Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0F018601.195ON54252528020.0
KNAG0C025201.195ON59252819930.0
Smik_10.811.195ON53352919470.0
Suva_6.2311.195ON54353919410.0
YJL153C (INO1)1.195ON53352919360.0
Skud_10.631.195ON53352919330.0
CAGL0I06050g1.195ON53853218840.0
SAKL0F00396g1.195ON52752518670.0
NDAI0B001201.195ON56753618550.0
TDEL0C035801.195ON53050818460.0
NCAS0I027501.195ON58351418440.0
KLLA0D16412g1.195ON52952518340.0
ZYRO0G18150g1.195ON53052518100.0
TPHA0A028801.195ON54053717890.0
TBLA0C020701.195ON53653117860.0
Kpol_2001.171.195ON47147217000.0
KLLA0D14707g3.425ON88080770.93
KLLA0D12694g6.278ON136783751.9
Smik_2.537.387ON1113138707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0F01860
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...  1083   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   772   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...   754   0.0  
Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...   752   0.0  
YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...   750   0.0  
Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...   749   0.0  
CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...   730   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   723   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   719   0.0  
TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...   715   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   714   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   711   0.0  
ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...   701   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   693   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   692   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   659   0.0  
KLLA0D14707g Chr4 (1242483..1245125) [2643 bp, 880 aa] {ON} simi...    34   0.93 
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    33   1.9  
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...    32   7.5  

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/525 (100%), Positives = 525/525 (100%)

Query: 18  PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNK 77
           PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNK
Sbjct: 18  PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNK 77

Query: 78  VGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGND 137
           VGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGND
Sbjct: 78  VGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGND 137

Query: 138 VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSI 197
           VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSI
Sbjct: 138 VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSI 197

Query: 198 YYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTA 257
           YYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTA
Sbjct: 198 YYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTA 257

Query: 258 NTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGL 317
           NTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGL
Sbjct: 258 NTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGL 317

Query: 318 IELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQ 377
           IELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQ
Sbjct: 318 IELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQ 377

Query: 378 FRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLML 437
           FRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLML
Sbjct: 378 FRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLML 437

Query: 438 GGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQEFHKFYPILSFLSYWL 497
           GGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQEFHKFYPILSFLSYWL
Sbjct: 438 GGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQEFHKFYPILSFLSYWL 497

Query: 498 KAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR 542
           KAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR
Sbjct: 498 KAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR 542

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/528 (70%), Positives = 440/528 (83%), Gaps = 7/528 (1%)

Query: 21  SVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELE-ITPFEQDYQFKINLN-PNKV 78
           ++ FNP+LCTLS + NEL+S +KYQN+++  D  T  +  ++P E +Y FK++L+ P KV
Sbjct: 64  AIPFNPQLCTLSRETNELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEKV 123

Query: 79  GIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDV 138
           G++LVG GGNNGST LAS+LAN+  + FN +EG    N++GSMTQSST+KLG+D +GNDV
Sbjct: 124 GVLLVGFGGNNGSTLLASILANRQKMVFNNKEGPQRANFFGSMTQSSTMKLGVDVKGNDV 183

Query: 139 FAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIY 198
           F PFNS+LPM +P +FVV GWDIN+ NLF AMQR  VLEYDLQ KLK  ME+  P+KS+Y
Sbjct: 184 FVPFNSVLPMADPTEFVVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSVY 243

Query: 199 YPDFIAMNQFERANNCINQNDDGQ-FNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTA 257
           YPDFIA+NQF+RANNCIN    G+ F+T  K  DL +IR+DI+ FK+ N L+ +IVLWTA
Sbjct: 244 YPDFIALNQFDRANNCINATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWTA 303

Query: 258 NTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGL 317
           NTERCV+IIP VND+ D+L+ +I+DNH EI+PS IFA A+I+E VPYINGSPQNTFVPGL
Sbjct: 304 NTERCVDIIPSVNDSADSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL 363

Query: 318 IELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQ 377
           I+LAE +DVLIAGDDFK+GQTKLKSV+ QFLVDAGIKPVSIASYNHLGNNDG NLSS  Q
Sbjct: 364 IDLAERHDVLIAGDDFKSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQRQ 423

Query: 378 FRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLML 437
           FRSKEISKSSVIDDCI SN+IL+N      K NHCIVIKY+ AVGDSKVAMDEYYS+LML
Sbjct: 424 FRSKEISKSSVIDDCIQSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELML 483

Query: 438 GGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGE----DQEFHKFYPILSFL 493
           GGHNRISIHNVCEDSLLA+P+IIDLLVMTEF SRI Y+K+ +      +F  FYPIL+FL
Sbjct: 484 GGHNRISIHNVCEDSLLAAPLIIDLLVMTEFFSRIKYQKIEDGAPPSDKFSDFYPILTFL 543

Query: 494 SYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           SYWLKAPLTR GF+PINSLNRQRLALENFLRLL+GLPPNDELRFEERL
Sbjct: 544 SYWLKAPLTRKGFQPINSLNRQRLALENFLRLLIGLPPNDELRFEERL 591

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/529 (68%), Positives = 433/529 (81%), Gaps = 9/529 (1%)

Query: 18  PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-PN 76
           P  SVK     CT +   NEL+++Y Y+N++V K     + ++TP  QDY FK++LN P 
Sbjct: 8   PIASVKVVTDKCTYT--ENELLTKYSYENAVVTK-TAGGQFDVTPTVQDYVFKLDLNKPK 64

Query: 77  KVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGN 136
           K+GIML+GLGGNNGST +AS+LAN++++ F T+EG  +PNY+GSMTQ STLKLGID+EGN
Sbjct: 65  KLGIMLIGLGGNNGSTLVASILANRHDMEFQTKEGLKKPNYFGSMTQCSTLKLGIDAEGN 124

Query: 137 DVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKS 196
           DV+APFNS+LPMVNPNDF+VSGWDIN  NL+ AMQR +VLEYDLQ +LK  M + KPL S
Sbjct: 125 DVYAPFNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVKPLPS 184

Query: 197 IYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWT 256
           IYYPDFIA NQ ERANNCIN ++ G+  T+ KW+ L +IR+DI+ FK  N+L+ +IVLWT
Sbjct: 185 IYYPDFIAANQDERANNCINLDEKGKVTTRGKWSHLQQIRRDIQHFKEENSLDKVIVLWT 244

Query: 257 ANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPG 316
           ANTER VE+  GVNDTM NL+ SIKD+H EI+PS +FA A+I+E VPYINGSPQNTFVPG
Sbjct: 245 ANTERYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNTFVPG 304

Query: 317 LIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHA 376
           L++LAEH    IAGDDFK+GQTKLKSV+ QFLVDAGIKPVSIASYNHLGNNDG NLS+  
Sbjct: 305 LVQLAEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPK 364

Query: 377 QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLM 436
           QFRSKEISKSSVIDD I SN+IL+N K    K +HCIVIKYMK VGDSKVAMDEYYS+LM
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELM 423

Query: 437 LGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQEFH----KFYPILSF 492
           LGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF SR++YKK    QE H     FYP+L+F
Sbjct: 424 LGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKGSSVQEDHDKYESFYPVLTF 483

Query: 493 LSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           LSYWLKAPLTR GF P+N LN+QR ALENFLRLL+GLP  +ELRFEERL
Sbjct: 484 LSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEERL 532

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/539 (67%), Positives = 433/539 (80%), Gaps = 19/539 (3%)

Query: 18  PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-PN 76
           P  SV+     CT +  +NEL+++Y Y+N++V K       ++TP  QDY FK++LN P 
Sbjct: 8   PTASVRVASNKCTYT--DNELLTKYSYENAVVSK-TPDGRYDVTPTVQDYVFKLDLNKPA 64

Query: 77  KVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGN 136
           K+G+MLVGLGGNNGSTF A++LANK+NI F T+EG  +PNY+GSMTQSSTLKLGID++GN
Sbjct: 65  KLGVMLVGLGGNNGSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGN 124

Query: 137 DVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKS 196
           DV+APFNS+LPM NPNDFVV+GWDIN+ N F AMQRA+VLEYDLQ +LK  M S KPL S
Sbjct: 125 DVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPS 184

Query: 197 IYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWT 256
           IYYPDFIA NQ +RANNCIN ++ G   T+ KW  L +IR DI+ FK  N+L+ +IVLWT
Sbjct: 185 IYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWT 244

Query: 257 ANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPG 316
           ANTER VE+  GVNDTM+NL+ SIKD+H EI+PS IFA A+I+E VPYINGSPQNTFVPG
Sbjct: 245 ANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304

Query: 317 LIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHA 376
           L++LAEH    IAGDDFK+GQTK+KSV+ QFLVDAGIKPVSIASYNHLGNNDG NLS+  
Sbjct: 305 LVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPK 364

Query: 377 QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLM 436
           QFRSKEISKSSVIDD I SN+IL+N K   +K +HCIVIKYMK VGDSKVAMDEYYS+LM
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLG-NKVDHCIVIKYMKPVGDSKVAMDEYYSELM 423

Query: 437 LGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQ--------------E 482
           LGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF SR++YKK    Q              +
Sbjct: 424 LGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENENDGK 483

Query: 483 FHKFYPILSFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           F  FYP+L+FLSYWLKAPLTR GF P+N LN+QR ALENF+RLL+GLP  +ELRFEERL
Sbjct: 484 FESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/529 (68%), Positives = 433/529 (81%), Gaps = 9/529 (1%)

Query: 18  PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-PN 76
           P  SVK     CT    +NEL+++Y Y+N++V K   +   ++TP  QDY FK++L  P 
Sbjct: 8   PITSVKVVTDKCTYK--DNELLTKYSYENAVVTK-TASGRFDVTPTVQDYVFKLDLKKPE 64

Query: 77  KVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGN 136
           K+GIML+GLGGNNGST +AS+LANK+N+ F T+EG  +PNY+GSMTQ STLKLGID+EGN
Sbjct: 65  KLGIMLIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGN 124

Query: 137 DVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKS 196
           DV+APFNS+LPMV+PNDFVVSGWDIN+ +L+ AMQR++VLEYDLQ +LK  M   KPL S
Sbjct: 125 DVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPS 184

Query: 197 IYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWT 256
           IYYPDFIA NQ ERANNCIN ++ G   T+ KW  L +IR+DI++FK  N L+ +IVLWT
Sbjct: 185 IYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWT 244

Query: 257 ANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPG 316
           ANTER VE+ PGVNDTM+NL+ SIK++H EI+PS IFA A+I+E VPYINGSPQNTFVPG
Sbjct: 245 ANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304

Query: 317 LIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHA 376
           L++LAEH    IAGDD K+GQTKLKSV+ QFLVDAGIKPVSIASYNHLGNNDG NLS+  
Sbjct: 305 LVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPK 364

Query: 377 QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLM 436
           QFRSKEISKSSVIDD I SN+IL+N K    K +HCIVIKYMK VGDSKVAMDEYYS+LM
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELM 423

Query: 437 LGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQE----FHKFYPILSF 492
           LGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF +R++YKK+   +E    F  FYP+L+F
Sbjct: 424 LGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTF 483

Query: 493 LSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           LSYWLKAPLTR GF P+N LN+QR ALENFLRLL+GLP  +ELRFEERL
Sbjct: 484 LSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/529 (68%), Positives = 431/529 (81%), Gaps = 9/529 (1%)

Query: 18  PRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-PN 76
           P  SV+     CT + D  EL+++Y Y+N++V K       ++TP  QDY FK+ L+ P+
Sbjct: 8   PTASVRVATEKCTYTED--ELLTKYSYENAVVSK-TPDGRFDVTPTVQDYVFKVGLDKPD 64

Query: 77  KVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGN 136
           K+GIMLVGLGGNNGST +AS+LANK++I F+T+EG  +PNY+GSMTQSSTLKLG+D+ GN
Sbjct: 65  KLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGN 124

Query: 137 DVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKS 196
           DV+APFNS+LPMVNPNDFV+SGWDIND NL  AMQRA+VLEYDLQ +L   M + KPL S
Sbjct: 125 DVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPS 184

Query: 197 IYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWT 256
           +YYPDFIA NQ ERANNCIN +  G   T  KW  L +IR DI+DFK  N+L+ +IVLWT
Sbjct: 185 VYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWT 244

Query: 257 ANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPG 316
           ANTER VEI  GVNDTM+NL+ SIK++H EI+PS IFA A+I+E VPYINGSPQNTFVPG
Sbjct: 245 ANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304

Query: 317 LIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHA 376
           L++LAEH  V IAGDD K+GQTKLKSV+ QFLVDAGIKP+SIASYNHLGNNDG NLS+  
Sbjct: 305 LVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPK 364

Query: 377 QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLM 436
           QFRSKEISKSSVIDD I SN+IL+N K    K +HCIVIKYMK VGDSKVAMDEYYS+LM
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELM 423

Query: 437 LGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQE----FHKFYPILSF 492
           LGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF SR++YK++   QE    F  FYP+L+F
Sbjct: 424 LGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTF 483

Query: 493 LSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           LSYWLKAPLTR GF P+N LN+QR ALENF+RLL+GLP  +ELRFEERL
Sbjct: 484 LSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/532 (66%), Positives = 434/532 (81%), Gaps = 11/532 (2%)

Query: 21  SVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-PNKVG 79
           S++ N     +S   NEL++ Y Y  ++V  +    + E+TP +++YQFK++LN P ++G
Sbjct: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERLG 67

Query: 80  IMLVGLGGNNGSTFLASLLANKNNISFNTR--EGTVEPNYYGSMTQSSTLKLGIDSEGND 137
           +MLVGLGGNNGST +A++LANK+N+ F TR  EG  EPNYYGS+TQSST+KLG+DS+G D
Sbjct: 68  VMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127

Query: 138 VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSI 197
           V+ PFNS++PMVNPNDFVVSGWDIN   +  AM+RA VLE DL++KL P M+ +KPLKS+
Sbjct: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187

Query: 198 YYPDFIAMNQFERANNCINQN-DDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWT 256
           YYPDFIA NQ ERA+NC+N +   G+  T  KW  L  IR DI+ FK  N+L+ +I+LWT
Sbjct: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247

Query: 257 ANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPG 316
           ANTER VEI+PGVNDTM+NL+ +IK++H+EI+PS IFA A+I+E  PYINGSPQNTFVPG
Sbjct: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307

Query: 317 LIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHA 376
           LIELAE ND LIAGDDFK+GQTK+KSV+ QFLVDAGI+PVSIASYNHLGNNDG NLSS  
Sbjct: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367

Query: 377 QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLM 436
           QFRSKEISK+SV+DD I SN IL+N K   +K +HCIVIKYM AVGDSKVAMDEYYS+LM
Sbjct: 368 QFRSKEISKASVVDDIIESNPILYNDK-LGNKIDHCIVIKYMHAVGDSKVAMDEYYSELM 426

Query: 437 LGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKM-GED-----QEFHKFYPIL 490
           LGGHNRISIHNVCEDSLLA+P+IIDL+VMTEF SR+TY+ + G+D      +F  FYP+L
Sbjct: 427 LGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVL 486

Query: 491 SFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR 542
           SFLSYWLKAPLT+ G++PIN LN+QR ALENFLRLL+GLP  DELRFEERL+
Sbjct: 487 SFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/525 (67%), Positives = 421/525 (80%), Gaps = 8/525 (1%)

Query: 20  PSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVG 79
           P VK     C   G  ++LI+ Y Y+N+IV K          P  ++YQFK++L   K+G
Sbjct: 7   PKVKVATENCQYRG--SDLITNYTYKNTIVSK-CSDGSYSAQPVVENYQFKVDLKVPKLG 63

Query: 80  IMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDVF 139
           +MLVGLGGNNGSTF+AS+LANK+ I FN++EGT+  NYYGS+TQ+ST+KLGID++GNDV+
Sbjct: 64  VMLVGLGGNNGSTFIASILANKHKIQFNSKEGTIGANYYGSVTQASTIKLGIDADGNDVY 123

Query: 140 APFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYY 199
            PFNS+LP VNPNDFVV GWDIN  N++ AM RAKVLEYDLQ KLK  ME   PL S+YY
Sbjct: 124 VPFNSVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHPLPSVYY 183

Query: 200 PDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTANT 259
           PD+IA NQ ERANNCIN+   G  +T++KW+ + KIR+DI+DFK  N L+ +IVLWTANT
Sbjct: 184 PDYIAANQDERANNCINRVK-GTVSTKNKWDHVEKIRKDIRDFKETNGLDKVIVLWTANT 242

Query: 260 ERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGLIE 319
           ER  ++I GVND  +NL+ +IK +H+EISPS IFA A+I+E VPYINGSPQNTFVPG++E
Sbjct: 243 ERYSDLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNTFVPGIVE 302

Query: 320 LAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQFR 379
           LAE N   I GDDFK+GQTKLKSV+ QFLVDAGI+PVSIASYNHLGNNDG NLSS  QF+
Sbjct: 303 LAEKNKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPKQFK 362

Query: 380 SKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLMLGG 439
           SKEISKSSV+DD I SN IL+N+K    K +HCIVIKYM AV DSKVAMDEYYS+LMLGG
Sbjct: 363 SKEISKSSVVDDIIASNSILYNEKLGK-KIDHCIVIKYMPAVADSKVAMDEYYSELMLGG 421

Query: 440 HNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQ---EFHKFYPILSFLSYW 496
           HNRISIHNVCEDSLLA+P+IIDLLVM+EFLSR+TYKK+  D     + K Y ILSFLSYW
Sbjct: 422 HNRISIHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLESDASAGSYEKLYSILSFLSYW 481

Query: 497 LKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           LKAPLTR GF+ IN LN+QR+ALENFLRLL+GLP  DELRFEERL
Sbjct: 482 LKAPLTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERL 526

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/536 (65%), Positives = 427/536 (79%), Gaps = 18/536 (3%)

Query: 24  FNPRLCTLSGDNNELISRYKYQNSIV-VKDIHTNE-LEITPFEQDYQFKINLNPNKVGIM 81
            N   C  S   N L++ Y Y  +IV ++  H N  + ++   +DY FK++L   K+G+M
Sbjct: 31  LNSDKCKYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIPKIGVM 90

Query: 82  LVGLGGNNGSTFLASLLANKNNISFNTREGTV----EPNYYGSMTQSSTLKLGIDSEGN- 136
           LVG+GGNNG+TFLASLLANKNN++FN ++G         + GSMTQSSTL LG + + N 
Sbjct: 91  LVGMGGNNGTTFLASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQSSTLYLGKNQQTNE 150

Query: 137 DVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKS 196
           DV+ PFNSILPM NPND ++SGWDI+ EN+F AMQRAKVLEYDLQ KLKP MESY PLKS
Sbjct: 151 DVYVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYTPLKS 210

Query: 197 IYYPDFIAMNQFERANNCINQNDDG----QFNTQDKWNDLLKIRQDIKDFKSHNNLENII 252
           IYYPDFIAMNQ +RA+NCIN    G     ++ ++KWNDLL IRQ+IKDFK+ N L+ +I
Sbjct: 211 IYYPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKLDKVI 270

Query: 253 VLWTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNT 312
           +LWTA TE+  E+IPG+NDT +NL+ SIK NH EI+PS IFATA+I+E  PYINGSPQNT
Sbjct: 271 ILWTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGSPQNT 330

Query: 313 FVPGLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNL 372
           FVPGLI+LAE  +VLIAGDDFKTGQTKLKSV+ QFL+DAGIKP+SIASYNHLGNNDGLNL
Sbjct: 331 FVPGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNNDGLNL 390

Query: 373 SSHAQFRSKEISKSSVIDDCINSNEILFNKKDSTDKTN----HCIVIKYMKAVGDSKVAM 428
           SS  QF+SKEI+KS+VIDD I SN+IL+ + D   K N    HCIVIKYM+++GDSKVAM
Sbjct: 391 SSSLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDSKVAM 450

Query: 429 DEYYSQLMLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQ---EFHK 485
           DEYY++LMLGGHNRISIHNVCEDSLLASPII+DL++M EF SRITY + G  Q    + +
Sbjct: 451 DEYYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIESGNQQGDGNYQQ 510

Query: 486 FYPILSFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           FYP+LS LSYWLKAPLTR G++PIN LN+QR+AL+NF+RLL+GLPP DELRFEERL
Sbjct: 511 FYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERL 566

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/508 (66%), Positives = 421/508 (82%), Gaps = 3/508 (0%)

Query: 37  ELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVGIMLVGLGGNNGSTFLAS 96
           +L ++Y+Y NS+V K      LE+ P  QDY+F+++L   K+G+MLVGLGGNNG+T +AS
Sbjct: 24  KLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIPKIGVMLVGLGGNNGTTLVAS 83

Query: 97  LLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDVFAPFNSILPMVNPNDFVV 156
           +LAN++ I F+T++G  E NYYGS+TQSST+KLGID +GNDV+ PFNS+LP V+PNDFVV
Sbjct: 84  VLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVPFNSVLPFVSPNDFVV 143

Query: 157 SGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYYPDFIAMNQFERANNCIN 216
            GWDIN  NL  AM R++VLEYDLQ +L+  M    PL SIYYPDFIA NQ ERA+NCIN
Sbjct: 144 GGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPDFIAANQDERADNCIN 203

Query: 217 QN-DDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTANTERCVEIIPGVNDTMDN 275
           ++   G  +T+ KW+ + +IR+DIK+FKS N+L+ +IVLWTANTER  +++  VND  DN
Sbjct: 204 RDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTERYADVLSNVNDNADN 263

Query: 276 LIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGLIELAEHNDVLIAGDDFKT 335
           L+A+IK++H EI+PS IFA A+I+E VPYINGSPQNTFVPG+I+LAE ++ LIAGDDFK+
Sbjct: 264 LLAAIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDLAEKHNALIAGDDFKS 323

Query: 336 GQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQFRSKEISKSSVIDDCINS 395
           GQTK+KSV+ QFLVDAGIKPVSIASYNHLGNNDG NL+S  QF+SKEISK SV+DD I S
Sbjct: 324 GQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKSKEISKRSVVDDVIAS 383

Query: 396 NEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLMLGGHNRISIHNVCEDSLLA 455
           N+IL+N+K + +K +HCIVIKYM AVGDSKVAMDEYYS+LMLGGHNRISIHNVCEDSLLA
Sbjct: 384 NKILYNEK-AGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLA 442

Query: 456 SPIIIDLLVMTEFLSRITYKKMGEDQE-FHKFYPILSFLSYWLKAPLTRSGFKPINSLNR 514
           +P+IIDL+VM EF SR++YKK+G DQ+ +  FY ILSFLSYWLKAPLTR GFK IN LN+
Sbjct: 443 TPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSFLSYWLKAPLTRKGFKTINGLNK 502

Query: 515 QRLALENFLRLLVGLPPNDELRFEERLR 542
           QR  +ENFLRLL+GLP  DELRFEE+L+
Sbjct: 503 QRQGIENFLRLLIGLPALDELRFEEKLK 530

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/514 (64%), Positives = 420/514 (81%), Gaps = 2/514 (0%)

Query: 29  CTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVGIMLVGLGGN 88
           C  S  +N L++ YKY+ S V  +     ++++  EQDY+FKI+L   KVG+MLVG GGN
Sbjct: 70  CQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVPKVGVMLVGFGGN 129

Query: 89  NGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSE-GNDVFAPFNSILP 147
           NGST LAS+LANK+NISF+ ++G ++PNY GSMTQS+T+ LG D E G D F PFN++LP
Sbjct: 130 NGSTLLASILANKHNISFHNKDGEIKPNYLGSMTQSATVHLGRDEETGRDFFQPFNAVLP 189

Query: 148 MVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYYPDFIAMNQ 207
           MVNPND +V+GWDI++ NL  +MQRA+VL+YDLQ +L P M+ Y P+KSIYYP+FIA NQ
Sbjct: 190 MVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIYYPEFIAANQ 249

Query: 208 FERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTANTERCVEIIP 267
           F+RANNCIN   D +F T+ KW+ ++++R DIK FK+ N L+ +IVLWTANTE+  +I+P
Sbjct: 250 FDRANNCINSKGD-EFTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTANTEKFAQIVP 308

Query: 268 GVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGLIELAEHNDVL 327
           GVNDT +NL+ +IK++H EI+PS +FA A+I+E VPYINGSPQNTFVPGLI+LAEH +VL
Sbjct: 309 GVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGLIKLAEHENVL 368

Query: 328 IAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQFRSKEISKSS 387
           IAGDDFKTGQTKLKSV+TQFLVDAGI+PVSIASYNHLGNNDG NLSS  QF+SKEISKS 
Sbjct: 369 IAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQFKSKEISKSG 428

Query: 388 VIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLMLGGHNRISIHN 447
           VI+D + SN I++       + +HCIVIKYM AVGDSKVAMDEYY++LMLGGHNRIS+HN
Sbjct: 429 VINDILESNSIMYGDDPEKARIDHCIVIKYMPAVGDSKVAMDEYYNELMLGGHNRISLHN 488

Query: 448 VCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQEFHKFYPILSFLSYWLKAPLTRSGFK 507
           VCEDSLLA+PII+DL++M EF SR+TYK+  ++ ++ KF+P+L+ LSYWLKAPL R  F 
Sbjct: 489 VCEDSLLAAPIILDLVIMCEFCSRVTYKEANDNGDYKKFHPVLTLLSYWLKAPLAREDFL 548

Query: 508 PINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           P+N L +QR ALENF+RLL+GLP NDELRFEERL
Sbjct: 549 PVNGLMKQRAALENFMRLLIGLPANDELRFEERL 582

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/525 (65%), Positives = 420/525 (80%), Gaps = 6/525 (1%)

Query: 19  RPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKV 78
           +P+VK    +   S    EL ++Y Y+N+IV K        + P  QDY+FK++L   KV
Sbjct: 8   KPTVKVATDVAEFS--ETELTTKYTYRNAIVEKSAD-GVFNVEPVTQDYEFKVDLKLPKV 64

Query: 79  GIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDV 138
           G+MLVGLGGNNG+TFLAS+LANK+ + F T+EG  E NYYGS+TQSSTLKLG+D+EGNDV
Sbjct: 65  GVMLVGLGGNNGTTFLASILANKHKVKFQTKEGLKEANYYGSVTQSSTLKLGVDAEGNDV 124

Query: 139 FAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIY 198
           +APFNS++PMV+PNDF VSGWDIN  +L  AM RA+VL  DLQ+KL+  M ++KPL SIY
Sbjct: 125 YAPFNSLVPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKPLPSIY 184

Query: 199 YPDFIAMNQFERANNCINQNDD-GQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTA 257
           YPDFIA NQ ERA+NC N++   G  + +DKW+ +  IR DI+ FK +N L+ ++VLWTA
Sbjct: 185 YPDFIAANQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVLVLWTA 244

Query: 258 NTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGL 317
           NTER  +I+ GVNDT +NLI +I+ +H+EI+PS +FA A+I+E VPYINGSPQNTFVPG+
Sbjct: 245 NTERYADIVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNTFVPGV 304

Query: 318 IELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQ 377
           I+LAE     IAGDDFK+GQTK+KSV+ QFLVDAGI+PVSIASYNHLGNNDG NLSS  Q
Sbjct: 305 IDLAEKEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQ 364

Query: 378 FRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLML 437
           F+SKEISK+SV+DD I SN+IL+N K   +K +HCIVIKYM AVGDSKVAMDEYYS+LML
Sbjct: 365 FKSKEISKASVVDDIIESNQILYNDK-LGNKIDHCIVIKYMPAVGDSKVAMDEYYSELML 423

Query: 438 GGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGE-DQEFHKFYPILSFLSYW 496
           GGHNRISIHNVCEDSLLA+P+IIDLLVM EF SRI YKK+ +    +H FYP+L+ LSYW
Sbjct: 424 GGHNRISIHNVCEDSLLATPLIIDLLVMAEFCSRIKYKKINDLSGGYHSFYPVLTMLSYW 483

Query: 497 LKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           LKAPLTR GFK IN LN+QR ALENFLRLL+GLP  DELRFEERL
Sbjct: 484 LKAPLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEERL 528

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/525 (64%), Positives = 417/525 (79%), Gaps = 5/525 (0%)

Query: 20  PSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVG 79
           PSVK        S    EL ++Y Y NSIV ++  TN +++ P +Q+Y FK++L   +VG
Sbjct: 9   PSVKVATDKVHYS--ETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLPRVG 66

Query: 80  IMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDVF 139
           +MLVG+GGNNG+TFLAS+LAN+  + F+ +EG  E NYYGS+TQ STLKLG+  +GND +
Sbjct: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFY 126

Query: 140 APFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYY 199
            PFNS+LP V+PNDF V+GWDI+  NL  AM+RA+VLEYDLQ +LKP M  YKPL SIYY
Sbjct: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186

Query: 200 PDFIAMNQFERANNCINQ-NDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTAN 258
           PDFIA NQ  RA+NCIN+ N+ G  +T++KW  L +IR DI++FK   +L+ +IVLWTAN
Sbjct: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246

Query: 259 TERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGLI 318
           TER  +IIPGVNDT DNL+ +IK +  EI+PS IFA A+I+E   YINGSPQNTFVPG+I
Sbjct: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306

Query: 319 ELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQF 378
           ELAE  D  IAGDDFK+GQTK+KSV+ QFLV+AGIKP SIASYNHLGNNDG NLSS  QF
Sbjct: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366

Query: 379 RSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLMLG 438
           +SKEISK SV+DD + SN +L+N K   +K +HCIVIKYM AVGDSKVAMDEYYS+LMLG
Sbjct: 367 KSKEISKKSVVDDVVASNPLLYNDKLG-NKIDHCIVIKYMNAVGDSKVAMDEYYSELMLG 425

Query: 439 GHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGE-DQEFHKFYPILSFLSYWL 497
           GHNRISIHNVCEDSLLA+P+IIDLLVM EF +R++YK++G+   E+ KFY ILSFLSYWL
Sbjct: 426 GHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSFLSYWL 485

Query: 498 KAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR 542
           KAPLTR G++ IN LN+QR  LENF+RLL+GLP  DELRFEERL+
Sbjct: 486 KAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/537 (64%), Positives = 423/537 (78%), Gaps = 18/537 (3%)

Query: 19  RPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKV 78
            P +  N   CT+ G  N L S+Y Y +++V K+  TN   +   ++DY+F ++LN  K+
Sbjct: 7   EPKIIVNNDKCTIEG--NTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLPKL 64

Query: 79  GIMLVGLGGNNGSTFLASLLANKNNISFNTR--EGTVEPNYYGSMTQSSTLKLGIDSEGN 136
           GIMLVGLGGNNG+T LAS+LANKNN+ F ++  +G  + NYYGS+TQSST+KLGID + N
Sbjct: 65  GIMLVGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTN 124

Query: 137 D-VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLK 195
           D ++ PF  ILP+ NPNDFV++GWDI+D N F AMQRA VLE+DLQ +LK  ME  KPLK
Sbjct: 125 DEIYVPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLK 184

Query: 196 SIYYPDFIAMNQFERANNCINQNDDGQFN---------TQDKWNDLLKIRQDIKDFKSHN 246
           SIYYPDFIA+NQ ERAN+C N+  + + N         T++KW+ + +IR DI++FK  N
Sbjct: 185 SIYYPDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKEN 244

Query: 247 NLENIIVLWTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYIN 306
           NL+ +IVLWTANTER   I  GVND  DNL+ +IK++HSE+SPS IFA A+I+E VPYIN
Sbjct: 245 NLDKVIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYIN 304

Query: 307 GSPQNTFVPGLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGN 366
           GSPQNTFVPG+I+LAE     IAGDDFK+GQTK+KSV+ QFLVDAGIKP+SIASYNHLGN
Sbjct: 305 GSPQNTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGN 364

Query: 367 NDGLNLSSHAQFRSKEISKSSVIDDCINSNEILFNKKDSTDKT-NHCIVIKYMKAVGDSK 425
           NDG NLSS  QF+SKEISK  V DD I SN+ILFN  D   KT +HCIVIKY+ AVGDSK
Sbjct: 365 NDGFNLSSPMQFKSKEISKRGVCDDMIESNQILFN--DKVGKTIDHCIVIKYLNAVGDSK 422

Query: 426 VAMDEYYSQLMLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQ-EFH 484
           VAMDEYYS+LMLGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF +R+TYKK+GE   ++ 
Sbjct: 423 VAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLGEGATDYE 482

Query: 485 KFYPILSFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           +FYP+L+ LSYWLKAPLTR GFKPIN L +QR ALENFLRLL+GLPP D+LRFEERL
Sbjct: 483 QFYPVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRFEERL 539

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/531 (63%), Positives = 419/531 (78%), Gaps = 12/531 (2%)

Query: 20  PSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVG 79
           P+VK     C  + D  ELI++Y Y+N +V  +      ++    +DY+FK +L   KVG
Sbjct: 8   PAVKVQTDKCRYTED--ELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTDLKIPKVG 65

Query: 80  IMLVGLGGNNGSTFLASLLANKNNISFNTR--EGTVEPNYYGSMTQSSTLKLGIDSEG-N 136
           +MLVG+GGNNG+TF+AS+LANK  + F T+  +G  + NYYGS+TQ+ST+KLG+DSE  N
Sbjct: 66  VMLVGMGGNNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKLGVDSETLN 125

Query: 137 DVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKS 196
           DV+ PFNS+LPMVNPNDFVVSGWDI D N + AM  ++VLEYDL  +LKP M   KPLKS
Sbjct: 126 DVYIPFNSLLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEMSQIKPLKS 185

Query: 197 IYYPDFIAMNQFERANNCINQNDDGQ--FNTQDKWNDLLKIRQDIKDFKSHNNLENIIVL 254
           IYYPDF+AMNQ ERANNCIN+ D+     + ++K +DL  IR DIK FK  N+L+ +IVL
Sbjct: 186 IYYPDFLAMNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQENHLDKVIVL 245

Query: 255 WTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFV 314
           WTA+TER  +II GVNDT DNL+ SIK +H EI+PS IFA A+I+E   YINGSPQNT V
Sbjct: 246 WTASTERYADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYINGSPQNTLV 305

Query: 315 PGLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSS 374
           PG+++L++  + +IAGDDFKTGQTKLKSV+ QFL+DAGIKP+S+ASYNHLGNNDG NLS+
Sbjct: 306 PGVVDLSKRENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGNNDGYNLSA 365

Query: 375 HAQFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQ 434
             QFRSKEISKSSVIDD I SNEIL+N K   +  +HCIVIKYM AVGD+KVAMDEYYS+
Sbjct: 366 PKQFRSKEISKSSVIDDMIESNEILYNAKTGAE-VDHCIVIKYMPAVGDNKVAMDEYYSE 424

Query: 435 LMLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMG----EDQEFHKFYPIL 490
           LMLGGHNRIS+HNVCEDSLLA+PI+IDL+VM EF+SRI+YK++     E+ E+  F   L
Sbjct: 425 LMLGGHNRISVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRDDEELEYSTFNSTL 484

Query: 491 SFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           SFLSYWLKAP+ + GF+PIN LN+QRLALENFLRLL+GLPPNDELRFEERL
Sbjct: 485 SFLSYWLKAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPNDELRFEERL 535

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/472 (71%), Positives = 388/472 (82%), Gaps = 13/472 (2%)

Query: 81  MLVGLGGNNGSTFLASLLANKNNISFNTR--EGTVEPNYYGSMTQSSTLKLGIDSEGN-D 137
           MLVGLGGNNG+TFLAS+LANKNN+ F ++  +G  + NYYGS+TQSST+KLGI+ E N D
Sbjct: 1   MLVGLGGNNGTTFLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNED 60

Query: 138 VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSI 197
           V+ PFN ILP VNPNDFVVSGWDIN+ N   AMQRA VLEYDLQSKLK YM+   PLKSI
Sbjct: 61  VYIPFNEILPFVNPNDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSI 120

Query: 198 YYPDFIAMNQFERANNCINQ--NDDGQFN-TQDKWNDLLKIRQDIKDFKSHNNLENIIVL 254
           YYPDFIA+NQ ERANN IN+  ND    N ++ KW+ +  IR DI++FK+ NNL+ +IVL
Sbjct: 121 YYPDFIAINQNERANNVINRGTNDLSLENLSKGKWSHVEHIRNDIRNFKNENNLDKVIVL 180

Query: 255 WTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFV 314
           WTANTER   I  G+NDT DNLI SIK++H+E+SPS IFA A+I+E VPYINGSPQNTFV
Sbjct: 181 WTANTERYSVIENGINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFV 240

Query: 315 PGLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSS 374
           PG+IELAE     IAGDDFK+GQTK+KSV+ QFLVDAGIKP+SIASYNHLGNNDG NLSS
Sbjct: 241 PGVIELAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSS 300

Query: 375 HAQFRSKEISKSSVIDDCINSNEILFNKKDSTDKT-NHCIVIKYMKAVGDSKVAMDEYYS 433
             QF+SKEISK  V DD I SN+ILFN  D   KT +HCIVIKYM AVGDSKVAMDEYYS
Sbjct: 301 PMQFKSKEISKRGVCDDMIESNQILFN--DKVGKTIDHCIVIKYMNAVGDSKVAMDEYYS 358

Query: 434 QLMLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKM-GED---QEFHKFYPI 489
           +LMLGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF +R+TYKK+ G D   +EF  FYP+
Sbjct: 359 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLDGADATKKEFEPFYPV 418

Query: 490 LSFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541
           L+ LSYWLKAPLTR GFK IN L +QR ALENF+RLL+GLPP DELRFEERL
Sbjct: 419 LTLLSYWLKAPLTRPGFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERL 470

>KLLA0D14707g Chr4 (1242483..1245125) [2643 bp, 880 aa] {ON} similar
           to uniprot|P53253 Saccharomyces cerevisiae YGR089W NNF2
           Protein that exhibits physical and genetic interactions
           with Rpb8p which is a subunit of RNA polymerases I II
           and III computational analysis of large- scale
           protein-protein interaction data suggests a role in
           chromosome segregation
          Length = 880

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 164 ENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYYPDFIAMNQFERANNCINQNDDGQF 223
           ENL MA+++ +     L+ KLK   +    L+ +Y  +    N F+R   C    D  + 
Sbjct: 719 ENLKMALKQGEFQTTQLEEKLKELTQKETELEEVYLVE--KDNHFQRTLECSKTEDQWKL 776

Query: 224 NTQDKWNDLLKIRQDIKDFK 243
             ++  + L K++Q+++  +
Sbjct: 777 KLKEAESQLSKLKQELQQLQ 796

>KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} similar
            to uniprot|P35187 Saccharomyces cerevisiae YMR190C SGS1
            Nucleolar DNA helicase of the RecQ family, involved in
            maintenance of genome integrity
          Length = 1367

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 12/83 (14%)

Query: 377  QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAM----DEY- 431
            QF  K+  K+   D+C NS+ I++  KD T+++    +   +K++ DSKV +    D Y 
Sbjct: 976  QFDPKDCGKN--CDNCKNSSNIVYQTKDVTEESKD--IANLIKSIQDSKVTLIHCQDVYK 1031

Query: 432  ---YSQLMLGGHNRISIHNVCED 451
               Y +++  GH++   H + +D
Sbjct: 1032 GSKYQKIVQLGHHQSPYHGMGKD 1054

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 8/138 (5%)

Query: 187 YMESYKPLKSIYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHN 246
           Y   Y  ++ I+Y +   +NQ  +  +  ++N   Q+      N  LKI Q +   ++ N
Sbjct: 515 YSHFYSKIQQIHYTNLELINQVTQQRDSSHENCQKQYTAN--QNMQLKISQQV--LQTLN 570

Query: 247 NLENIIVLWTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATA-AIMEKVPYI 305
           +L+N +  + +   +  ++I GV + + N + S K NH     S +  TA  +M K+  +
Sbjct: 571 SLQNSLRNYNS---KFSQVINGVTEELTNSVNSHKVNHDSTFKSLMNTTANLLMIKMNEL 627

Query: 306 NGSPQNTFVPGLIELAEH 323
             S  N+F     + A H
Sbjct: 628 VLSISNSFKDFQSDFASH 645

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,732,708
Number of extensions: 3041504
Number of successful extensions: 10174
Number of sequences better than 10.0: 55
Number of HSP's gapped: 10467
Number of HSP's successfully gapped: 55
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)