1/218 (0%)

Query: 40  AITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISS 99
            +++V IY D+  YE+ LSRLI S+D +KP+  IAQELI  D  LF++L+SF+QYD I  
Sbjct: 75  VLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDL 134

Query: 100 RLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLD 159
            LK  E +  +    T+  L+TLNECH+ LN LPT+ Q+ FE+NT+L QR KINS++LLD
Sbjct: 135 HLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLD 194

Query: 160 YATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSD 219
           YATKLSKFTKIPPTFDKGSIGPNNF+WPAED+LRRGMLA+A+   D+LT I G   S+S 
Sbjct: 195 YATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSK 254

Query: 220 DNSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQS 257
           + ++  +  ++ +  +    + ++   RR S++F+G++
Sbjct: 255 EKALPTEVQETQEQTQT-QQQDQEEQPRRESFVFSGKN 291

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  219 bits (559), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 137/180 (76%)

Query: 33  SASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFV 92
           S + +   ++KV +Y DL +YE+TLS+L++S+D +KP+  IA++LI  D  LF ++    
Sbjct: 29  SNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLA 88

Query: 93  QYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKI 152
           +YD I   L+  +K  +E   KT++ILE LNECH+ L  LP ++QV FE NT+L+QR KI
Sbjct: 89  EYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKI 148

Query: 153 NSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG 212
           NS+ LLDYATKLSKFTKIPPTFDKG++GPNNF+WPAEDALRRGMLA+A+ H+ ELT+I G
Sbjct: 149 NSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  219 bits (558), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 99/172 (57%), Positives = 134/172 (77%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           ++KV +Y DL +YE  LS+L++S+D +KPD  +A++LI  D  LFN++     YD I   
Sbjct: 37  LSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRN 96

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           L+  +K  +E   K+++ILE LNECH+ L+ LPT++QV FE NT+L+QR KINS+ LLDY
Sbjct: 97  LQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDY 156

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG 212
           ATKLSKFTKIPPTFDKG++GPNNF+WPAEDALRRGMLA+A+ H+ ELT++ G
Sbjct: 157 ATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG 208

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  217 bits (553), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 112/260 (43%), Positives = 164/260 (63%), Gaps = 5/260 (1%)

Query: 32  DSASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSF 91
           +S + +   + KV +YSDL  YEE L++L+ S+D +KP  +I ++LI+ D KL+++LD  
Sbjct: 8   NSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLL 67

Query: 92  VQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKK 151
            QYD + +RL+  + +  +   +TK IL  LNECH+ LN LP +++V FE   +L+QR+K
Sbjct: 68  PQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREK 127

Query: 152 INSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIA 211
           I S+VLL+YATKL+KFTKIPPTFDKG+IGPNNF+WPAEDALR+GMLA+A+ H  ELTK+ 
Sbjct: 128 IKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLP 187

Query: 212 GVEMSLSDDNSIALDE--IKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGXXXXXXXXXXX 269
           G E    D ++   D+  +K  +  EG I  ++D      S++F G +            
Sbjct: 188 GQEDGEEDGSTANEDKNIVKDAEGAEGEI--RQDDKKEDDSFVF-GANANDAEGDEDKNA 244

Query: 270 XXXXXXXVXXXXXXFNPDDF 289
                  +      FNPD+F
Sbjct: 245 GEDEDEAMDSDLDLFNPDEF 264

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  217 bits (553), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 154/246 (62%), Gaps = 1/246 (0%)

Query: 44  VGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKD 103
           V IY DL QYEE+L RL+ S+D ++PD + AQELI+IDSKL+++L    +YD I S+LK 
Sbjct: 50  VAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKK 109

Query: 104 FEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATK 163
            E++ K+   +T +IL  L EC+N LN LP V+QV FEM TM +Q+ K+NSSVLL+YA K
Sbjct: 110 LEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMK 169

Query: 164 LSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSI 223
           LSKFT++PPTF+K +IGPNNF+WPAEDA+RRGMLA+A+  + ELT + G +     + + 
Sbjct: 170 LSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG-QSDQEAEQAS 228

Query: 224 ALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGXXXXXXXXXXXXXXXXXXVXXXXXX 283
           A  E  +   G   +       +RRGS+ F G                     +      
Sbjct: 229 AGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKPPPASDADSSVVDDGDASMDLDLNL 288

Query: 284 FNPDDF 289
           FNPD+F
Sbjct: 289 FNPDEF 294

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  216 bits (551), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 150/221 (67%), Gaps = 15/221 (6%)

Query: 42  TKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRL 101
           +KV +Y DL +YE+ L +L++S+D +KP+ +IA++LI  D  LFN++     YD+I   L
Sbjct: 38  SKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNL 97

Query: 102 KDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYA 161
           +  +K  +E   KT++ILE LNECH+ L+ LP ++QV FE  T+L+QR KINS+ LLDYA
Sbjct: 98  RKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYA 157

Query: 162 TKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDN 221
           TKLSKFT+IPPTFDKG++GPNNF+WPAEDALRRGMLA+A+ H+ ELT+I G E   +   
Sbjct: 158 TKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGEEEQET--- 214

Query: 222 SIALDEIKSVDAGEGPIPEKKDSSSR-------RGSYIFAG 255
                E    D    P  EKK+SS         + S+IF G
Sbjct: 215 -----EEVPTDTLSQPQKEKKESSENSPQNSPTKDSFIFNG 250

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  206 bits (525), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 135/176 (76%)

Query: 35  SGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQY 94
           + A  ++  V IY+D+  YE+TL +L+ SID ++PD ++A+ LI++D +L+ +L SF +Y
Sbjct: 51  TAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEY 110

Query: 95  DRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINS 154
           D I +++   +   ++  L+TK IL+ LN+  N LN LP +++++FE + M E++KKINS
Sbjct: 111 DEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINS 170

Query: 155 SVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKI 210
            +LLDYATK+SKFTKIPPTF+KGSIGPNNF+WPAEDALRRGMLA+A+ H  ELTK+
Sbjct: 171 KILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKL 226

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  199 bits (506), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 147/222 (66%), Gaps = 14/222 (6%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           ++K+ +Y+D+ ++E+TL +L+ S+D + PD ++A+ LI+ D +L+ SL+   +YD I +R
Sbjct: 22  LSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTR 81

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
            K  +++ +++  KT  ILETL EC + LN LP ++QV FE  TML+QR+K+ + VLLDY
Sbjct: 82  AKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDY 141

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMS---- 216
           A KL+KFT +PPTFDKG++GPNNFVWPAEDA+RRGMLA+A+    E       + S    
Sbjct: 142 AMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGANAQEQQASSEQK 201

Query: 217 ---LSDDNSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAG 255
               S +N  A  +I+S D  E P+       +RR S+ F G
Sbjct: 202 TSEKSSENEEAQTDIRSPDTKEEPV-------ARRPSFGFDG 236

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  197 bits (502), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 126/172 (73%)

Query: 35  SGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQY 94
           + A   ++K  IYSD+ ++EETL +L+ S+D + PD KIA+ LI++D +L  +L+S  +Y
Sbjct: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75

Query: 95  DRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINS 154
           D I  R K+ +++  E+  +   ILETL EC   LN LP ++QV FE  TML+QR+K+ +
Sbjct: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135

Query: 155 SVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDE 206
           +VLLDYA KL+KFT +PPTFDKG++GPNNFVWPAEDA+RRGMLA+A+    E
Sbjct: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASE 187

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  198 bits (504), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 126/171 (73%)

Query: 37  ASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDR 96
            S  +  VGIY DL +YEET+ +L +S+DT+KPD  +  ++I+ D KL+ +L+ F +Y +
Sbjct: 28  VSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYK 87

Query: 97  ISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSV 156
           I   L   +K++K    KT+EILETLN C+N+LN LP ++QV FE   ML+QR+KI+S V
Sbjct: 88  IEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKV 147

Query: 157 LLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDEL 207
           +LDYA KL+KFT+ PPTFDK  IGPNNF+WPAED+LR+GMLA+A+    EL
Sbjct: 148 VLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  182 bits (461), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 83/163 (50%), Positives = 116/163 (71%), Gaps = 3/163 (1%)

Query: 46  IYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFE 105
           +Y DL++YEE L RL++S+D ++PD   A+EL++ D  L  SLD F  YD +   L+  +
Sbjct: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63

Query: 106 KQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLS 165
           ++ +     T   LETL+EC+ AL+ LP ++QV FE   +LEQR ++NS+VLL+YATKLS
Sbjct: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123

Query: 166 KFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELT 208
           KFTK P      ++GPNNFVWPAEDALRRG LA+AA H++E+T
Sbjct: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  172 bits (437), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 86/170 (50%), Positives = 127/170 (74%)

Query: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100
           + +V +Y DL Q+EE L +L+ S+D + PD + AQ+LI+ D KL+++L+    YD I  +
Sbjct: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81

Query: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160
           LK  + + +E   +T +IL  L++C+N LN LP V+QV FEM  M +Q++KI S VLL+Y
Sbjct: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEY 141

Query: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKI 210
           A KL+KFT++PPTF+K +IGPNNF+WPAEDA+RRGMLA+A+  ++ELT+I
Sbjct: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRI 191

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 46  IYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNS 87
           ++++++ Y++ + RL  S +   P+KKI QEL+D+  KL NS
Sbjct: 294 LHNEIASYKKQIERLT-SKNLETPEKKIIQELVDLKEKLVNS 334

>TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {ON}
            Anc_6.311 YMR207C
          Length = 2317

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 58   SRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYD 95
            S+ + +ID  +PD KI +ELI+ D  +F+SL  F+  D
Sbjct: 1138 SKFLNNIDHPQPDLKILEELIECDFAIFDSLFPFLVND 1175

>NDAI0A00460 Chr1 complement(80213..81943) [1731 bp, 576 aa] {ON}
           Anc_1.46 YCL029C
          Length = 576

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 14/112 (12%)

Query: 53  YEETLSRLIQSIDTYKP---DKKIAQELID--IDSKLFNSLDSFVQYDRISSRLKDFEKQ 107
           YE  + +    I  YK    D+++  E I   ID    N  D  +Q   ++++L     Q
Sbjct: 260 YEIKIDKQRNEISQYKKLLDDQRMVLEEIQPTIDQYEKNLHDMELQLQNVNNQLN----Q 315

Query: 108 EKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLD 159
           E+E  LK K+  ET +E      LL  +DQ+H E+    +Q   IN++  +D
Sbjct: 316 EREQQLKQKQFFETEHE-----QLLAVIDQLHEEIKENEKQFININNNKSID 362

>SAKL0G12650g Chr7 complement(1078086..1079969) [1884 bp, 627 aa]
           {ON} similar to uniprot|P54790 Saccharomyces cerevisiae
           YLL004W ORC3 Subunit of the origin recognition complex
           which directs DNA replication by binding to replication
           origins and is also involved in transcriptional
           silencing
          Length = 627

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 24/92 (26%)

Query: 39  PAITKVGIYSDLSQYEETLSRLIQSID-TYKPDKKIAQELIDIDSKLFNSLDSFV----- 92
           P ++ +GI  DLS        L+Q+ D  +K + K+     D+DS  F +LD F+     
Sbjct: 170 PDLSSLGIAYDLS--------LVQNFDKVFKKNLKLIFNFKDVDSFNFQTLDDFILLLKS 221

Query: 93  --QYDR--------ISSRLKDFEKQEKESTLK 114
             +Y++        I++ L + EK  K+ST++
Sbjct: 222 ALKYEKVEICLVFNINTNLSNIEKNLKQSTIR 253

>CAGL0B04939g Chr2 complement(480761..482563) [1803 bp, 600 aa] {ON}
           similar to uniprot|Q06247 Saccharomyces cerevisiae
           YLR173w
          Length = 600

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 89  DSFVQYDRISSRLKDFEK--QEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTML 146
           D F+ +D+I+  +K+     Q     LKT  + E  N  H  + L+P V  +  +++  L
Sbjct: 240 DDFIDWDKIAISVKELHDLLQRSNLGLKTINVKEQTNGFH--VRLVPKVTDLVNDISRFL 297

Query: 147 EQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNN 183
             R   N + ++  A KL    K+P   +  SIG +N
Sbjct: 298 RHRLFFNQAFVIP-ALKLD--VKVPDCLELFSIGLSN 331

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 74  AQELI-DIDSKLFNSLDSFVQYDRISSRLKDFEKQE--KESTLKTKEILETLNECHNALN 130
           A ELI + D ++    D F Q+D+I + LKD +K    K +T K  EI + + +CH    
Sbjct: 141 ATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHK--- 197

Query: 131 LLPTVDQVHFEMNTMLEQRKKI 152
                D V   +N   E+R +I
Sbjct: 198 -----DYVRSGLNLSEEKRNEI 214

>KAFR0D00670 Chr4 (111615..115781) [4167 bp, 1388 aa] {ON} Anc_1.76
            YCR042C
          Length = 1388

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 6/106 (5%)

Query: 73   IAQELIDI---DSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNAL 129
            + Q L+DI   +    N  D  +   R+ + +      +KE     K+++E LN   N  
Sbjct: 971  VKQFLLDILTYNENAENPFDDIIYLTRLINNVVTCTINDKEDKSFLKKVVEQLNRYENLD 1030

Query: 130  NLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFD 175
              +PT  QV   M T+LE++ ++N + L D+   L K+ +    +D
Sbjct: 1031 TWIPTY-QVKL-MKTILEEKLRLNIAGLYDFGN-LKKYLQYSLNYD 1073

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,214,405
Number of extensions: 1021449
Number of successful extensions: 4248
Number of sequences better than 10.0: 112
Number of HSP's gapped: 4426
Number of HSP's successfully gapped: 112
Length of query: 289
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 181
Effective length of database: 41,097,471
Effective search space: 7438642251
Effective search space used: 7438642251
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)