Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0F007302.153ON1081085661e-76
SAKL0E10934g2.153ON1131003413e-42
Ecym_82052.153ON1141073381e-41
KLLA0F24024g2.153ON1221003311e-40
KLTH0B05148g2.153ON1111003283e-40
CAGL0I02728g2.153ON1111043205e-39
Kwal_33.147762.153ON1111003162e-38
ZYRO0G06534g2.153ON1121053065e-37
Kpol_505.202.153ON1121003066e-37
TDEL0B051502.153ON1191113076e-37
ABR130W2.153ON111993032e-36
Smik_8.1942.153ON129983009e-36
TPHA0F018702.153ON180953049e-36
Skud_8.1772.153ON130962982e-35
Suva_15.3132.153ON132962973e-35
YHR116W (COX23)2.153ON151982984e-35
NDAI0B043302.153ON127952921e-34
KNAG0H035202.153ON109962892e-34
NCAS0B070002.153ON1081082362e-26
TBLA0B012402.153ON119992242e-24
KLTH0H02552g6.284ON7745650.48
Suva_10.665.205ON7226602.1
Ecym_3560na 1ON50433605.8
Kpol_2002.1035.205ON6326566.6
Smik_12.545.205ON6926567.1
Ecym_82875.205ON5826568.0
YLL009C (COX17)5.205ON6926568.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0F00730
         (108 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   222   1e-76
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   135   3e-42
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   134   1e-41
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   132   1e-40
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   130   3e-40
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   127   5e-39
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   126   2e-38
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   122   5e-37
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   122   6e-37
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   122   6e-37
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   121   2e-36
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   120   9e-36
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   121   9e-36
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   119   2e-35
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   119   3e-35
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   119   4e-35
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   117   1e-34
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   115   2e-34
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....    96   2e-26
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    91   2e-24
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    30   0.48 
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    28   2.1  
Ecym_3560 Chr3 (1064334..1065848) [1515 bp, 504 aa] {ON} similar...    28   5.8  
Kpol_2002.103 s2002 complement(245135..245326) [192 bp, 63 aa] {...    26   6.6  
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    26   7.1  
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    26   8.0  
YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}  C...    26   8.8  

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  222 bits (566), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MSKKEPEQDPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDP 60
           MSKKEPEQDPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDP
Sbjct: 1   MSKKEPEQDPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDP 60

Query: 61  CQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           CQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE
Sbjct: 61  CQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  135 bits (341), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 82/100 (82%), Gaps = 2/100 (2%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           DP+L TDK KVNF  +    +T+ FK+YPD+PES  ++ +F  K P++Y+DPCQES+++S
Sbjct: 16  DPQLETDKEKVNFTPQ--ANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMS 73

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           FKCLE+NNYDR +CK+YFDAYRECKKQWL +R+ +RS+WE
Sbjct: 74  FKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/107 (62%), Positives = 83/107 (77%), Gaps = 7/107 (6%)

Query: 6   PEQDP---KLVTDKTKVNFVQEDPGTN-TTKFKYYPDDPESAYHRDQFRTKQPTKYYDPC 61
           P Q P    +VTDKTKVNF    P +N T+ F++YPDDPE+  +R +F +K  + YYDPC
Sbjct: 11  PSQSPPKGNVVTDKTKVNFT---PTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPC 67

Query: 62  QESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           +ES+++SFKCLELNNYDRSLC DYFDAYRECKKQWL AR+ D SKW+
Sbjct: 68  EESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  132 bits (331), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 2/100 (2%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           DP L  +KTKVNF  E    NT  +K+YPDDPES  +R +F  K  ++YYDPCQES+++S
Sbjct: 25  DPSLELNKTKVNFTPEKTDVNT--YKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMS 82

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           FKCLELNNYDR LC DYFDAYRECKKQWL AR+  R  WE
Sbjct: 83  FKCLELNNYDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  130 bits (328), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 83/100 (83%), Gaps = 2/100 (2%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           DP+L  DKTKV++  ++  T +  FK+YPD+PES++++ +F  K  +++YDPCQES+++S
Sbjct: 14  DPQLQVDKTKVDYAPKN--TESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMS 71

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
            KCLELNNYDRS+C++YFDAYRECKKQWL AR+ +RS+WE
Sbjct: 72  MKCLELNNYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  127 bits (320), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 4   KEPEQDPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQE 63
           K+   DP + TDK KV++  +  G +TT+++YYPD+PES  ++ +F  K  ++YYDPCQE
Sbjct: 9   KDGNYDPHVQTDKDKVDYAPK--GVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQE 66

Query: 64  SAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKW 107
           SA++SFKCLELN+YDR  CK+YFDAYRECKKQWL AR+ DR+ W
Sbjct: 67  SAKMSFKCLELNDYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  126 bits (316), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 82/100 (82%), Gaps = 2/100 (2%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           DP+L  DK+K+++  +D    +  +K+YPD+PES++++ +F  K  +++YDPCQES+++S
Sbjct: 14  DPQLQVDKSKIDYAPQDAKAGS--YKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMS 71

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
            KCLELN+YDRS+C++YFDAYRECKKQWL AR+ +RS+WE
Sbjct: 72  MKCLELNDYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  122 bits (306), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 78/105 (74%), Gaps = 2/105 (1%)

Query: 4   KEPEQDPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQE 63
           +E   DP+LV +  KV++  +  G +  KF+YYPD PES+  R +F  K  ++Y+DPCQE
Sbjct: 10  REGNLDPQLVVEPKKVDYAPQ--GDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQE 67

Query: 64  SAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           S+++SF CL+ NNYDR +CK+YFDAYRECKKQWL AR+ +RS WE
Sbjct: 68  SSRMSFNCLDRNNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  122 bits (306), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%), Gaps = 3/100 (3%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           D  L TDK+KV+F  +D   +    K+YPD+PES   + +F TK+ ++YYDPCQESAQ+S
Sbjct: 16  DSTLETDKSKVDFANKDDKKD---LKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMS 72

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           F CL+ NNYD+S C+ YFDAYRECKKQWL AR+ DRS+WE
Sbjct: 73  FNCLDRNNYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  122 bits (307), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%), Gaps = 8/111 (7%)

Query: 6   PEQDPKLVTDKTKVNFVQEDP--------GTNTTKFKYYPDDPESAYHRDQFRTKQPTKY 57
           P +D K+++ +  VN   +D         G + +KF+YYP++PES  +R  F  K P++Y
Sbjct: 9   PSEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQY 68

Query: 58  YDPCQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           YDPCQESAQ+S  CL+ N+Y++ LCK+YFDAYRECKKQWL +R+ DRS+WE
Sbjct: 69  YDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  121 bits (303), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%), Gaps = 3/99 (3%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           DP + TD+  VNF    P T+ + F++YPD+ ES   R +   K P++Y DPCQESA +S
Sbjct: 15  DPSVQTDRAAVNFT---PSTDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMS 71

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKW 107
            KCLE NNYDR LC++YFDAYRECKKQWL+AR+ D S+W
Sbjct: 72  MKCLERNNYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  120 bits (300), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (79%), Gaps = 6/98 (6%)

Query: 13  VTDKTKVNFV--QEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFK 70
           VTD+TKVN+V   +DP +    F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+
Sbjct: 36  VTDRTKVNYVPKSDDPSS----FQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQ 91

Query: 71  CLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           CLE N+YDRS C++YFDAYRECKKQWL AR+ +R +WE
Sbjct: 92  CLERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  121 bits (304), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 74/95 (77%)

Query: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68
           DP LVT+K  V+F + D   N  +FK+YPD+PES++ + +F +K  ++YYDPC ESA++S
Sbjct: 79  DPSLVTNKESVDFTKPDITLNENRFKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMS 138

Query: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTD 103
           FKCL++N+YDR  C+ YFDAYRECKKQWL AR+ +
Sbjct: 139 FKCLDMNDYDRDKCRAYFDAYRECKKQWLRARRNN 173

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  119 bits (298), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 78/96 (81%), Gaps = 2/96 (2%)

Query: 13  VTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCL 72
           +TD+TKVN+V ++   + + F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+CL
Sbjct: 37  ITDRTKVNYVPKN--NDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCL 94

Query: 73  ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           E N+YDRS C++YFDAYRECKKQWL AR+ +R +WE
Sbjct: 95  ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  119 bits (297), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 77/96 (80%), Gaps = 2/96 (2%)

Query: 13  VTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCL 72
           VTD++KVN+V +    + + F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+CL
Sbjct: 39  VTDRSKVNYVPQ--SNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCL 96

Query: 73  ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           E N+YDR+ C+DYFDAYRECKKQWL AR+ +R +WE
Sbjct: 97  ERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  119 bits (298), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (79%), Gaps = 6/98 (6%)

Query: 13  VTDKTKVNFV--QEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFK 70
           VTD+TKVN+V   +DP +    F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+
Sbjct: 58  VTDRTKVNYVPKSDDPSS----FQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQ 113

Query: 71  CLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           CLE N+YDRS C++YFDAYRECKKQWL AR+ +R +WE
Sbjct: 114 CLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  117 bits (292), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 55/95 (57%), Positives = 72/95 (75%), Gaps = 2/95 (2%)

Query: 14  TDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCLE 73
           T K  VNF  ++  T+T  FKYYPDDPE   ++ +F  K  ++YYDPCQES+Q+SFKCL+
Sbjct: 34  TTKDTVNFTPDEKDTST--FKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLD 91

Query: 74  LNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
            NN+DR  C +YFDAYRECKKQWL AR+ +RS+W+
Sbjct: 92  RNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  115 bits (289), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 2/96 (2%)

Query: 13  VTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCL 72
           V+ K  V+F     G N  +F+Y+PD P+S  H+ +F+TK  +K+YDPCQES+++SF CL
Sbjct: 16  VSGKETVDFAPL--GGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCL 73

Query: 73  ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           E N+YDRS CK YFDAYRECKKQWL AR+ ++S+WE
Sbjct: 74  EQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 73/108 (67%), Gaps = 6/108 (5%)

Query: 3   KKEPEQDPKLVTDKTKVNFV--QEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDP 60
           +++PE+       K  VNF   +++PG+    +KY+PDDP    ++ +F  K  ++YYDP
Sbjct: 4   QEQPEEKGNNSNRKQDVNFTPDEKNPGS----YKYFPDDPVQGLNKYKFIMKGDSEYYDP 59

Query: 61  CQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108
           CQE +++S KCLE N +D+S C++YFDAYR+CKK W+  R+ +R +WE
Sbjct: 60  CQECSEMSRKCLERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 90.9 bits (224), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 4   KEPEQDPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQE 63
           K+ E    +  D T V+FV  DP  + T F+Y+PD P S   R  F  K+ +K+YDPC E
Sbjct: 17  KQLENGSVVQNDPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHE 76

Query: 64  SAQLSFKCLELNNYD-RSLCKDYFDAYRECKKQWLNARK 101
           SAQ+S +C+  +  D +++C ++F AYR+CKK W++A+K
Sbjct: 77  SAQMSVRCMTDHPDDHKTVCAEFFAAYRDCKKAWIDAKK 115

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 29.6 bits (65), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 20/45 (44%)

Query: 59  DPCQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTD 103
           DPC+  A     CL    +D S C    D+  EC  ++ N R  D
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKFYNERGAD 47

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
          YLL009C (REAL)
          Length = 72

 Score = 27.7 bits (60), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 71 CLELNNYDRSLCKDYFDAYRECKKQW 96
          C+  N  D   CK++ D Y+EC K +
Sbjct: 39 CILFNGQDSDKCKEFIDKYKECMKGY 64

>Ecym_3560 Chr3 (1064334..1065848) [1515 bp, 504 aa] {ON} similar to
           Ashbya gossypii AFR386C
          Length = 504

 Score = 27.7 bits (60), Expect = 5.8,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 3/33 (9%)

Query: 74  LNNYDRSLCKDYFDAYRE---CKKQWLNARKTD 103
           +NNY   L  DYFDA  E   C    LN   +D
Sbjct: 323 VNNYSHQLVNDYFDADHEITGCSTSQLNEADSD 355

>Kpol_2002.103 s2002 complement(245135..245326) [192 bp, 63 aa]
          {ON} complement(245135..245326) [192 nt, 64 aa]
          Length = 63

 Score = 26.2 bits (56), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 71 CLELNNYDRSLCKDYFDAYRECKKQW 96
          CL  N  + + CK++ D Y+ C K +
Sbjct: 33 CLLFNGQESTSCKEFIDKYKSCMKGF 58

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
          YLL009C (REAL)
          Length = 69

 Score = 26.2 bits (56), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 71 CLELNNYDRSLCKDYFDAYRECKKQW 96
          C+  N  D   CK++ + Y+EC K +
Sbjct: 36 CILFNGQDSEKCKEFIEKYKECMKGY 61

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
          Ashbya gossypii AAL161W
          Length = 58

 Score = 26.2 bits (56), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 71 CLELNNYDRSLCKDYFDAYRECKKQW 96
          CL  N  + + CK+  D YR C K +
Sbjct: 29 CLLFNGLESTKCKELVDKYRSCMKGY 54

>YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}
          COX17Copper metallochaperone that transfers copper to
          Sco1p and Cox11p for eventual delivery to cytochrome c
          oxidase; contains twin cysteine-x9-cysteine motifs
          Length = 69

 Score = 26.2 bits (56), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 71 CLELNNYDRSLCKDYFDAYRECKKQW 96
          C+  N  D   CK++ + Y+EC K +
Sbjct: 36 CILFNGQDSEKCKEFIEKYKECMKGY 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,071,776
Number of extensions: 599952
Number of successful extensions: 1213
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1198
Number of HSP's successfully gapped: 44
Length of query: 108
Length of database: 53,481,399
Length adjustment: 78
Effective length of query: 30
Effective length of database: 44,537,451
Effective search space: 1336123530
Effective search space used: 1336123530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)