Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0F007202.152ON60860829780.0
SAKL0E10956g2.152ON60052617210.0
ZYRO0G06512g2.152ON60452616930.0
KNAG0H035302.152ON61453416900.0
TDEL0B051402.152ON59952616810.0
NCAS0B070102.152ON62552916780.0
Kpol_1048.212.152ON59752616580.0
Kwal_33.147672.152ON59452616580.0
Skud_14.2112.152ON61758216470.0
YNL121C (TOM70)2.152ON61754416410.0
Suva_14.2192.152ON61754416360.0
Ecym_82042.152ON59752616340.0
KLLA0F24046g2.152ON60452516330.0
Smik_14.2072.152ON61758016340.0
TBLA0C055302.152ON61052516300.0
KLTH0B05170g2.152ON59352616170.0
ABR131W2.152ON59452616140.0
CAGL0L12936g2.152ON60052715890.0
TPHA0I015102.152ON60360415770.0
NCAS0G024802.152ON59652515460.0
NDAI0F028102.152ON60952214830.0
Skud_8.1782.152ON63854014730.0
Suva_15.3142.152ON64454014570.0
YHR117W (TOM71)2.152ON63953814520.0
Smik_8.1952.152ON63553314240.0
NDAI0B043402.152ON66453513840.0
CAGL0L04048g2.152ON58752313481e-180
NCAS0G008105.617ON584891422e-08
ACR005W6.21ON3271081364e-08
NDAI0B057903.481ON523951313e-07
AEL224W5.617ON580891305e-07
SAKL0G07084g5.617ON585801296e-07
CAGL0H08195g5.617ON583891288e-07
Kwal_55.199355.617ON593891288e-07
TDEL0A048405.617ON576891288e-07
Suva_8.805.617ON586991289e-07
TPHA0J003406.21ON338821241e-06
Smik_15.2055.617ON589801262e-06
AAR083C3.481ON5381711252e-06
Ecym_44133.481ON510951233e-06
YOR027W (STI1)5.617ON589901233e-06
Ecym_55825.617ON5841291224e-06
Ecym_30256.21ON318861187e-06
KLTH0F14542g3.481ON5131051207e-06
KAFR0B066103.481ON5111551198e-06
TBLA0A072706.21ON373961181e-05
TBLA0E033005.617ON582801181e-05
KAFR0C058905.617ON575911181e-05
CAGL0D05060g3.481ON5101041181e-05
Kpol_1018.695.617ON590801181e-05
Kpol_1037.266.21ON342861171e-05
SAKL0E01210g6.21ON323741162e-05
TPHA0D028805.617ON585891172e-05
KNAG0A079003.481ON512951172e-05
Skud_15.1925.617ON5891021162e-05
TPHA0D032203.481ON513951162e-05
NCAS0H008306.21ON3381601143e-05
TPHA0E011105.352ON6931251153e-05
NDAI0I022406.21ON350911134e-05
KLTH0E02178g5.617ON593791144e-05
KNAG0C055005.352ON5851501144e-05
Kpol_505.413.481ON513971135e-05
NDAI0F009105.617ON5831151135e-05
TDEL0E027505.352ON5641601126e-05
CAGL0E02739g6.21ON343931108e-05
KLLA0A07062g5.617ON581891119e-05
ZYRO0A05676g5.617ON572791119e-05
Suva_15.1826.21ON346741091e-04
TBLA0C039503.481ON512951101e-04
KNAG0M011706.21ON339861091e-04
Kwal_55.211753.481ON511951091e-04
Ecym_20906.328ON172621032e-04
NCAS0F034903.481ON5121041082e-04
NCAS0A112003.367ON907971082e-04
YOR007C (SGT2)6.21ON346741062e-04
NCAS0A00490singletonON620771072e-04
Kpol_1032.86.21ON3431081054e-04
NDAI0D008106.21ON3491411044e-04
KNAG0B032005.617ON579991054e-04
KLLA0B09262g3.367ON9411401065e-04
Skud_15.1686.21ON348741036e-04
ZYRO0C07788g6.21ON334711027e-04
Smik_15.1766.21ON345741027e-04
KAFR0L004106.21ON331861028e-04
KNAG0H006103.367ON973971039e-04
SAKL0F03102g3.481ON5131031029e-04
Kwal_56.224336.21ON322711010.001
TBLA0G010506.21ON350931010.001
KLLA0B10912g3.481ON512971010.001
NCAS0E024907.412ON8091201010.002
KLLA0D01155g6.21ON33568990.002
NDAI0C043205.352ON7061151000.002
KAFR0H008703.367ON887971000.002
Smik_4.5795.352ON667112990.002
ZYRO0C16522g3.367ON97497990.002
Kpol_339.135.352ON686112980.003
TDEL0G044806.21ON34386970.003
Suva_7.4083.481ON51395980.003
YBR112C (CYC8)3.367ON96697980.004
Suva_4.3613.367ON96397970.005
ZYRO0F08624g8.506ON379135960.005
Smik_2.2543.367ON102097970.005
TPHA0M016303.367ON104393970.005
CAGL0D01364g3.367ON114897960.006
KAFR0C018505.352ON646124960.006
Skud_2.2403.367ON98497950.007
TPHA0D038606.328ON12071880.008
YGR123C (PPT1)3.481ON51395940.010
SAKL0A01672g6.328ON12861870.011
Skud_2.247.412ON769127930.014
Smik_6.2153.481ON51395920.015
Smik_2.367.412ON751127920.016
KLTH0C11220g6.21ON32771910.016
ZYRO0B04224g3.481ON513102910.018
NCAS0F028705.352ON700112920.019
YDR320C (SWA2)5.352ON668112920.019
Suva_3.956.328ON11170850.019
Kwal_27.118908.506ON334118900.020
Ecym_34593.367ON1115140920.020
TDEL0C050903.367ON75997910.021
TBLA0H019705.352ON840125910.023
Kpol_172.23.367ON41884900.025
Suva_2.4895.352ON659112910.025
YBR155W (CNS1)8.506ON38589900.027
Kpol_513.28.506ON37489900.027
YBL084C (CDC27)7.412ON758155900.030
SAKL0B07986g3.367ON880140890.036
TBLA0I023106.328ON11662830.037
Skud_2.2828.506ON38589880.037
Suva_2.347.412ON763221890.039
TBLA0F012303.367ON118991890.041
NDAI0A051003.367ON100797890.047
TDEL0A074306.328ON12446820.049
KLTH0F10428g3.367ON795140880.052
Kwal_23.36703.367ON802140880.052
KLLA0B09966g8.506ON370108870.057
CAGL0C01903g7.412ON769192880.058
NCAS0D045006.328ON12173810.062
KAFR0L018707.412ON712185870.062
AAR054C6.328ON13362820.065
ADL344W3.367ON910140870.072
TBLA0H033808.506ON37579860.080
YCR060W (TAH1)6.328ON11158800.081
Skud_7.4323.481ON51395850.11
TBLA0H015203.367ON689237850.11
Skud_3.1356.328ON11873790.11
KAFR0J025706.328ON12159790.12
TPHA0M002706.21ON37797840.12
KLLA0B10197g5.352ON621111840.14
TPHA0L014208.506ON374132840.14
ZYRO0B03828g7.412ON727192840.15
KLLA0C08910g6.328ON11560780.17
Kwal_27.107407.412ON628120830.18
CAGL0H07095g5.352ON661163830.18
KNAG0H001602.665ON780157820.25
Kpol_1006.43.367ON73297820.27
AGL268C8.506ON37989810.27
KLTH0H14872g5.352ON623110800.43
Skud_4.5865.352ON642112800.44
NCAS0D026706.21ON35197790.45
CAGL0H07425g8.506ON38090790.48
Kpol_1018.1067.412ON753187800.54
Smik_2.2958.506ON385139790.55
KNAG0I025206.328ON11789740.59
ZYRO0A03036g3.265ON867311790.61
NDAI0I004406.328ON12875740.65
NDAI0G037103.5ON112197790.74
Suva_8.1295.689ON74149780.82
Smik_3.1596.328ON11567720.91
Kwal_27.117378.470ON57589770.92
CAGL0K05599g5.689ON71049770.95
TDEL0B013108.506ON380121761.0
Ecym_25598.506ON370107761.0
KLLA0C02453g1.88ON1028161771.0
Kpol_1028.516.328ON11790721.1
TDEL0C027207.412ON700239771.2
TBLA0D004607.412ON835184761.6
ZYRO0D10186g5.352ON635111751.7
Kwal_34.159775.352ON597116751.8
KLTH0E10934g8.470ON56889751.8
Suva_4.4058.506ON38589741.8
TDEL0G026402.333ON37740742.1
KAFR0C038202.665ON70464742.2
KLTH0F02508g1.88ON1055160742.3
Skud_15.2455.689ON75049742.3
SAKL0F16236g7.546ON1408201742.7
KAFR0A053703.455ON120183742.7
Ecym_50617.62ON42883733.2
KAFR0D023405.689ON69743733.5
YOR080W (DIA2)5.689ON73249723.7
KAFR0E029808.506ON38089723.7
KNAG0F040107.546ON141886724.2
NDAI0E040407.412ON78392724.5
KNAG0B022407.412ON739185715.2
Kpol_1067.251.456ON39197705.5
NCAS0A105403.265ON877199715.9
Smik_18.9singletonON28297706.1
SAKL0F12936g7.412ON632120716.1
KLTH0E11748g8.506ON37889706.2
KLTH0C06204g7.412ON627120706.2
CAGL0K09240g6.328ON14268676.9
TDEL0D055003.481ON512104706.9
Kpol_1043.605.689ON70640708.2
NDAI0J001307.546ON140390708.6
KLLA0E20857g7.412ON710118699.1
NDAI0C051308.470ON59088699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0F00720
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...  1151   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   667   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   656   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   655   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   652   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   650   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   643   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   643   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   639   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   636   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   634   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   634   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   633   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   634   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   632   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   627   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   626   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   616   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   612   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   600   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   575   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   572   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   565   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   563   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   553   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   537   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   523   e-180
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    59   2e-08
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    57   4e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    55   3e-07
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    55   5e-07
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    54   6e-07
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    54   8e-07
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    54   8e-07
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    54   8e-07
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    54   9e-07
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    52   1e-06
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    53   2e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    53   2e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    52   3e-06
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    52   3e-06
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    52   4e-06
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    50   7e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    51   7e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    50   8e-06
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    50   1e-05
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    50   1e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    50   1e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    50   1e-05
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    50   1e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    50   1e-05
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    49   2e-05
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    50   2e-05
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    50   2e-05
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    49   2e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    49   2e-05
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    49   3e-05
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    49   3e-05
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    48   4e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    49   4e-05
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    49   4e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    48   5e-05
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     48   5e-05
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    48   6e-05
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    47   8e-05
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    47   9e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    47   9e-05
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    47   1e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    47   1e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    47   1e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    47   1e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    44   2e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    46   2e-04
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    46   2e-04
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    45   2e-04
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       46   2e-04
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    45   4e-04
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    45   4e-04
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    45   4e-04
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    45   5e-04
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    44   6e-04
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    44   7e-04
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    44   7e-04
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    44   8e-04
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    44   9e-04
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    44   9e-04
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    44   0.001
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    44   0.001
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    44   0.001
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    44   0.002
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    43   0.002
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    43   0.002
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    43   0.002
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    43   0.002
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    43   0.002
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    42   0.003
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    42   0.003
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    42   0.003
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    42   0.004
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    42   0.005
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    42   0.005
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    42   0.005
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    42   0.005
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    42   0.006
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    42   0.006
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    41   0.007
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    39   0.008
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    41   0.010
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    38   0.011
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    40   0.014
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.015
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    40   0.016
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    40   0.016
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    40   0.018
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    40   0.019
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    40   0.019
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    37   0.019
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    39   0.020
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    40   0.020
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    40   0.021
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    40   0.023
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    39   0.025
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    40   0.025
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    39   0.027
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    39   0.027
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    39   0.030
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    39   0.036
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.037
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.037
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    39   0.039
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    39   0.041
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    39   0.047
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    36   0.049
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    39   0.052
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    39   0.052
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    38   0.057
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    39   0.058
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    36   0.062
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    38   0.062
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    36   0.065
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    38   0.072
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    38   0.080
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.081
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    37   0.11 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    37   0.11 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    35   0.11 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    35   0.12 
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    37   0.12 
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...    37   0.14 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    37   0.14 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    37   0.15 
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.17 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.18 
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    37   0.18 
KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}...    36   0.25 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    36   0.27 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    36   0.27 
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    35   0.43 
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...    35   0.44 
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    35   0.45 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    35   0.48 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    35   0.54 
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.55 
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    33   0.59 
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    35   0.61 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.65 
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    35   0.74 
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    35   0.82 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.91 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    34   0.92 
CAGL0K05599g Chr11 (545761..547893) [2133 bp, 710 aa] {ON} simil...    34   0.95 
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    34   1.0  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    34   1.0  
KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa] ...    34   1.0  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    32   1.1  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    34   1.2  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    34   1.6  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    33   1.7  
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...    33   1.8  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    33   1.8  
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    33   1.8  
TDEL0G02640 Chr7 (504079..505212) [1134 bp, 377 aa] {ON} Anc_2.3...    33   2.1  
KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {O...    33   2.2  
KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa] ...    33   2.3  
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    33   2.3  
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    33   2.7  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...    33   2.7  
Ecym_5061 Chr5 complement(135182..136468) [1287 bp, 428 aa] {ON}...    33   3.2  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    33   3.5  
YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}  DIA2Origi...    32   3.7  
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    32   3.7  
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    32   4.2  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    32   4.5  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    32   5.2  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    32   5.5  
NCAS0A10540 Chr1 (2097795..2100428) [2634 bp, 877 aa] {ON} Anc_3...    32   5.9  
Smik_18.9 Chr18 complement(14576..15424) [849 bp, 282 aa] {ON} Y...    32   6.1  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   6.1  
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    32   6.2  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    32   6.2  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    30   6.9  
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    32   6.9  
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    32   8.2  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   8.6  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    31   9.1  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    31   9.3  

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/608 (94%), Positives = 572/608 (94%)

Query: 1   MPTDSGASQGGIGSFITRHRXXXXXXXXXXXXXXXXXXXXNNLRELKDLKDHDKQAEDKS 60
           MPTDSGASQGGIGSFITRHR                    NNLRELKDLKDHDKQAEDKS
Sbjct: 1   MPTDSGASQGGIGSFITRHRTAILATLAAGATAASAYYYYNNLRELKDLKDHDKQAEDKS 60

Query: 61  ENATEXXXXXXXXXXXXXXXXQFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFK 120
           ENATE                QFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFK
Sbjct: 61  ENATEKKLASKPKKKKVSKASQFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFK 120

Query: 121 EKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLR 180
           EKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLR
Sbjct: 121 EKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLR 180

Query: 181 RATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNES 240
           RATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNES
Sbjct: 181 RATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNES 240

Query: 241 ELPSNTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSM 300
           ELPSNTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSM
Sbjct: 241 ELPSNTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSM 300

Query: 301 ELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYL 360
           ELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYL
Sbjct: 301 ELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYL 360

Query: 361 ALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDEN 420
           ALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDEN
Sbjct: 361 ALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDEN 420

Query: 421 NIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYE 480
           NIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYE
Sbjct: 421 NIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYE 480

Query: 481 FGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLA 540
           FGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLA
Sbjct: 481 FGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLA 540

Query: 541 QLKLQEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLA 600
           QLKLQEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLA
Sbjct: 541 QLKLQEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLA 600

Query: 601 QYHAQGFM 608
           QYHAQGFM
Sbjct: 601 QYHAQGFM 608

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/526 (62%), Positives = 406/526 (77%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P  ENGEP    +D LT +QK+K+A+ LKDKGNE+FKEK +++A+K+Y+ AL LKKDPV
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPV 136

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN SACYVS+ +L+KV+E +T AL+LK DYSK LLRRA+ANE L NY+DAMFDLS LS
Sbjct: 137 FYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALS 196

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           L  DFNGA+IEPMLERN+NKQA+ VL  K K   K +  LPSNTS+ASFF IF PE SF+
Sbjct: 197 LYGDFNGASIEPMLERNMNKQAMLVL--KEKLEEKKDHRLPSNTSLASFFGIFEPETSFE 254

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YDE  +AD+ LL GL  LY   +  Y+ A+ SF K+   YK LLE + + E + +K AI
Sbjct: 255 NYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQKAAI 314

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+VGIF FL+ND ++A D   Q++   PRVNSYIYLALI ADK +  E  + FD+AL+
Sbjct: 315 ALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENFDKALE 374

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDPNC+ +YYHRGQ+ F+TQ Y NA  DF KAKE +ENNIFPYIQLACL+YRE  FEDC+
Sbjct: 375 LDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCE 434

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR+KFP APE+P F  EIL+DKGDL  A KQYE   +LE+    IHVGIAPL+GK
Sbjct: 435 TLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIAPLVGK 494

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT LAR+PT ENF EA++  ++A EKDPRSEQA +GLAQLKLQ+E+VD AI LFE+A+D 
Sbjct: 495 ATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEEAADL 554

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +RS DEKLQATTFAEA K+QK+IRADP+I AK+EETLA Y AQG +
Sbjct: 555 ARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/526 (61%), Positives = 405/526 (76%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P  E GEP    V  ++ +QK+ W+  LKDKGNE+FK+KDY+NALK+YD+AL LKKDPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVS+N+LDKV+E STKALELKPDYSKALLRRA+ANE LENY DAMFDLSVLS
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           LN DF G++IEPMLERNLNKQA+ VL  K K   +    LPS+T++ASFF IFTPE  F 
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVL--KDKLGQQKNQLLPSDTALASFFGIFTPETEFA 258

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YDE S+AD++L  GL+ LY   +  Y+ A+  F+++++ Y  L E   D   + +K AI
Sbjct: 259 NYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAI 318

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+ GIF FL+ND + A +   ++I   PRVNSYIY+ALI ADK + +E  ++FD+A+K
Sbjct: 319 ALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIK 378

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDP  + +YYHRGQ+ F+T  Y  A  DF KAK+L+E NIFPYIQLACL+YRE  F+DC+
Sbjct: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  A++KF  APE+P F  EILADKGDL+ A KQY+   RLE     IHVGI+PL+GK
Sbjct: 439 TLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGK 498

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT LARQP+ ENF EA+KLL++A  KDPRSEQ  VGLAQLKLQ+ED+D AI+LFE+A+  
Sbjct: 499 ATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASL 558

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +R++DEKLQATTFAEAAKVQKRIRADP++ AK+EETLA Y AQG +
Sbjct: 559 ARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/534 (60%), Positives = 410/534 (76%), Gaps = 8/534 (1%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   +GEPD + +D+ T +Q++ +A+ LKDKGNE FKEK  E A+K+Y +AL  KKDPV
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FY+N+SACYVSLN+ +KV+E   KALELKPDYSK LLRRA   E +EN++DAMFDLSVLS
Sbjct: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPS-KNESELPSNTSMASFFSIFTPEISF 261
           LNNDF+GA+IEPMLERNLNKQA+K+L ++ +N   K E  LPS+TSMASFF IF PE  F
Sbjct: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260

Query: 262 DSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISK--- 318
             YDE  +AD+ L  GL EL++A    +  A++ FN+++  Y+ L     D+E +++   
Sbjct: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320

Query: 319 -KFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYF 377
            KFAIALEY GIF FL+ND++ AQ   N++I   PRVNSYIYLAL SAD  E  E    F
Sbjct: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380

Query: 378 DEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGD 437
           D+AL+L+PN S  YYHRGQL F+TQDY  AK DFLKAKELD +NIF YIQLACL YREGD
Sbjct: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440

Query: 438 FEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE---NTQKSIHV 494
            ++C+  F+ AR+KFPVAPE+PTF  EILADKGD   AAKQY+   RLE   + +  I V
Sbjct: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500

Query: 495 GIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIE 554
           G+APL+GKAT LARQP+PENF+EA+ L ++A ++DPRSEQA VGLAQL LQ+EDVD+AI+
Sbjct: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560

Query: 555 LFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +FE+A+D +R+ DEKLQA TFAEAAKVQK+IRADP+I+AKVEE LA+Y AQG +
Sbjct: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/526 (60%), Positives = 403/526 (76%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P  +NGEP    ++ L+ + ++ +A  LKD+GNE+FK+KDY+NALK+Y++AL++KKDPV
Sbjct: 76  YPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKDPV 135

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVSL +LDKV+E STKALELKPDYSKALLRRA+ANE LENY+DAMFDLSVLS
Sbjct: 136 FYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVLS 195

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           LN DFNG++IEPMLERNLNKQA+ VL  K  N      +LPSNT++ASFF IF PE +F 
Sbjct: 196 LNGDFNGSSIEPMLERNLNKQAMFVLKDKLGN--NVSQQLPSNTALASFFGIFPPETTFA 253

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +Y+E  +AD  L NGL++LY   +  Y++A+ +F KS   +   L    D   + +K AI
Sbjct: 254 NYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLKEKTAI 313

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+ GIF FL+ND + A D   ++I   PR+NSYIY+ALI ADK + +E  +YFD+A+ 
Sbjct: 314 ALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYFDKAIA 373

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDPN  P YYHRGQ+ ++T  Y  A  DF KAKE DENNIFPYIQLACL+YRE  F+DC+
Sbjct: 374 LDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCE 433

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  A++KFP APE+P F  EIL DKGDL+ A KQYE   RLE     IHVG+APL+GK
Sbjct: 434 TLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGVAPLVGK 493

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT LARQP+ ENF EA+ LL++A  +DP SEQA VGLAQLKLQ+E+VD AI LFE+A++ 
Sbjct: 494 ATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEEAANL 553

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +R++DEKLQATTFAEAAKVQKRI+ADPV+ AK+EETLA Y AQG M
Sbjct: 554 ARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/529 (61%), Positives = 403/529 (76%), Gaps = 3/529 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P  ++ +PD   + +L  +++ K +++LKDKGN+YFK KDY NA+K+Y+ AL L KDP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVSL +LDKVIE STKALEL P+YSKALLRRA+ANE LENYSDA+FDLSVLS
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQ---KSKNPSKNESELPSNTSMASFFSIFTPEI 259
           LN D++GA+IEP+LERNLNKQAIKVL++   K    +K +  LPS TS+ SFF IF PE+
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 260 SFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKK 319
           +F +Y+E   AD ELL GL  L+      Y  A+ +F K+  L+   L      + + +K
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336

Query: 320 FAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDE 379
            AIALEY GIF FL+NDL+ AQ    ++I   PRVNSY+YLALISADK+   E +KYFD+
Sbjct: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396

Query: 380 ALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFE 439
           AL+L+P+   +YYHRGQL F+TQDY  AK +F KAKELDE NIFPYIQLACL+YRE DF+
Sbjct: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456

Query: 440 DCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPL 499
            CQ  F+  R+KFP  PE+PTF  EILADKGD  LA KQY+   RLE  QK+IHVGIAPL
Sbjct: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516

Query: 500 IGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKA 559
           +GKAT LARQP   N  EA++L++ A E DPRSEQAIVGLAQLKLQ E+VD AIELFEKA
Sbjct: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576

Query: 560 SDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +D SR+MDEK+QA TFAEAAK+QKRIRADPVI AKV+E LA Y +QG +
Sbjct: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/526 (59%), Positives = 403/526 (76%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   NGEPD     N T +QK+ +++ LKDKGN++FKE+ YE+ALK+Y++AL LK+DPV
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVSL  L+KV+E STKALELKPDYSKALLRRA+ANE LEN+++AMFDLSVLS
Sbjct: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           LN DFN A+IEPMLERNLNKQA++VL  K K  S  + +LPSNT +ASFF IFTPE +  
Sbjct: 194 LNGDFNEASIEPMLERNLNKQAMRVL--KDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           ++DE ++AD ELLN L  LY  K+  Y IA+ SF+K+ E Y   LE+  D E + +K A 
Sbjct: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALEY GIF FL+ND + + +   +SI   PRVN+YIY ALI ADK E      +FD+AL 
Sbjct: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           +DPN +P+YYHRGQ++F++Q Y  A  DF KAKE D +NIFPYIQLACL+Y EG F+DC+
Sbjct: 372 VDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCE 431

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  A++KFP APE+P F  E+L DKGD D A+KQY+   RLE +  +IHVG++PL+GK
Sbjct: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT LARQPT EN  E++ LL++A + D RSEQA +GLAQLKLQ+E++D AI LFE+ASD 
Sbjct: 492 ATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +R+M+EKLQATTFAEA+KVQK+IRADPV+ AK++ TLA Y  QG +
Sbjct: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/526 (58%), Positives = 406/526 (77%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           FP  E GEPD   VD L+A++KDK+A+ LKDKGNE+FK K +E+ALK+Y  A+ +K+DPV
Sbjct: 71  FPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPV 130

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN SACYVSL + +KV+E +T AL+LKPDYSK LLRRA+ANE L  ++DAMFDLS +S
Sbjct: 131 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVS 190

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           L  DFNG++IEP+LERN+NKQA+ VL  K K   + E +LPSNTS+ASFF IF PE SF+
Sbjct: 191 LYGDFNGSSIEPLLERNMNKQAMLVL--KEKLEKQQEYKLPSNTSLASFFGIFQPETSFE 248

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YDE S+ADK LL+GL  LY   +G YE A+++F+K+ + YK LLE   +  ++ +K AI
Sbjct: 249 NYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAI 308

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+VGIF FL+ND ++A +   +++   PR N+YIY+ALI ADK +  E    F++AL+
Sbjct: 309 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALE 368

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDPNC+ +YYHRGQ++F+TQ +  A  DF KAKEL+E+NIFPYIQLACL+YREG F D +
Sbjct: 369 LDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSE 428

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR+KFP +PE+P F  E L+DKGD+  A K+Y+   +LE+    IHVG++PLIGK
Sbjct: 429 TLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGK 488

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT L+R+P+ ENF EA++L + A E DPRSEQA +GLAQLKLQ+ED+D AI LFE+A+D 
Sbjct: 489 ATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 548

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +RS DEKLQATTFAEA K+QK+IRADP++ AK+EETLA Y AQG +
Sbjct: 549 ARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/582 (55%), Positives = 418/582 (71%), Gaps = 30/582 (5%)

Query: 45  ELKDLKDHDKQAEDKSENATEXXXXXXXXXXXXXXXXQFPAKENGEPDFTGVDNLTADQK 104
           E KD+K   K+AE   + A+E                 +P   NGEPDF+   N TA++K
Sbjct: 48  EKKDVKGSQKKAEGSKKTASESKAPV------------YPVSSNGEPDFSKKANFTAEEK 95

Query: 105 DKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMS 164
           DK+A+ LKDKGN+YF+ K Y++A+K+Y++AL LK+DPVFYSN+SACYVS+ +L KV+EMS
Sbjct: 96  DKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMS 155

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQA 224
           TKALE+KPDYSK LLRRA+ANE L N++DAMFDLSVLSLN DFN A+IEPMLERNLNKQA
Sbjct: 156 TKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQA 215

Query: 225 IKVLDQK--------------SKNPSKNESE----LPSNTSMASFFSIFTPEISFDSYDE 266
           +  L +K              S  P K   +    LPS TSMASFF IF PE++F +YDE
Sbjct: 216 MSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPSITSMASFFGIFKPELTFANYDE 275

Query: 267 ESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEY 326
            + ADKEL++GL  LY      Y+ A+ SF K+ +L++  L+ + + E + +K AI+LE+
Sbjct: 276 FNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEH 335

Query: 327 VGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPN 386
            GIF FL+ND + A +   ++I   PRVNSYIY+ALI AD+N+  E   YFD+ALKL+PN
Sbjct: 336 TGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPN 395

Query: 387 CSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFE 446
            S +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFPYIQLACL+YRE  F+DC+  F 
Sbjct: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455

Query: 447 LARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATAL 506
            A++KFP APE+P F  EIL DK D D A KQY+  I LEN    I+VGIAPL+GKAT L
Sbjct: 456 EAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLL 515

Query: 507 ARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSM 566
            R PT ENF EA+ LL+ A + DPRSEQA +GLAQ+KLQ+ED+D AI LFE+++D +R+M
Sbjct: 516 TRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTM 575

Query: 567 DEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +EKLQA TFAEAAKVQ++IR+DP++ AK++ETLA+   QG M
Sbjct: 576 EEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/544 (58%), Positives = 402/544 (73%), Gaps = 18/544 (3%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   NGEPDF+   N TA++KDK+A+ LKDKGN++F+ K Y++A+K+Y++AL LK+DPV
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPV 133

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVS+ +L KV+EMSTKALELKPDYSK LLRRA+ANE L  ++DAMFDLSVLS
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLS 193

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQK--------------SKNPSK----NESELPS 244
           LN DFN A+IEPMLERNLNKQA+  L +K              S  P+K     +  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPS 253

Query: 245 NTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYK 304
            TSMASFF IF PE++F +YDE ++ADKEL+NGL  LY      Y+ A+ SF K+  L++
Sbjct: 254 VTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFE 313

Query: 305 ILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALIS 364
             L+   + E + +K AI+LE+ GIF FL+ND + A +   ++I   PRVNSYIY+ALI 
Sbjct: 314 EQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 365 ADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFP 424
           AD+N+  E   YFD+ALKLD N S +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFP
Sbjct: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 425 YIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIR 484
           YIQLACL+YRE  F+DC+  F  A++KFP APE+P F  EIL DK D D A KQY+  I 
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 485 LENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKL 544
           LEN    I+VGIAPL+GKAT L R PT ENF EA+ LL+ A + DPRSEQA +GLAQ+KL
Sbjct: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 545 QEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHA 604
           Q+ED+D AI LFE+++D +R+M+EKLQA TFAEAAKVQ+RIR+DPV+  K++ETLA+   
Sbjct: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLRE 613

Query: 605 QGFM 608
           QG M
Sbjct: 614 QGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/544 (58%), Positives = 404/544 (74%), Gaps = 18/544 (3%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   NGEPDF+   + TA++KDK+A+ LKDKGN+YF+ K Y++A+K+Y++AL LK+DPV
Sbjct: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVS+ +L KV+EMSTKALELKPDYSK LLRRA+ANE L N++DAMFDLSVLS
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQK--------------SKNPSK----NESELPS 244
           LN DFN A+IEPMLERNLNKQA+  L +K              S  P K     +  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253

Query: 245 NTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYK 304
            TSMASFF IF PE++F + DE ++ADKEL+NGL  LY      Y+ A+ SF K+++L++
Sbjct: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313

Query: 305 ILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALIS 364
             L+   + E + +K AI+LE+ GIF FL+ND + A +   ++I   PRVNSYIY+ALI 
Sbjct: 314 DQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373

Query: 365 ADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFP 424
           AD+N+  E   YFD+ALKLD N S +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFP
Sbjct: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 425 YIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIR 484
           YIQLACL+YRE  F+DC+  F  A++KFP APE+P F  EIL DK D D A KQY+  I 
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 485 LENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKL 544
           LEN  + I+VGIAPL+GKAT L R PT ENF EA+ LL+ A + DPRSEQA +GLAQ+KL
Sbjct: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 545 QEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHA 604
           Q+ED+D AI LFE+++D +R+M+EKLQA TFAEAAKVQ+RIR+DPV+  K++ETLA+   
Sbjct: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613

Query: 605 QGFM 608
           QG M
Sbjct: 614 QGLM 617

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/526 (58%), Positives = 402/526 (76%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   NGEPD +GVD+ T +QK+++++ +KDKGNE FKEK YE A+K+Y  AL LKKDPV
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN SAC+V LN+L+KV+E +T ALELKPDYSK LLRRATANE L N++DAM DLS +S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           L   +N  +IEP+LERN+NKQA++VL +K  + SK++  LPSNTS+ASFF IF  E SF 
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ--LPSNTSLASFFGIFPSETSFA 250

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YDE+S+AD  LL GL+ L   KTG YE+++  FNK+ +L  +  ++  +   +  K AI
Sbjct: 251 NYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAI 310

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+VGIF FL+N+ + A  L  +++   PR NSYIY+ALI ADK + DE  +YFD+AL+
Sbjct: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           L PN S +YYHRGQ+ FVTQ +  +  DF KAKE + +NIFPYIQLACL+YRE  FEDC+
Sbjct: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR+KFP APE+P F  EIL+DKGDL+ A K+YEF  +LE+ Q+ IHVG+APL+GK
Sbjct: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGK 490

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT LARQ    +F+EA+ L ++A +KDPRSEQA +GLAQLKLQ+E VD AI+LFE+A+D 
Sbjct: 491 ATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +R+ +EKLQATTFAEAAK+QKRIRADP++ AK++ETL  Y  QG +
Sbjct: 551 ARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/525 (58%), Positives = 395/525 (75%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   NG+PD +  D  T +Q DK+A+ LKDKGNE+FK KD+E A+++Y  A+ LK+DPV
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN SA YVS+N  +KV+E +T AL+LKPDYSK  LRRA+A E L  +SDAMFDLS +S
Sbjct: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           L  +++G ++E +LERN+NKQA KVL +K K     ES LPSNTS+ASFF IF PE SFD
Sbjct: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
            YD E++AD EL  GL+ LY  +TGCYE+A+  F K+ ELYK  LES+ D E++ KK AI
Sbjct: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           A E+VGIF F +ND +TA     +S+S +PR ++YIY+ALI ADK E ++  +YFD+AL+
Sbjct: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDPNCS +YYHRGQ++FV +++  A  DF KAKEL+  NIF YIQ ACL++R+  F+DC+
Sbjct: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR+KFP APE+P F  EILA K  LD A KQY+  I+LE+    IHVGIAP+IGK
Sbjct: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           ATAL R PT ENF EAS+L ++A + DPRSEQA +GLAQLKLQ+E++D AI+LFE A+D 
Sbjct: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGF 607
           SRS DEKLQATTFAEA KVQK+IRADP IK K++E +A Y AQG 
Sbjct: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/580 (55%), Positives = 419/580 (72%), Gaps = 30/580 (5%)

Query: 47  KDLKDHDKQAEDKSENATEXXXXXXXXXXXXXXXXQFPAKENGEPDFTGVDNLTADQKDK 106
           K++K   K+ +D SE+  E                 +P   NG+PDF+   N TA++KD+
Sbjct: 50  KEVKGSQKKTKDGSESTAESNTPV------------YPVSSNGDPDFSNKANFTAEEKDR 97

Query: 107 WAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           +A+ LKDKGN++F+ K Y++A+K+Y++AL LK DPVFYSN+SACYVS+ +L KV+EMSTK
Sbjct: 98  YALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTK 157

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIK 226
           ALELKPDYSK LLRRA+ANE L N++DAMFDLSVLSLN DFN A+IEPMLERNLNKQA+ 
Sbjct: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217

Query: 227 VLDQK-------SKNPS----------KNESE-LPSNTSMASFFSIFTPEISFDSYDEES 268
            L +K       +  P+          K+++E LPS TSMASFF IF PE++F +YDE +
Sbjct: 218 KLKEKFGDIDTATATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESN 277

Query: 269 DADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVG 328
           +ADK+L+NGL  LY      Y+ A+ SF K+++L+   L+   + E   +K AI+LE+ G
Sbjct: 278 EADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTG 337

Query: 329 IFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNCS 388
           IF FL+ND + A +   ++I   PRVNSYIY+ALI AD+N+  E   YFD+ALKLD N S
Sbjct: 338 IFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNS 397

Query: 389 PIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELA 448
            +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFPYIQLACL+YRE  F+DC+  F  A
Sbjct: 398 SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA 457

Query: 449 RKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALAR 508
           ++KFP APE+P F  EIL DK D + A KQY+  I LEN    I+VGIAPL+GKAT L R
Sbjct: 458 KRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTR 517

Query: 509 QPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSMDE 568
            PT ENF EA+ LL++A + DPRSEQA +GLAQ+KLQ+ED+D AI LFE+++D +R+M+E
Sbjct: 518 NPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEE 577

Query: 569 KLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           KLQA TFAEAAKVQKRIR+DP++ AK++ETLA+   QG M
Sbjct: 578 KLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLREQGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/525 (60%), Positives = 400/525 (76%), Gaps = 3/525 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P ++NGEP+    D  T ++K+K++I LKDKGN  FK   +E A+K+Y++A+ LK++P+
Sbjct: 86  YPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKENPI 145

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN+SACYVSLN+L+++I+   KALELKPDYSK LLRRA ANE+LENY+DAMFDLSVLS
Sbjct: 146 FYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVLS 205

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           LN D+NGA+IEP+LERNLNKQA+ VL  K KN SK++ +LPS+TS+++FF IF PE+SF+
Sbjct: 206 LNGDYNGASIEPILERNLNKQAMSVLKDKLKN-SKDD-QLPSDTSLSAFFGIFKPELSFE 263

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YDE +DADKELLNGL  L+  ++  Y IA+ SF  ++ELY   LE T D   +  K +I
Sbjct: 264 NYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKASI 323

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           A EY GIFNFL+NDL  A +  ++SI  +PR+NSYIY ALI ADK E  +   YFD+ALK
Sbjct: 324 AYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKALK 383

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LD     +YYHR QLNFVTQD+  A  DF KAKE D  NIFPYIQLACL+YRE  F+DC+
Sbjct: 384 LDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCE 443

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQK-SIHVGIAPLIG 501
             F  A++KFP  PE+P F  E+L DKGD D A K YE   RLE   K  IHVG+APLIG
Sbjct: 444 TLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLIG 503

Query: 502 KATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASD 561
           KAT LAR+PT EN + A KLL++A   DPRSEQA +GLAQLKLQ+E++D +I LFE+++D
Sbjct: 504 KATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESAD 563

Query: 562 YSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQG 606
            +R+M+EKLQATTFAEAAKVQK IRADP+I  K+EETLA Y AQ 
Sbjct: 564 LARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/526 (57%), Positives = 400/526 (76%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P  E GEPD + +  L+ +QKDK+A+ LKDKGNE+FK K Y+ A+++Y +A+ +K+DPV
Sbjct: 70  YPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPV 129

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN SACYVSL + +KV+E +T AL+LKPDYSK LLRRA+ANE L N++DAMFDLS +S
Sbjct: 130 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVS 189

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           L  DF+GA+IEP+LERN+NKQ++ VL  K K   + E +LPSNTS+ASFF IF PE +F+
Sbjct: 190 LYGDFSGASIEPLLERNMNKQSMLVL--KEKLEKQQEYKLPSNTSLASFFGIFQPETTFE 247

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YD+ S+ADK LL GL  LY      YE A+ SF K+ + +K+LLE   +   + +K AI
Sbjct: 248 NYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAI 307

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+VGIF FL+ND ++A +   +++   PR N+YIY+ALI ADK +  E    F++ALK
Sbjct: 308 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALK 367

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDP+C+ +YYHRGQ+ F+TQ +  A  DF KAKEL E+NIFPYIQLACL+YREG F+D +
Sbjct: 368 LDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSE 427

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR+KFP APE+P F  E L+DKGDL  A KQY+   +LE+    IHVG++PLIGK
Sbjct: 428 TLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGK 487

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT L+R+P+ ENF EA++L + A + DPRSEQA +GLAQLKLQ+ED+D AI LFE+A+D 
Sbjct: 488 ATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 547

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +RS DEKLQATTFAEA K+QK+IRADPV+ AK+EETLA Y AQG +
Sbjct: 548 ARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/526 (57%), Positives = 396/526 (75%), Gaps = 2/526 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P  +NGEPD +G+   T +QK+K+A+ LKDKGNE FK++ YE A+KFYD AL LK+DPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           FYSN SACYV LN+L+KV+E +T AL+LKPDYSK LLRRATANE L NY+DAM DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           L   ++  TIEP+LERN+NKQA++VL QK     K+E  LPSNTS+ASFF IF  E S +
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE--LPSNTSLASFFRIFPSETSLE 247

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YDE S+AD+ LL GL  L++ + G YEIA+ +F  ++E +    E+  D   + +K AI
Sbjct: 248 NYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAI 307

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+VGI  FL+N+ + A +L  ++I   PR NSYIY+ LI ADK + DE  + F++AL+
Sbjct: 308 ALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALE 367

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LDP  S  YYHR Q+NFV Q +  A  DF KAKE D + ++PYIQLACL+YRE  F+DC+
Sbjct: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR++FP APE+P F  EIL+DKGD + A K+Y+F  +LE+ Q+ IHVG+APL+GK
Sbjct: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           A  LARQP+  NF+EA+KL + A EKDPRSEQA +GLAQLKLQ+E+VD AI+LFE A+D 
Sbjct: 488 AALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           SR+ +EKLQATTFAEAAK+QKRIRADPV+ AK++ETL  Y AQG +
Sbjct: 548 SRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 391/527 (74%), Gaps = 11/527 (2%)

Query: 90  EPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSA 149
           +PD   +   + DQK  +A  LKDKGN  FKEK +E+A++FY+ A+ L +DPVF+SN+SA
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134

Query: 150 CYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNG 209
           CYVSL +LDKV+E ST+ALELKPDYSKALLRRA+A E +  Y DAMFD+SVLSLN DFNG
Sbjct: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194

Query: 210 ATIEPMLERNLNKQAIKVLDQ---------KSKNPSKNESELPSNTSMASFFSIFTPEIS 260
           ++IEPMLERNLNKQA++VL +         +++ P +   ELPSNTS++SFF IF PE  
Sbjct: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQP-RERQELPSNTSLSSFFGIFKPETE 253

Query: 261 FDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKF 320
             +YDE ++AD  L+ GLK LY A +  Y++A+  F K+ +LY+  L +  D     +K 
Sbjct: 254 IPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNNDA-AFKEKA 312

Query: 321 AIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEA 380
           A ALEY+GIF+FL+NDL  ++    ++++  PRVN+YIYLAL  AD+ + ++   YF++A
Sbjct: 313 ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKA 372

Query: 381 LKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFED 440
           + LDPN + +YYHRGQ+ F+TQ+Y  A  DF K+KE D  NIFPYIQLACL+YRE    +
Sbjct: 373 IALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAE 432

Query: 441 CQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLI 500
           C+  FE ARK FP APE+P F  EILADKGD+D A KQY    RLE+ QK IHVGIAPL+
Sbjct: 433 CEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLV 492

Query: 501 GKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKAS 560
           GKAT LARQPTPENF+  S+LL+DA + DPRSEQA VGLAQL+LQ+E VD AIELFE+A+
Sbjct: 493 GKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAA 552

Query: 561 DYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGF 607
             +R++DEKLQA TFAEA KVQKRIRADPV+  KVEETLA Y AQ  
Sbjct: 553 KMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/604 (52%), Positives = 421/604 (69%), Gaps = 5/604 (0%)

Query: 7   ASQGGIGSFITRHRXXXXXXXXXXXXXXXXXXXXNNL-RELKDLKDHDKQAEDKSENATE 65
           AS G +G FI R++                      L R++ D     K+ +  S+    
Sbjct: 3   ASDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQRQIDDSSSSKKKKKKHSKKKKS 62

Query: 66  XXXXXXXXXXXXXXXXQFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYE 125
                            +P   NGEPD +G D+ + + K+K+A+ LKDKGN+YFK++D+E
Sbjct: 63  TSTDEKSNSKNETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFE 122

Query: 126 NALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATAN 185
           NALK+Y++AL LK+DPVFYSN+SACYVSL +L+KV+E ST+AL+LK DYSKALLRRA+A 
Sbjct: 123 NALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAY 182

Query: 186 EQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESEL-PS 244
           E L NY DAM DLSVLSLN DFNGA+IEPMLERNLNKQA++VL +K    ++N+ +L PS
Sbjct: 183 ESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEK---IAENKPQLLPS 239

Query: 245 NTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYK 304
           NTS+ASFF +F PE+S ++++E S+++KELLNGL  LYS     Y +A+ SF K+++L +
Sbjct: 240 NTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLE 299

Query: 305 ILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALIS 364
              E  ++   I +K+AIALEY GI  FL+ND + A +   ++I   PRVNSYIY +LI 
Sbjct: 300 KEYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLIL 359

Query: 365 ADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFP 424
           ADK E +ES K FD A+ LD   +  YYHRGQL F+TQ Y  A  DF KAKELDE+NI P
Sbjct: 360 ADKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILP 419

Query: 425 YIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIR 484
           YIQLACL+Y+E  F DC+  F  AR+KFP APE+P F  ++L ++ + D A KQY+   +
Sbjct: 420 YIQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKK 479

Query: 485 LENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKL 544
           LE   + IHVGIAP+IGKAT LAR P  EN  E+++L ++A + DPRSEQA +GLAQLKL
Sbjct: 480 LEEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKL 539

Query: 545 QEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHA 604
           Q+E+VD AI LFE+A+  +R+MDEKLQATTFAEA+KVQK++R+DPVI  K++ETLA Y  
Sbjct: 540 QQEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQ 599

Query: 605 QGFM 608
           QG M
Sbjct: 600 QGLM 603

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/525 (57%), Positives = 384/525 (73%), Gaps = 1/525 (0%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142
           +P   NGEP    VD L    K++WA  LK+KGN  FK+KD+ENA+K+Y FAL LK+DPV
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPV 129

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202
           +YSN+SACY SL   +KVIEM+TKAL L+PDYSK L+RRA A E+L N+ DAMFDLSV S
Sbjct: 130 YYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCS 189

Query: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262
           LN D + A+IEP+LERNLN+QA+ VL+ K     K +S+LPSNT++ SFF IF PE+SF 
Sbjct: 190 LNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDK-KSQLPSNTALTSFFGIFKPELSFA 248

Query: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
           +YD+  + DKELLNGLK LY      YE A+ SF K+ E +   L  T D ET+ +K AI
Sbjct: 249 NYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTAI 308

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           ALE+ GIF FL+N+ + A +   +++   PR+NSYIY+ALI ADK + D     +++A+K
Sbjct: 309 ALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMK 368

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LD   + +YYHRGQ+ F+TQ Y  A  DF KAKELD  NIFPYIQLACLSYRE  F+DC+
Sbjct: 369 LDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCE 428

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F  AR+KFP + E+P F  EILADKGD D A K+YE  I LE  Q ++HVGIAPL+GK
Sbjct: 429 TLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVGK 488

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562
           AT L R PT ENF EA+ LL++AV++DPRSEQA + L QLKLQ+ED+D AIELFE A+  
Sbjct: 489 ATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAATL 548

Query: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGF 607
           +R+ +EKLQATTFAEAAK+QKRIRADP + AK++ET+A   A  F
Sbjct: 549 ARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRASDF 593

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/522 (55%), Positives = 379/522 (72%), Gaps = 3/522 (0%)

Query: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNM 147
           NGEP+ + +D+LT + K++WA+ LKDKGNE FK   +E+A+K+Y +AL LK DP++YSN+
Sbjct: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNI 149

Query: 148 SACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDF 207
           SACY SL + +KVIE +TKAL+L+P +SK L+RRA A E + N+ DAMFD+S  SLN D 
Sbjct: 150 SACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDM 209

Query: 208 NGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFDSYDEE 267
           N A+IEP+LER LNKQA  VL  K K  +  E  LPS+T +ASFF +F PE SF +Y+E 
Sbjct: 210 NDASIEPILERILNKQAEFVL--KEKISANKEQNLPSSTPLASFFRVFKPETSFANYEES 267

Query: 268 SDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYV 327
           ++AD+EL+NGL  LY      ++IA+ SF K+ EL+K  L   +D E I +K AIALEY 
Sbjct: 268 NEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYS 327

Query: 328 GIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNC 387
           GI  +++N+ + A D    +I   PRVNSYIY +LI +D     E  + FD+AL+L+PN 
Sbjct: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNN 387

Query: 388 SPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFEL 447
             IYYHRGQ  F+ Q Y  A  DF K KELDENNIF YIQLACL+YRE  F+DC+  F  
Sbjct: 388 PAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSE 447

Query: 448 ARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE-NTQKSIHVGIAPLIGKATAL 506
           AR+KFP APE+P F  E+LAD+G+ + A K+++  I LE  T + IHVGIAPLIGKAT L
Sbjct: 448 ARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLL 507

Query: 507 ARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSM 566
             +PT ENF E  +LLQ+A +KDPRSEQA +GLAQLKLQ+ED+D AI+LFE+A++ ++S 
Sbjct: 508 ISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSY 567

Query: 567 DEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +EKLQATTFAEAAK+QKRIRADP + AK+ +T+ Q  +Q  M
Sbjct: 568 EEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM 609

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/540 (54%), Positives = 377/540 (69%), Gaps = 13/540 (2%)

Query: 82  QFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKD 140
           ++P   +GEPD   +  L   Q+ ++A++LKDKGN +F  K++++A+K+Y  A+ L   D
Sbjct: 99  EYPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND 158

Query: 141 PVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSV 200
           PVFYSNMSACY+S  +L+KV+E +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSV
Sbjct: 159 PVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218

Query: 201 LSLNNDFNGATIEPMLERNLNKQAIKVLDQK-SKNPSKNESE-LPSNTSMASFFSIFTPE 258
           LSLN DF+GA+IEPMLERNLNKQA+KVL+   SKN     SE LPSNTS+ASFF IF P+
Sbjct: 219 LSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPD 278

Query: 259 ISFDSYDEESDADKE---LLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKET 315
           +        S  D     LL  L+ LYSA +  Y IA + F K+ + Y  LL ++     
Sbjct: 279 LEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGA 338

Query: 316 ISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNK 375
           I    A+A  Y GIF FL+NDL+ AQ L  +SI+  P  NSYI++AL  ADK    E   
Sbjct: 339 IRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFS 398

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           +F +A+ LDP  SP YYHRGQ+ F+ QDYVNAK DF KA+ L+  NI+PYIQLACL Y++
Sbjct: 399 FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVG 495
           G F + +  F   + KFP  PE+PTF  EIL DKGD + A KQY+   RL+  Q+ IHVG
Sbjct: 459 GKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVG 518

Query: 496 IAPLIGKATALARQPTP-------ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEED 548
           I PLIGKAT LARQ T        E F+ A +LL +A + DPRSEQA +GLAQLKLQ E 
Sbjct: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578

Query: 549 VDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +D AIELF+ ++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E+TLA Y A G +
Sbjct: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/540 (53%), Positives = 381/540 (70%), Gaps = 13/540 (2%)

Query: 82  QFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKD 140
           ++P   +GEPD   +  L+A Q+  +A++LKDKGN +F  K + +A+K+Y +A+ L   D
Sbjct: 105 EYPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPND 164

Query: 141 PVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSV 200
           PVFYSN+SACY+S  +LDKV+E +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSV
Sbjct: 165 PVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 224

Query: 201 LSLNNDFNGATIEPMLERNLNKQAIKVLDQKS-KNPSKNESE-LPSNTSMASFFSIFTPE 258
           LSLN DF+G +IEPMLERNLNKQA+KVL++   KN     S+ LPSNTS+ASFF IF P+
Sbjct: 225 LSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPD 284

Query: 259 ISFDSYDEES---DADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKET 315
           +     +  S    A   L   L+ LYSA +  Y IA+    K+ + Y  LL + ++   
Sbjct: 285 LETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRV 344

Query: 316 ISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNK 375
           I +  A+A  Y GIF FL+NDL+ AQ L  +SI+  P  NSY+++AL  ADK    E  K
Sbjct: 345 IRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFK 404

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           +F  A+ LDP   P YYHRGQ+ F+ QDY+NAK+DF KA+ L+  N++PYIQLACL Y++
Sbjct: 405 FFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVG 495
             F + ++ F  A+ KFP+ PE+PTF  EIL DKGD + A KQY+   RLE  QK IHVG
Sbjct: 465 DKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVG 524

Query: 496 IAPLIGKATALARQ----PTP---ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEED 548
           I PLIGKAT LARQ    PT    E F+ A +LL  A E DPRSEQA +GLAQL+LQ E 
Sbjct: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584

Query: 549 VDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           +D AI+LF++++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E+TLA Y AQG +
Sbjct: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/538 (53%), Positives = 378/538 (70%), Gaps = 12/538 (2%)

Query: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDP 141
           +P+  NGEPD   +  L+  Q+  +A++LK++GN +F  K++  A+K+Y +A+ L   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 142 VFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           VFYSN+SACY+S  +L+KVIE +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 202 SLNNDFNGATIEPMLERNLNKQAIKVLDQK-SKNPSKNESELPSNTSMASFFSIFTPEIS 260
           SLN DF+GA+IEPMLERNLNKQA+KVL++  SK+  +    LPSNTS+ASFF IF   + 
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 261 FDSYDEESDADKE---LLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETIS 317
             S +  S+ D     L + L+ LYSA    Y +A     KS ++Y  LL +    + + 
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 318 KKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYF 377
           +  A+AL Y GIF+FL+N+L+ AQ L  +SI+  P  NSYI+LAL  ADK    E  K+F
Sbjct: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401

Query: 378 DEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGD 437
            +A+ L+P   P YYHRGQ+ F+ QDY NAK DF KA+ L+  N++PYIQLACL Y++G 
Sbjct: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461

Query: 438 FEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIA 497
           F + +  F   + KFP  PE+PTF  EIL D+GD D A KQY+   RLE  Q+ IHVGI 
Sbjct: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521

Query: 498 PLIGKATALARQ----PTP---ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVD 550
           PLIGKAT LARQ    PT    E F+ A KLL  A E DPRSEQA +GLAQLKLQ E +D
Sbjct: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581

Query: 551 TAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
            AIELFE ++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E TLA+Y A+G +
Sbjct: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/533 (54%), Positives = 367/533 (68%), Gaps = 13/533 (2%)

Query: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSN 146
           NGEPD + +  LT  QK  +A++LK+KGN +F  K++  A+K+Y  A+ L   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 147 MSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND 206
           +SACY+S  +L+KV+E +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSVLSLN D
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 207 FNGATIEPMLERNLNKQAIKVLDQK-SKNPSKNESELPSNTSMASFFSIFTPEISFDSYD 265
           F+GA+IEPMLERNLNKQA+KVL++  SK   +    LPSNTS+ SFF IF P++     +
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 266 EESDADKE---LLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322
             S  D     L + L++LYSA    Y  A+  F  + + Y  LL S  D   + +  A+
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-LKENAAL 342

Query: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382
           A  Y GIF+FL+N+L+ AQ L  +SI+  P  NSYI+LAL  ADK    E  KYF +A+ 
Sbjct: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402

Query: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442
           LD    P YYHRGQ+ F+ QDYVNAK DF KA+ L   NI+PYIQLACL Y++G F + +
Sbjct: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462

Query: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502
             F   + KFP  PE+P F  EIL DKGD   A KQY+   RLE  Q+ IHVGI PLIGK
Sbjct: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522

Query: 503 ATALARQ----PTP---ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIEL 555
           AT LARQ    PT    E F+ A  LL  A E DPRSEQA +GLAQLKLQ E +D AIEL
Sbjct: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582

Query: 556 FEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
           F+ ++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E TLA Y A+G +
Sbjct: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/535 (52%), Positives = 378/535 (70%), Gaps = 9/535 (1%)

Query: 83  FPAKENGEPDFTGVDNLTADQ---KDKWAIELKDKGNEYFKEKDYENALKFYDFALILKK 139
           +P     +PDF  ++ L A+    K K+A ELK+KGN+YFK KD ENA+K+Y++AL L +
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQ 189

Query: 140 DPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLS 199
           DPVFYSN+SACY ++N+LDKVIE S KALELKPDYSKALLRRA A E L N  +A++D S
Sbjct: 190 DPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFS 249

Query: 200 VLSLNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEI 259
           +LSL  +++G  +EP+L R L+K +  VL  K  N   +   L S++++ SFF IF PE 
Sbjct: 250 ILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPPET 309

Query: 260 SFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETIS-- 317
           +  +Y+ + +ADKEL+ GL+ L    +  +  A+  F K+ EL+   L S+ED +  S  
Sbjct: 310 TITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGL 369

Query: 318 -KKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKN-EKDESN- 374
            +K AIALEY G+F FL+ DL+ ++    ++I   PR NSYIY+A++ ADKN +K++ + 
Sbjct: 370 LEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDY 429

Query: 375 -KYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSY 433
            KYFD+A  L+PN +P YYHRGQL  V Q +  A+  FLKAKELD++N++PYIQLAC++Y
Sbjct: 430 FKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAY 489

Query: 434 REGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIH 493
               F+ CQ  F+ AR KFP  PE+PTF  EILADKG+L+ A KQY+   RLE   K IH
Sbjct: 490 YNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIH 549

Query: 494 VGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAI 553
           VGIAPLIGKA ALAR PT ENF   ++LL+ A E DPRSEQA + LAQLKLQ ED+DTAI
Sbjct: 550 VGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAI 609

Query: 554 ELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608
            LFE+ +D +R+  +KLQATTFAEAAK+QKRI+ +P+  AK+EETLA Y A G +
Sbjct: 610 ALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII 664

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  523 bits (1348), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 270/523 (51%), Positives = 355/523 (67%), Gaps = 4/523 (0%)

Query: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNM 147
           N EPD   +      +K+++A ELK +GN YFK KDYENA+ +Y FAL LK DPVFYSNM
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 148 SACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDF 207
           +ACY+SL    + IE  +KALEL PDYSK LL+RA   E +  ++DA+ DL+ +SLN D+
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 208 NGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFDSYDEE 267
           N ATI+P++ER LNKQA+  L    +   KN+  LPS TSMA+FF +F  E     +D  
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKV-LPSYTSMAAFFGVFDAETDIPGHDAT 244

Query: 268 SDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYV 327
            ++DK L + L  LYS     Y+  +S F K+ ELYK  LE+       ++K AIA E+ 
Sbjct: 245 EESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHT 304

Query: 328 GIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNC 387
            I +FL+ND +TA++L +++I   PR  SYIYL L+ ADK   +E    F +A+ LDPN 
Sbjct: 305 AILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNM 364

Query: 388 SPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFEL 447
           + IYYHRGQ+NF+ Q Y  A  DF KAKE D  NIFPYIQLAC+SYREG F+DC+  F  
Sbjct: 365 AAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSE 424

Query: 448 ARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALA 507
           AR+KFP APE+P F  EIL+DKG+++ AA +Y+  I LE+  ++IHVGIAPL+GKAT L 
Sbjct: 425 ARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLL 484

Query: 508 RQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSMD 567
           + PT ENF EA  L + A  +DPRSE+A +GLAQ KLQ+ED+D AI LFE+A+   R++D
Sbjct: 485 KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLD 544

Query: 568 EKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYH---AQGF 607
           EKLQATTFAEA KVQ R+RAD  ++AK  + L +      QGF
Sbjct: 545 EKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF 587

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A ELK KGN  F  KD+  A++++  A+     P  V YSN SACY SL +  + +  + 
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + +++ PD+SK   R   A+  L +  DA
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 71/138 (51%), Gaps = 12/138 (8%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L    + I+  
Sbjct: 390 AEEARLEGKEYFTKSDWPNAVKAY--TEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDC 447

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND--FNGATIEPMLERNLNK 222
            KA+E  P++ +A LR+ATA   ++++  A+  L      +D   NGA+   ++     K
Sbjct: 448 EKAIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIM-----K 502

Query: 223 QAIKVLDQKSKNPSKNES 240
             +K   ++ + P+ NE+
Sbjct: 503 LQMKATQERFQAPTGNET 520

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 12/105 (11%)

Query: 324 LEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEAL-- 381
           L+  G   F   D   A + F ++I+AS   N  +Y     ++++    S K F EAL  
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLY-----SNRSACYTSLKQFQEALND 61

Query: 382 -----KLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
                K++P+ S  Y   G  +    D  +A++++ KA ELD NN
Sbjct: 62  AQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN 106

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 7/108 (6%)

Query: 89  GEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNM 147
           GEP       + A++  K A  LK +GN     KDYE A++ Y  A+ +L  D V+Y+N 
Sbjct: 77  GEP------KVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 148 SACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAM 195
           +A Y SL + +K +E + KA ++   YSK   R   A   L  + +A+
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           AI+LK++GN+Y KEK Y  A+++Y  A+ L     +F+SN +   + L+     ++    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           ALEL P   KA  RR  +   L ++  A  DLS++
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KD+E A++ +  A+ + + P  V YSN SACY S+ +  + +  + 
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + + +KPD+SK   R   A+  L +  +A
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 18/141 (12%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF   D+ NA+K Y    ++K+ P     YSN +A    L      I+  
Sbjct: 388 AEEARLQGKEYFTNADWPNAVKAY--TEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDC 445

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS-----LNNDFNGATIEPMLERN 219
             A++  P++ +A +R+ATA   ++ Y+ A+  L         +NN  N         R 
Sbjct: 446 DMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSNT--------RE 497

Query: 220 LNKQAIKVLDQKSKNPSKNES 240
           +++  IK   Q+ +  + NES
Sbjct: 498 IDQLYIKATQQRFQPANANES 518

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KD+E A++ +  A+ + + P  V YSN SACY S  + +K +E + 
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 166 KALELKPDYSKALLRRATAN 185
           + + + P +SK   R   A+
Sbjct: 63  QCVNINPAWSKGYNRVGAAH 82

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L    + I+  
Sbjct: 393 AEEARLQGKEYFTKGDWPNAVKSY--TEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 450

Query: 165 TKALELKPDYSKALLRRATA 184
             A+   P++ +A +R+ATA
Sbjct: 451 NVAISKDPNFIRAYIRKATA 470

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL--- 168
           K +GN+++K + ++ A++ Y  A  L KD  + +N +A      E +  I+  T+A+   
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQG 322

Query: 169 -ELKPDY---SKALLR 180
            EL+ DY   SK+  R
Sbjct: 323 RELRADYKVISKSFAR 338

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KDYE A+  +  A+ + + P  VFYSN SACY SL +  + +  + 
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + +++ P +SK   R   A+  L +  +A
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 18/141 (12%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G +YF + D+ NA+K Y    ++K+ P     YSN +A    L    + IE  
Sbjct: 390 AEEARLEGKDYFTKGDWPNAVKAY--TEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDC 447

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS-----LNNDFNGATIEPMLERN 219
            KA+E  P++ +A +R+ATA   ++ ++ A+  L         +NN  N         R 
Sbjct: 448 NKAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANV--------RE 499

Query: 220 LNKQAIKVLDQKSKNPSKNES 240
           +++  +K   Q+ +  S NE+
Sbjct: 500 IDQLYVKASQQRFQPASSNET 520

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 13/91 (14%)

Query: 115 GNEYFKEKDYENALKFYDFALILKKDPVFYSNMSA-------CYVSLNELDKVIEMSTKA 167
           GN+ +K + ++ A+  YD A  L +D  + +N SA          +L  LD+ +E   K 
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVE---KG 319

Query: 168 LELKPDY---SKALLRRATANEQLENYSDAM 195
            E++ DY   +K+  R    + +  N   A+
Sbjct: 320 REMRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KD+E A + +  A+   + P  V YSN SACY SL +  + +E + 
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + +++ P +SK   R   A   L N  DA
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G E+F + D+ +A+  Y    ++K+ P     YSN +A    L      I+  
Sbjct: 401 AEEARLQGKEFFTKGDWPSAVSAY--TEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDC 458

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSV-----LSLNNDFNGATIE 213
             A+   P++ +A +R+A+A   +  ++ AM  L       L +N   N   IE
Sbjct: 459 DVAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 50/91 (54%), Gaps = 7/91 (7%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL--- 168
           K +GN+Y+K + ++ A++ Y+ A  L +D  + +N SA      + ++ I+  T+A+   
Sbjct: 271 KAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQG 330

Query: 169 -ELKPDY---SKALLRRATANEQLENYSDAM 195
            E++ DY   SK+  R   A  ++++   A+
Sbjct: 331 REMRADYKLISKSFARIGNAYLKMDDLKKAI 361

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KDYE A + +  A+ + + P  V YSN SACY SL +  + ++ + 
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + +++ P +SK   R   A   L N  DA
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 10/116 (8%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L    + I   
Sbjct: 382 AEEARLEGKEYFSKADWPNAVKAY--TEMIKRSPQDARGYSNRAAALAKLMSFPEAIADC 439

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS-----LNNDFNGATIEPM 215
            +A+E  P++ +A +R+A+A   ++ ++ A+  L  +      LNN  N   I+ +
Sbjct: 440 DRAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREIDQL 495

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 7/95 (7%)

Query: 84  PAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVF 143
           P KEN EP+   VD          A E K +GN+++K + ++ A++ Y+ A  L KD  +
Sbjct: 227 PLKENNEPEPMEVDEKGPQVA---AEEEKAEGNKFYKARKFDEAIEHYNKAWELHKDITY 283

Query: 144 YSNMSACYVSLNELDKVIEMSTKAL----ELKPDY 174
            +N +A      + +  I   T A+    E++ DY
Sbjct: 284 LNNRAAAEYEKGDYETAIATLTNAVDEGREMRADY 318

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 98  NLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLN 155
           +LTAD       E K +GN  F  KDY  A+  +  A+ + + P  V YSN SACY SL 
Sbjct: 2   SLTAD-------EYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLK 54

Query: 156 ELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDA 194
           +    +  +T+ +++ P +SK   R   A+  L +  DA
Sbjct: 55  KFTDALNDATECVKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L    + I   
Sbjct: 393 AEEARLEGKEYFTKSDWPNAVKAY--TEMIKRSPEDARGYSNRAAALAKLMSFPEAIADC 450

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDL 198
            KA+E  P++ +A +R+ATA   ++ ++ A+  L
Sbjct: 451 NKAIEKDPNFVRAYIRKATAQIAVQEFAGALETL 484

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL--- 168
           K +GN+++K + +E A++ Y+ A  L +D  + +N +A      + +  I   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 169 -ELKPDY---SKALLRRATANEQL 188
            E++ DY   SK+  R   A  +L
Sbjct: 323 REMRADYKVISKSFARIGNAYHKL 346

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 101 ADQKDKWAIE-LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELD 158
           AD++ K   E LK +GN+    KDYE+A+K Y  A+ +L  + V+Y+N +A Y SL + D
Sbjct: 85  ADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYD 144

Query: 159 KVIEMSTKALELKPDYSKALLR 180
             +  +  A+++ P YSK   R
Sbjct: 145 DAVNDAESAIKVNPTYSKGYSR 166

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KDY+ A++ +  A+ + K P  V YSN SACY SL +    +  + 
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 166 KALELKPDYSKALLRRATAN 185
           + + + P +SK   R   A+
Sbjct: 65  ECININPSWSKGYNRLGAAH 84

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G +YF + D+ NA+K Y    ++K+ P     YSN +A    L    + I   
Sbjct: 396 AEEARLEGKDYFTKSDWPNAVKAY--TEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDL 198
            KA+E  P++ +A +R+ATA   ++ Y+ A+  L
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVQEYAAALETL 487

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 78/171 (45%), Gaps = 17/171 (9%)

Query: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSN 146
           +G P     D++TA      A++ K++GNE+ K KDY  A++ Y  A+       +F+SN
Sbjct: 22  SGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSN 77

Query: 147 MSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND 206
            +   + L+     +E S +A+EL     KA  RR  A+  L  +  A  DL V+     
Sbjct: 78  RALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKP 137

Query: 207 FNGA------TIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASF 251
            + A        E ML R   ++AI+       +  + +  L    S+ASF
Sbjct: 138 GDEAVRRALEVCERMLRRERFERAIRA------DGDEEQRRLCKTLSLASF 182

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKK-DPVFYSNMSACYVSLNELDKVIEMSTK 166
           A+E KD+GN++   KDY  A++ Y  A+ L     +F+SN +   + L+     +E S+K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           A+EL     K   RR  A   L+++  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 9/90 (10%)

Query: 98  NLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLN 155
           +LTAD       E K +GN  F  KDY+ A++ +  A+ + + P  V YSN SACY SL 
Sbjct: 2   SLTAD-------EYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLK 54

Query: 156 ELDKVIEMSTKALELKPDYSKALLRRATAN 185
           +    +  + + +++ P +SK   R   A+
Sbjct: 55  KFSDALNDANECVKINPSWSKGYNRLGAAH 84

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L    + I   
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAY--TEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDL 198
            KA+E  P++ +A +R+ATA   ++ Y+ A+  L
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVKEYASALETL 487

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL--- 168
           K +GN+++K + ++ A++ Y+ A  L KD  + +N +A      E +  I     A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 169 -ELKPDY---SKALLRRATANEQL 188
            E++ DY   SK+  R   A  +L
Sbjct: 326 REMRADYKVISKSFARIGNAYHKL 349

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 52/125 (41%), Gaps = 5/125 (4%)

Query: 391 YYHRGQLNFVTQDYVNAKNDFLKAKELDE--NNIFPYIQLACLSYREGDFEDCQNQFELA 448
           Y  +G   F  +DY  A   F KA E+ E  N++    + AC +  +  F D  N     
Sbjct: 8   YKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLK-KFSDALNDANEC 66

Query: 449 RKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALAR 508
            K  P   +    LG      GDLD A   Y+  + L+ + K+   G+  +    T  AR
Sbjct: 67  VKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQV--HRTQQAR 124

Query: 509 QPTPE 513
           Q  P+
Sbjct: 125 QAQPD 129

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 115 GNEYFKEKDYENALKFY-DFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173
           G EYF + D+ +A+K Y +  +    D   YSN +A    L      I+   KA+E+ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 174 YSKALLRRATANEQLENYSDAMFDLSVLSLNND--FNGATIEPMLERNLNKQAIKVLDQK 231
           + +A +R+ATA   ++ YS A+  L V    +    NG++I     R +++  +K   Q+
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSSI-----REIDQLYVKATQQR 513

Query: 232 SKNPSKNES 240
            +  + NES
Sbjct: 514 FQPANTNES 522

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KD++ A++ +  A+   ++P  V YSN S  Y SL + D+ +  +T
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + +++K D+SK   R   A+  L N  +A
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+ F  KD+E A+K Y  A+ ++  + VFY N +A Y S  + ++ +  +  A+ 
Sbjct: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158

Query: 170 LKPDYSKALLRRATANEQLENYSDAM 195
           + P YS+   R   A   L    +AM
Sbjct: 159 INPSYSRGYSRLGLAKYALGKPEEAM 184

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 98  NLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNE 156
           ++ +++  + A+E K++GN + KEK Y  A+++Y  A+ L     +F+SN +   + L+ 
Sbjct: 2   SIVSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDN 61

Query: 157 LDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
               +E   K++EL P   KA+ RR  +   L  +S A  DL  +
Sbjct: 62  FLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 20/155 (12%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A   KD+GN++ K++D++ A + Y  A+  + DP   +FYSN +   + L+     +   
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAI--ETDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSV--------LSLNNDFNGATIEPML 216
           T A+EL     KA  RR  AN  L N+  A  D ++        +   N F+  T E ++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNGFD--TCEKVI 124

Query: 217 ERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASF 251
                K+AI   D+K+   +  +S     TS++SF
Sbjct: 125 REERFKKAIGGSDEKTGGATICQS-----TSLSSF 154

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 372 ESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACL 431
            +N+ + +A++ DP  S  Y +R   N    +++NA ND   A EL+ +N+  Y +    
Sbjct: 27  RANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKAYHRRGLA 86

Query: 432 SYREGDFEDCQNQFELARKKFP 453
           +    +F+  +N F +  K  P
Sbjct: 87  NIGLLNFKSARNDFNIVLKYKP 108

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 101 ADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALI-LKKDPVFYSNMSACYVSLNELDK 159
           +D+  + A   KD+GN     +DY+ A++ Y  A+     DP++YSN S  Y+ +N+ + 
Sbjct: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189

Query: 160 VIEMSTKALELKPDYSKALLRRATANEQLENYSDAM 195
            I  +   + +  ++SKA +R A    Q   Y DA+
Sbjct: 190 AINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E KD+GN  F  K+Y+ A++ +  A+ + + P  V YSN SACY S  +  K +E + 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 166 KALELKPDYSKALLRRATAN 185
           + +++ P +SK   R   A+
Sbjct: 65  ECVKINPTWSKGYNRVGAAH 84

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 10/114 (8%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDPV---FYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++ +DP     YSN +A    L    + I   
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAY--TEMIARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS-----LNNDFNGATIE 213
             A+E  P++ +A +R+ATA   ++++  A+  L         LNN  N   I+
Sbjct: 447 NTAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREID 500

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 3/122 (2%)

Query: 391 YYHRGQLNFVTQDYVNAKNDFLKAKELDE--NNIFPYIQLACLSYREGDFEDCQNQFELA 448
           Y  +G   FV ++Y  A   F KA E+ E  N++    + AC + ++   +  ++  E  
Sbjct: 8   YKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECV 67

Query: 449 RKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALAR 508
            K  P   +    +G      GDLD A K Y+  + L+++ K+ H G++ +     A   
Sbjct: 68  -KINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGLSQVTRAQEARHS 126

Query: 509 QP 510
           QP
Sbjct: 127 QP 128

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 106 KWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEM 163
           K A E K +GN  F  KDY+ A+  +  A+ + + P  V YSN SA Y S  + ++ +  
Sbjct: 3   KTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 164 STKALELKPDYSKALLRRATANEQLENYSDA 194
           + + +++ P ++K   R+  A + L  Y +A
Sbjct: 63  ADECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 5/102 (4%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L      I   
Sbjct: 385 AEEARLEGKEYFTKADWPNAVKSY--TEMIKRAPDDARGYSNRAAALAKLMSFPDAISDC 442

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND 206
            KA+E  P + +A LR+AT    ++ ++ A+  L +    +D
Sbjct: 443 NKAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDLARERDD 484

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 99  LTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNEL 157
           + A   DK A+E K++GN   K +DY  A++ YD A+ L     V++SN + C++ L+  
Sbjct: 1   MGATDADK-ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNF 59

Query: 158 DKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
               +   KAL L P   KA  RR  A   L  +  A  DL+V+
Sbjct: 60  QCASQDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KDY+ A+  +  A+ + + P  V YSN SACY SL +    ++ + 
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 166 KALELKPDYSKALLRRATAN 185
           + +++ P +SK   R   A+
Sbjct: 65  ECVKINPSWSKGYNRVGAAH 84

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G +YF + D+ NA+K Y    ++K+ P     YSN +A    L    + I+  
Sbjct: 397 AEEARLEGKDYFTKGDWPNAVKAY--TEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDC 454

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDL 198
            KA+E  P++ +A +R+ATA   +  +S A+  L
Sbjct: 455 NKAIEKDPNFVRAYIRKATAQIAVREFSSALETL 488

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 3/86 (3%)

Query: 98  NLTAD--QKDKWAIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSL 154
           N+T D  +  + A  LK +GN+    KDYE A+K Y  A+  L  + V+++N +A Y SL
Sbjct: 88  NVTEDDTEASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSL 147

Query: 155 NELDKVIEMSTKALELKPDYSKALLR 180
            + D+ +E +  A+++ P YSK   R
Sbjct: 148 KKYDEAVEDANSAIKINPTYSKGYSR 173

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A +LK +GN+    KD+E A+K Y  A+ +L  + V+Y+N +A Y SL + ++ ++ +  
Sbjct: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAES 156

Query: 167 ALELKPDYSKALLR 180
           A+++ P YSK   R
Sbjct: 157 AIKVNPSYSKGYSR 170

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  K+YE A+  +  A+ +  +P  V YSN SACY SL +    +  + 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           +  ++ P +SK   R   A+  L +  +A
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 8/136 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDPV-FYSNMSACYVSLNELDKVIEMSTK 166
           A E + +G ++F +  + +A+K Y   +    D    YSN +A    L    + I    K
Sbjct: 392 AEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEK 451

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL-SLNNDF-NGATIEPMLERNLNKQA 224
           ALE  P++ KA +R+ATA   ++ YS A+  L +  S + +  NG+ I     R +N+  
Sbjct: 452 ALEKDPNFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNNGSNI-----REINQLY 506

Query: 225 IKVLDQKSKNPSKNES 240
            K   Q+ +  S NE+
Sbjct: 507 AKATQQRFEPASSNET 522

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 16/125 (12%)

Query: 83  FPAKENGEPDFTGVDNLTADQKD---KWAIELKDKGNEYFKEKDYENALKFYDFALILKK 139
            P  +  EP     +N+  D  D   K A   KD+GN+ +K   ++ A++ YD A  L  
Sbjct: 230 VPESKEKEPVAANPENMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWELHN 289

Query: 140 DPVFYSNMSACY-------VSLNELDKVIEMSTKALELKPDY---SKALLRRATANEQLE 189
           D  + +N +A          ++  L+  IE   K  EL+ DY   +KA  R   A E+L 
Sbjct: 290 DITYLNNKAAAQYEKGDYETTIKTLEDAIE---KGRELRADYKIIAKAFTRMGNAYEKLN 346

Query: 190 NYSDA 194
           +   A
Sbjct: 347 DLKKA 351

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 340 AQDLFNQSISASPRVNSYIY---LALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQ 396
           A DLF+++I  SP  N  +Y    A  ++ K   D  N   +E  K++P  S  Y   G 
Sbjct: 24  AVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALND-ANECTKINPTWSKGYNRVGA 82

Query: 397 LNFVTQDYVNAKNDFLKAKELDENN 421
            ++   D   A+  + KA ELD +N
Sbjct: 83  AHYGLGDLDEAEKSYKKALELDASN 107

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A++ KD+GN Y K +DY+ A++ Y  A+ L     +FYSN +  ++ L+     +     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           A++L  +  KA  RR  A   L  +  A  DL++L
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 98  NLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLN 155
           +LTAD       E K +GN  F  K+Y+ A++ +  A+ + + P  V +SN SACY SL 
Sbjct: 2   SLTAD-------EYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLK 54

Query: 156 ELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFD 197
           +    +  + + +++ P +SK   R   A+  L +  +A  D
Sbjct: 55  KFSDALNDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 5/96 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y    ++K+ P     YSN +A    L    + I   
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAY--TEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSV 200
            KA+E  P++ +A +R A A   ++ ++ A+  L V
Sbjct: 454 NKAIEKDPNFVRAYIRMAAAQIAVKEFAAALETLDV 489

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE-- 169
           K +GN+++K   ++ A++ Y+ A  L KD  + +N +A      + + VI     A+E  
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKG 325

Query: 170 --LKPDY---SKALLRRATANEQL 188
             ++ DY   SK+  R   A  +L
Sbjct: 326 RDMRADYKVISKSFARIGNAYHKL 349

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A++ K+KGNEY K+ DY++A++FY  A+ L     +++SN +  ++  +     +     
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           AL+L P   KA  RR  +   +  +  A  DL+V+
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 73/160 (45%), Gaps = 20/160 (12%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
            K +GN+    KDY  A++ Y  A+  L  + ++Y+N +A Y S+ E D  I+ + KA+E
Sbjct: 102 FKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIE 161

Query: 170 LKPDYSKALLRRATAN-------EQLENYS---DAMFDLSVLSLNNDFNGATIEPMLERN 219
           + P YSK   R A A        E LE Y    D   D +  ++  DF  A        N
Sbjct: 162 IDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMN 221

Query: 220 LNKQAIKVLDQKSKNPSKNESELPSN----TSMASFFSIF 255
           L K +    +     PS++  + P+N    + M    S+F
Sbjct: 222 LEKSSTTTPE-----PSRSAGQQPANPFAGSGMPDMSSLF 256

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 59/125 (47%), Gaps = 26/125 (20%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E KD+G EYFK+ DY +A + Y+ +L  + K  P   +  SN+ A  +   +   +I +S
Sbjct: 399 EFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIS 458

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203
           T AL+L P                      +SK + RRA A E +ENY  A     +L  
Sbjct: 459 TSALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIE 518

Query: 204 NNDFN 208
           NN FN
Sbjct: 519 NNIFN 523

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 96  VDNLTADQK--DKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVS 153
           ++ L A QK  ++ A  LK +GNE   E  YE A+K Y  A+   K+  +YSN S  Y  
Sbjct: 68  LNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSK 127

Query: 154 LNELDKVIEMSTKALELKPDYSKALLRRATA 184
           L   +  +  +T A+ + P +SKA  R   A
Sbjct: 128 LGRYEDAVNDATLAINIDPSFSKAYSRLGYA 158

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KDYE A + +  A+   + P  V YSN SAC+ SL + ++ +  + 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 166 KALELKPDYSKALLRRATA 184
           + +++ P +SK   R   A
Sbjct: 63  ECVKINPAWSKGYNRVGAA 81

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 8/136 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFY-DFALILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A E + +G EYF + D+ NA+K Y +      +D   YSN +A    L    + I+    
Sbjct: 401 AEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDM 460

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND--FNGATIEPMLERNLNKQA 224
           A+   P++ +A +R+ATA   +  ++ A+  L      +    NGA +     R +++  
Sbjct: 461 AISKDPNFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANV-----REIDQLY 515

Query: 225 IKVLDQKSKNPSKNES 240
           IK   Q+ +    NE+
Sbjct: 516 IKASQQRFQPQDPNET 531

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL--- 168
           K +GN+++K + ++ A++ Y+ A  L KD  + +N SA      + ++ I+  T+A+   
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQG 330

Query: 169 -ELKPDY---SKALLRRATANEQLENYSDAM 195
            E++ DY   SK+  R   A  +LE++  A+
Sbjct: 331 REMRADYKLISKSFARIGNAYLKLEDFKKAI 361

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 32/150 (21%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E + KG E FK+ DY  A+  Y+ +L  + +K P   +  SNM   Y+ + E  K ++++
Sbjct: 292 EFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLA 351

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203
             ALEL P+                     +SK ++R A A E  ENY+ A  +  +L  
Sbjct: 352 PLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVA 411

Query: 204 NNDFNGATIEPMLERNLNKQAIKVLDQKSK 233
               NG T E +++    ++  KVL+  SK
Sbjct: 412 ----NGITNEKVMDG--KRRCQKVLNPPSK 435

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A+E K++GN + KE++Y  A++ Y  A+ L  DP   +FYSN +   + L+         
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
            +AL L     KA  RR  AN  L  +  A  DL+V+
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 99  LTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNE 156
           LTAD       E K +GN  F  KD+  A++ +  A+ +   P  V YSN SA Y S  +
Sbjct: 3   LTAD-------EYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQ 55

Query: 157 LDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLS-VLSLNNDFNGA 210
             + +  +T+ +++ P +SK   R   A   L N  +A  +    L L+N+ N A
Sbjct: 56  FQEALNDATECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNNNKA 110

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 52/91 (57%), Gaps = 5/91 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ NA+K Y  + ++K+ P     YSN +A    L    + I+  
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAY--SEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 446

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAM 195
             A++  P++ +A +R+ATA   ++ Y++A+
Sbjct: 447 DNAIKKDPNFVRAYIRKATAQIAIKEYANAL 477

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 12/97 (12%)

Query: 332 FLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEAL-------KLD 384
           F   D   A +LF ++I  SP  N  +Y     ++++    S K F EAL       K++
Sbjct: 16  FTSKDFNKAIELFTKAIEVSPTPNHVLY-----SNRSAAYTSAKQFQEALNDATECVKIN 70

Query: 385 PNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
           P  S  Y   G   F   +   A+ ++ +A +LD NN
Sbjct: 71  PTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (45%), Gaps = 29/160 (18%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL-ILKKDP----VFYSNMSACYVSLNELDKVIEMS 164
           E KD+G E+FK  DY +A + Y+ +L  L ++     V YSN++A    + E  + +   
Sbjct: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203
             ALE+ P                      + K + RRA A E +ENY  A+ D   L  
Sbjct: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394

Query: 204 NNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELP 243
            N+FN      M  +   ++ +   + K+ +P+++ + +P
Sbjct: 395 KNNFNDKI---MGGKRRCQKVLNPTEPKATSPNRSPTPVP 431

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 59/154 (38%), Gaps = 32/154 (20%)

Query: 391 YYHRGQLNFVTQDYVNAKNDFLKA-KELDENN---IFPYIQLACLSYREGDFEDCQNQFE 446
           Y  RG   F   DYV+A  ++ K+   L +N+   I  Y  L    ++ G+++ C +  E
Sbjct: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335

Query: 447 LARKKFP---------------------VAPEIPTFLGEILADKGDLDLAAKQYEFGIRL 485
            A + FP                     + P+I T   E      + + A + Y+  I  
Sbjct: 336 SALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEK 395

Query: 486 ENTQKSIHVG-------IAPLIGKATALARQPTP 512
            N    I  G       + P   KAT+  R PTP
Sbjct: 396 NNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTP 429

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (52%), Gaps = 8/93 (8%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KD+E A+  Y  A+ +L  + ++Y+N +A + SL + D+ +  + KA+E
Sbjct: 96  LKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIE 155

Query: 170 LKPDYSKALLRRATAN-------EQLENYSDAM 195
           + P YSK   R   A        E LE Y   M
Sbjct: 156 IDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVM 188

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A + K +GN+ F  KDY  A++ +  A+ + + P  V +SN SACY S  +  K ++ + 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           + +++ P ++K   R   A+  L +  +A
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 50/94 (53%), Gaps = 5/94 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+  A++ Y    ++K++P     YSN +A    L      I   
Sbjct: 389 AEEARLQGKEYFTKADWPKAVEAY--TEMIKRNPNDARGYSNRAAALSKLMSFADAIRDC 446

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDL 198
            KA+E  P++ +A +R+AT    +++Y+ A+  L
Sbjct: 447 DKAIEKDPNFVRAYIRKATGQIAIKDYAGAIETL 480

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLNELDKVIEMST 165
           A E K +GN  F  KDY  A+  +  A+ + + P  V YSN SACY S  + ++ ++ + 
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 166 KALELKPDYSKALLRRATA 184
           + +++ P +SK   R   A
Sbjct: 63  ECVKISPSWSKGYNRVGAA 81

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFY-DFALILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A E + +G E+F + D+ NA+K Y +      +D   +SN +A    L    + IE   K
Sbjct: 380 AEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNK 439

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSV 200
           A+ + P++ +A +R+ATA   ++ ++ A+  L++
Sbjct: 440 AVSIDPNFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 12/101 (11%)

Query: 328 GIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEAL------ 381
           G   FL  D V A DLF ++I  S   N  +Y     ++++    SNK F+EAL      
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLY-----SNRSACYASNKKFEEALKDAEEC 64

Query: 382 -KLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
            K+ P+ S  Y   G   F       A+  + +A ELD +N
Sbjct: 65  VKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A ELK +GN+    K+YE A+K Y  A+ +L  + ++Y+N +A + SL E D+ I+ +  
Sbjct: 102 AEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAES 161

Query: 167 ALELKPDYSKALLR 180
           A+ + P Y +   R
Sbjct: 162 AISVDPSYFRGYSR 175

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKD-PVFYSNMSACYVSLNELDKVIEMSTK 166
           A+E K++GN+  K +DY  A++ Y  A+ L     +++SN +  ++ ++     I    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           ALE+ P   KA  RR  +   L  + +A  DL ++
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KDY+ A++ Y  A+ IL  + V+++N +A Y +    D+ ++ + +A++
Sbjct: 104 LKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIK 163

Query: 170 LKPDYSKALLRRATANEQLENYSDAM 195
           L P YSK   R A A    EN+ +++
Sbjct: 164 LDPAYSKGYSRLAYAKYVQENFEESL 189

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A+E K++GN Y KEK Y+ A+++Y  A+ L     +++SN +   + L+      E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           A+ L P   KA+ RR  +   L  +  A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A +LK KGN +FK  DYE A+ +Y+ A  L   +P+++SNM+   + L    + +    K
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 167 AL 168
            L
Sbjct: 101 GL 102

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 53/104 (50%), Gaps = 6/104 (5%)

Query: 101 ADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNEL 157
           AD K++ A+  K++GN Y KE++Y  A++ Y  A+ L  DP   +F+SN +   + L+  
Sbjct: 6   ADAKEQ-AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNF 62

Query: 158 DKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
              +     AL L P   KA  RR  ++  L     A  DL V+
Sbjct: 63  QSCMNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L++DPN S  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 294 YLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 353

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 354 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 383

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +   SF    +    LL+S E    +    +    ++G  + +RND   A D F 
Sbjct: 275 GCLYGMNNVSFYDPQKALNYLLKSLE----VDPNDSTTWYHLGRVHMIRNDYTAAYDAFQ 330

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 331 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 385

Query: 400 VTQDYVN-AKNDFLKAKELDENNIF 423
              + +N A + + +A  LD  N+ 
Sbjct: 386 TCNNQLNDALDAYKQAARLDPENVH 410

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A +LK +GN+    KDYE A+  Y  A+ +L  + ++Y+N +A + SL E D+ ++ +  
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161

Query: 167 ALELKPDYSKALLR 180
           A+ + P Y +   R
Sbjct: 162 AISIDPSYFRGYSR 175

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFALIL--KKDPVFYSNMSACYVSLNELDKVIEMSTKA 167
           ELK+ GN+ +KEK YE A+ ++  AL        + YSN +A ++ L    + +E     
Sbjct: 10  ELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNC 69

Query: 168 LELKPDYSKALLRRATA 184
           +EL P++ K   R   A
Sbjct: 70  VELAPNWDKGYSRVGVA 86

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 110 ELKDKGNEYFKEKDYENALKFY-DFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           E + +G ++F  ++Y  A+K Y +        PV + N +A +  L    +VI+   KA+
Sbjct: 431 EARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAI 490

Query: 169 ELKPDYSKALLRRATA 184
            + P Y KA +R+  A
Sbjct: 491 SVDPSYIKAYVRKGFA 506

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 101 ADQKDKWAIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDK 159
           ++ K K A  LK +GN+    K+Y++A+  Y  A+ I   +P +YSN +A Y  + +   
Sbjct: 91  SEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTN 150

Query: 160 VIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDL-SVLSLNND 206
            +  +  A++L P YSKA  R   A     N  DA+     VL L  D
Sbjct: 151 AVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 13/141 (9%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
            K +GN+    KD+  A++ Y  A+ IL  + ++Y+N +A + SL E ++ I+ +  A++
Sbjct: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163

Query: 170 LKPDYSKALLRRATAN-------EQLENYS---DAMFDLSVLSLNNDFNGATIEPMLERN 219
           + P YSK   R A A        E LE+Y    D   D +   +  D+   T +  +E +
Sbjct: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYE--TAKKRVEES 221

Query: 220 LNKQAIKVLDQKSKNPSKNES 240
           +N +  K  +Q       NES
Sbjct: 222 MNVEKSKTPEQGQGQQQTNES 242

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 98  NLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDP--VFYSNMSACYVSLN 155
           +LTAD       E K +GN  F  K Y+ A+  +  A+ + + P  V YSN SA Y S  
Sbjct: 2   SLTAD-------EYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQ 54

Query: 156 ELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDA 194
           + ++ ++ + +  ++ P ++K   R   A+  + N  DA
Sbjct: 55  KFNEALKDALECTKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A E + +G EYF + D+ +A+K Y    ++K+ P     YSN +A    L      I   
Sbjct: 385 AEEARLEGKEYFTKGDWPSAVKAY--TEMIKRAPEDARGYSNRAAALSKLMSFPDAISDC 442

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDL 198
            KA+E  P++ +A +R+ATA   ++++S A+  L
Sbjct: 443 NKAIEKDPNFVRAYIRKATAQIAVKDFSYAIETL 476

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 12/89 (13%)

Query: 340 AQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK-------LDPNCSPIYY 392
           A DLF ++I  S   N  +Y     ++++    S + F+EALK       ++P+ +  Y 
Sbjct: 24  AVDLFTKAIEVSETPNHVLY-----SNRSASYASEQKFNEALKDALECTKINPSWAKGYT 78

Query: 393 HRGQLNFVTQDYVNAKNDFLKAKELDENN 421
             G  +F   +  +A+  + KA ELD NN
Sbjct: 79  REGAAHFGMGNLDDAEASYKKALELDANN 107

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (47%), Gaps = 7/140 (5%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +   SF    +   +LL+S E    I    A +  ++G  + +RND  +A D F 
Sbjct: 327 GCLYGMNNVSFYDPQKALNLLLKSLE----IDSTDATSWYHLGRIHMIRNDYTSAYDAFQ 382

Query: 346 QSISASPRVNS-YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDY 404
           Q+++   R  + +  + ++     +  ++   +  A++L+P  S ++Y  G L     + 
Sbjct: 383 QAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQ 442

Query: 405 VN-AKNDFLKAKELDENNIF 423
           VN A + + +A  LD NN+ 
Sbjct: 443 VNDALDAYKQAARLDPNNVH 462

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 7/93 (7%)

Query: 380 ALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFE 439
           +L++D   +  +YH G+++ +  DY +A + F +A   D  N   +  +  L Y+   + 
Sbjct: 350 SLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYR 409

Query: 440 DCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
           D  + +  A +  P       ++ E+  D G L
Sbjct: 410 DALDAYTRAIRLNP-------YISEVWYDLGTL 435

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A +LK +GN+    KDYE A+  Y  A+ +L  + ++Y+N +A + SL   D+ +E +  
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAES 161

Query: 167 ALELKPDYSKALLR 180
           A+ + P Y +   R
Sbjct: 162 AISIDPTYFRGYSR 175

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KDYE A+K Y  A+ ++  + V+Y+N +A + SL   D+ I+ +  A++
Sbjct: 96  LKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVK 155

Query: 170 LKPDYSKALLR 180
           +   YSK   R
Sbjct: 156 VDSSYSKGYSR 166

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A +LK +GN+    KDYE A+  Y  A+ +L  + ++Y+N +A + SL E D+ ++ +  
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAES 161

Query: 167 ALELKPDYSKALLR 180
           ++ + P Y +   R
Sbjct: 162 SISIDPSYFRGYSR 175

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 97  DNLTADQKDKWAIE-LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSL 154
           D L  D++ K   E LK +GN+    KD++ A+  Y  A+ I   + ++Y+N +A Y SL
Sbjct: 87  DELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSL 146

Query: 155 NELDKVIEMSTKALELKPDYSKALLR 180
            + +K  E +  A+ + P+YSK   R
Sbjct: 147 KDFEKATEDAESAIRVDPNYSKGYSR 172

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L++DP+ +  +YH G+++ V  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 303 YLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 362

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 363 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 392

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 61/145 (42%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F    +    LL+S E    +    A    ++G  + +R+D   A D F 
Sbjct: 284 GCLYGMNNVQFYDPQKALNYLLKSLE----VDPSDATTWYHLGRVHMVRSDYTAAYDAFQ 339

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQL-N 398
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 340 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 394

Query: 399 FVTQDYVNAKNDFLKAKELDENNIF 423
                  +A + + +A  LD  NI 
Sbjct: 395 TCNNQLTDALDAYKQAARLDPENIH 419

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 1/103 (0%)

Query: 100 TADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELD 158
            +D+    A+E K++GN + K K++  A + Y  A+ L     +++SN +  ++ L+   
Sbjct: 4   ASDEDVNKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQ 63

Query: 159 KVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
             +    KA+EL P   KA  RR  +   L  ++ A  DL ++
Sbjct: 64  TALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 111 LKDKGNEYFKEKDYENA-LKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KD+E A LK+ +   +L  + V+Y+N +A + SL + ++ ++ +  A++
Sbjct: 100 LKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIK 159

Query: 170 LKPDYSKALLR 180
           + P YSK   R
Sbjct: 160 VNPSYSKGYSR 170

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 8/93 (8%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KDY  A++ Y+ A+ ++    V+Y+N +A Y S  + D+ I+ +  A++
Sbjct: 106 LKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165

Query: 170 LKPDYSKALLR-------RATANEQLENYSDAM 195
           ++P++SK   R       +  + E LE Y  A+
Sbjct: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKAL 198

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 54/97 (55%), Gaps = 5/97 (5%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           A+ELK++GN++ KEK Y  A ++Y  A  ++ DP   + YSN +   + L+     ++ +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKA--IEHDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 165 TKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
            +A+EL  +  KA  RRA +   L  +  A  DL ++
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 52/120 (43%)

Query: 369 EKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQL 428
           + DE+ + FD+A KLDPN    Y  +G        Y  AK  + KA   D ++   Y  +
Sbjct: 605 DHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGM 664

Query: 429 ACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENT 488
              S + G++E     FE AR   P    +    G  +   G+ + A   YE   +++ T
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 114 KGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKP 172
           +GN+    K ++ A++ Y  A+ +   + V+YSN +A Y SL + ++ ++ + +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 173 DYSKALLR 180
            YSK   R
Sbjct: 161 TYSKGFSR 168

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 54/115 (46%), Gaps = 28/115 (24%)

Query: 109 IELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEM 163
           IE K +G+E FK  DY +AL+ Y+ +L  + +  P   + YSN+ A  + + E  K IE 
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 164 STKALELKPD-----------------------YSKALLRRATANEQLENYSDAM 195
              AL L P                        +SK ++R+A + E LENY  A+
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L++DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 292 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 351

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 352 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 381

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 62/145 (42%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F    +    LL+S E    +    A    ++G  + +R+D   A D F 
Sbjct: 273 GCLYGMNNVQFYDPQKALNYLLKSLE----VDPSDATTWYHLGRVHMIRSDYTAAYDAFQ 328

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQL-N 398
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 329 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 383

Query: 399 FVTQDYVNAKNDFLKAKELDENNIF 423
                  +A + + +A  LD +N+ 
Sbjct: 384 TCNNQLTDALDAYRQASRLDPDNVH 408

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 26/112 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K KG+ +FK  DY N+L+ Y+ +L  +    P   +  SN+ A  + + E  K IE S
Sbjct: 376 EFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENS 435

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195
           + AL L P                      + K ++RRA + E LE++S+A+
Sbjct: 436 SMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           +  ++L++DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 292 FLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 351

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 352 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 381

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K++G E FK  DY  AL+ Y  +L  +  K P   +  SN+ A      E  K IE+S
Sbjct: 396 EFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIS 455

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195
           T ALE  P                      + K +L+RA A E +E+Y +A+
Sbjct: 456 TSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KD++ A+K Y  A+ +L  + V+Y+N +A + S+   ++ I+ +  A++
Sbjct: 100 LKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159

Query: 170 LKPDYSKALLRRATANEQLENYSDAM 195
             P YSK   R   A   L    DA+
Sbjct: 160 TDPTYSKGYSRLGYAKFALGQAEDAL 185

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A+E K++GN + KEK +  A++ Y  A+ L     +++SN +  +  ++     +    +
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           AL+L P   KA  RRA +   L  +  A  DL+VL
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L+ DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 284 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 343

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 344 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 373

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y ++   F    +    LL+S E         A    ++G  + +R D   A D F 
Sbjct: 265 GCLYGMSNVQFYDPQKALDYLLKSLE----ADPSDATTWYHLGRVHMIRTDYTAAYDAFQ 320

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 321 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 375

Query: 400 VTQDYV-NAKNDFLKAKELDENNIF 423
              + + +A + + +A  LD NN+ 
Sbjct: 376 TCNNQLSDALDAYKQAARLDVNNVH 400

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L+ DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 288 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 347

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 348 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 377

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 65/145 (44%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y ++   F    +    LL+S E   + +  +     ++G  + +R D   A D F 
Sbjct: 269 GCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWY----HLGRVHMIRTDYTAAYDAFQ 324

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 325 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 379

Query: 400 VTQDYV-NAKNDFLKAKELDENNIF 423
              + + +A + + +A  LD NNI 
Sbjct: 380 TCNNQLSDALDAYKQAARLDVNNIH 404

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 66/135 (48%), Gaps = 14/135 (10%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILK--KDPV---FYSNMSACYVSLNELDKVIEMST 165
            K++ N+ +K K ++ A + Y   + +K   D V    ++N++AC + +    + I +  
Sbjct: 81  FKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQ 140

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA----MFDLSVLSLNNDFNGATIEPMLERN-- 219
           KAL+  P   K   R A A  QL    +A     F L++ S N      T+E +++R   
Sbjct: 141 KALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSLQ--TLEGVIDRKQQ 198

Query: 220 -LNKQAIKVLDQKSK 233
            L++  +K L++K K
Sbjct: 199 ELHEAEVKRLEEKQK 213

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L+ DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 286 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 345

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 346 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 375

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y ++   F    +    LL+S E         A    ++G  + +R D   A D F 
Sbjct: 267 GCLYGMSNVQFYDPQKALDYLLKSLE----ADPSDATTWYHLGRVHMIRTDYTAAYDAFQ 322

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 323 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 377

Query: 400 VTQDYV-NAKNDFLKAKELDENNIF 423
              + + +A + + +A  LD NN+ 
Sbjct: 378 TCNNQLSDALDAYKQAARLDVNNVH 402

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 7/93 (7%)

Query: 380 ALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFE 439
           +L++DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+   + 
Sbjct: 297 SLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYR 356

Query: 440 DCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
           D  + +  A +  P       ++ E+  D G L
Sbjct: 357 DALDAYTRAIRLNP-------YISEVWYDLGTL 382

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L++DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 286 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 345

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 346 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 375

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 67/154 (43%), Gaps = 17/154 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F    +    LL+S E    +    A    ++G  + +R+D   A D F 
Sbjct: 267 GCLYGMNNVQFYDPQKALSYLLKSLE----VDPSDATTWYHLGRVHMIRSDYTAAYDAFQ 322

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 323 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALD----AYTRAIRLNPYISEVWYDLGTLYE 377

Query: 400 VTQDYV-NAKNDFLKAKELDENNIFPYIQLACLS 432
              + + +A + + +A  LD  NI    +L  L+
Sbjct: 378 TCNNQLSDALDAYKQAARLDPENIHIRKRLETLT 411

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 26/124 (20%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E   +G+ +FK  DY +AL+ Y+ +L  + +  P   + YSN++A  + + E   +++ +
Sbjct: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203
            KAL+L P                      +SK +LR+A A E LEN+  A      L  
Sbjct: 419 DKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIE 478

Query: 204 NNDF 207
           NN F
Sbjct: 479 NNVF 482

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L+ DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 278 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 337

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 338 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 367

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y ++   F    +    LL+S E         A    ++G  + +R D   A D F 
Sbjct: 259 GCLYGMSNVQFYDPQKALDYLLKSLE----ADPSDATTWYHLGRVHMIRTDYTAAYDAFQ 314

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 315 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 369

Query: 400 VTQDYV-NAKNDFLKAKELDENNIF 423
              + + +A + + +A  LD NN+ 
Sbjct: 370 TCNNQLSDALDAYKQAARLDVNNVH 394

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 112 KDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALEL 170
           K++GN  FKE  Y+ A + Y   + I  ++P+ YSN +   + L    +V+E+  K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 171 KPDYSKALLRR 181
            P+ +  + ++
Sbjct: 67  TPNTTDTVYKK 77

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A+E K++GN + KEK +  A++ Y  A+ L     +++SN +  +  ++     +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           A++L P   KA  RRA +   L  +  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK KGN +FK+ DYE A+ +Y  A+     +P+ YSN +   + L +  + ++   K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 170 L 170
           +
Sbjct: 67  M 67

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 1/127 (0%)

Query: 362 LISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
           L+S  K+  D + K F++A +LDPN +  Y  +G  +       +AK  + KA   D  +
Sbjct: 560 LLSLQKDH-DAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQH 618

Query: 422 IFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEF 481
              Y  L   S + G +E+    FE AR   PV   +    G  L   G  + A + YE 
Sbjct: 619 YNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYEL 678

Query: 482 GIRLENT 488
              L+ T
Sbjct: 679 ACHLQPT 685

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A+E K++GN + KEK +  A++ Y  A+ L     +++SN +  +  ++     +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           A++L P   KA  RRA +   L  +  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 1/127 (0%)

Query: 362 LISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
           L+S  K+  D + K F++A +LDPN +  Y  +G  +       +AK  + KA   D  +
Sbjct: 542 LLSLQKDH-DAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQH 600

Query: 422 IFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEF 481
              Y  L   S + G +E+    FE AR   PV   +    G  L   G  + A + YE 
Sbjct: 601 YNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYEL 660

Query: 482 GIRLENT 488
              L+ T
Sbjct: 661 ACHLQPT 667

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169
           LK +GN+    KD+E+A+  Y  A+  L  + V+++N +A Y SL +  + +E +  A++
Sbjct: 101 LKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK 160

Query: 170 LKPDYSKALLR 180
           + P YSK   R
Sbjct: 161 VNPSYSKGYSR 171

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 15/102 (14%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACY-------VSLNELDK 159
           A+E KD+GN++ K++D+  A + Y  A+ L     +F+SN +  +       +SLN+ DK
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 160 VIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
            +E+ +K +       KA  RR  +   L  +  A  DL  +
Sbjct: 72  ALELDSKNI-------KAYHRRGLSYVGLLEFKKARTDLKTV 106

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 26/112 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E +++G +YFK  DY ++ + Y+ +L  +    P   + YSN+ A  + + E  K ++ S
Sbjct: 405 EFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNS 464

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195
           + ALE+ PD                     + K  LR+A A E +E++  A+
Sbjct: 465 SSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAAL 516

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K KG   FK  DY N+L+ Y+ +L  +    P   +  SN+ A  + + E  K IE S
Sbjct: 376 EFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENS 435

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195
           + ALEL P                      + K ++RRA + E LE++  A+
Sbjct: 436 SMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 37.4 bits (85), Expect = 0.019,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKALEL 170
           K++GNE +K+  Y +A+  YD  +  + ++PV +SN +   + L E  + IE   + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 171 KPDYSKALLR 180
                 A LR
Sbjct: 68  AASPQHAALR 77

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 6/118 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKDP-----VFYSNMSACYVSLNELDKVIEMST 165
            K++GNE +K K Y++A + Y+  + +K D        +SN +AC + L    + +    
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 166 KALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQ 223
           +AL+  P   K   R A A   L+   DA   +    L  D   A ++ +L++ + ++
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQKVIKRE 197

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 64/140 (45%), Gaps = 7/140 (5%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F        +LL+S E    +    A    ++G  + +RND   A D F 
Sbjct: 347 GCLYGMNNVQFYDPQTALNLLLKSLE----VDSTDATTWYHLGRIHMVRNDYTAAYDAFQ 402

Query: 346 QSISASPRVNS-YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDY 404
           Q+++   R  + +  + ++    ++  ++   +  A++L+P  S ++Y  G L     + 
Sbjct: 403 QAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQ 462

Query: 405 VN-AKNDFLKAKELDENNIF 423
           +N A + + +A  LD NN+ 
Sbjct: 463 LNDALDAYKQAARLDPNNVH 482

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 379 EALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDF 438
           ++L++D   +  +YH G+++ V  DY  A + F +A   D  N   +  +  L Y+   +
Sbjct: 369 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 428

Query: 439 EDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
            D  + +  A +  P       ++ E+  D G L
Sbjct: 429 RDALDAYTRAIRLNP-------YISEVWYDLGTL 455

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           +  ++L+++P+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 264 FLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 323

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 324 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 353

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 17/144 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F    +    LL+S E    ++   A    ++G  + +R+D   A D F 
Sbjct: 245 GCLYGMNTVQFYDPQKALNFLLKSLE----VNPSDATTWYHLGRVHMIRSDYTAAYDAFQ 300

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQL-N 398
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 301 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 355

Query: 399 FVTQDYVNAKNDFLKAKELDENNI 422
                  +A + + +A  LD  N+
Sbjct: 356 TCNNQLTDALDAYKQAARLDPENV 379

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 26/125 (20%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E +  G E+FK+ DY++AL  Y  +L  + +K P   + YSN+ A  + + E  + ++  
Sbjct: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203
             ALEL P                      + K +LR+A A E +E Y  A     +L  
Sbjct: 608 DVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLH 667

Query: 204 NNDFN 208
            N FN
Sbjct: 668 KNVFN 672

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%)

Query: 382 KLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDC 441
           ++DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+   + D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 442 QNQFELARKKFPVAPEIPTFLGEI 465
            + +  A +  P   E+   LG +
Sbjct: 367 LDAYTRAIRLNPYISEVWYDLGTL 390

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K KG   FK  DY N+L+ Y+ +L  +  K P   +  SN+ A  + + E  K IE S
Sbjct: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195
             AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKD-----PVFYSNMSACYVSLNELDKVIEMST 165
            K +GNE +K K +++A + Y   L ++ +        Y+N +AC + L    + IE  +
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           KAL + P   K   R + A  QL    +A
Sbjct: 146 KALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKD-----PVFYSNMSACYVSLNELDKVIEMST 165
            K++GN+ +K K + +A + Y+ A+ +K D        Y+N +AC + L    + I    
Sbjct: 77  FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCK 136

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
            AL L P   K   R A A   +E + D 
Sbjct: 137 MALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 335 NDLVTAQDLFNQSISASP-RVNSYIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYH 393
           +D V + +L N  +   P +  ++  +  + + + + D + K F++A +LDPN +  Y  
Sbjct: 520 HDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTL 579

Query: 394 RGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELARKKFP 453
           +G  +       +AK  + KA   D  +   Y  L   + + G +E+    FE AR   P
Sbjct: 580 QGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINP 639

Query: 454 VAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENT 488
           V   +    G  L   G  + A + YE    L+ T
Sbjct: 640 VNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F        +LL+S E    +    A    ++G  + +RND   A D F 
Sbjct: 277 GCLYGMNNVQFYDPQTALNLLLKSLE----VDSTDATTWYHLGRIHMVRNDYTAAYDAFQ 332

Query: 346 QSISASPRVNS-YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQL-NFVTQD 403
           Q+++   R  + +  + ++    ++  ++   +  A++L+P  S ++Y  G L       
Sbjct: 333 QAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQ 392

Query: 404 YVNAKNDFLKAKELDENNIF 423
             +A + + +A  LD NN+ 
Sbjct: 393 LTDALDAYKQAARLDPNNVH 412

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 379 EALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDF 438
           ++L++D   +  +YH G+++ V  DY  A + F +A   D  N   +  +  L Y+   +
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 358

Query: 439 EDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
            D  + +  A +  P       ++ E+  D G L
Sbjct: 359 RDALDAYTRAIRLNP-------YISEVWYDLGTL 385

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           ELK KGN  FK   Y  A+ +Y+  + I   +P+ YSN +   +  +  D+ I    K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 169 EL 170
           +L
Sbjct: 65  QL 66

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKDPVF-----YSNMSACYVSLNELDKVIEMST 165
            K +GNE +K K +++A + Y   L ++ +  F     ++N +AC + L    + IE  +
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           KAL + P  +K   R + A  QL    +A
Sbjct: 146 KALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 84/221 (38%), Gaps = 36/221 (16%)

Query: 269 DADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVG 328
           D   +  N LK+L  A+            K ME+Y  LL    DK               
Sbjct: 494 DMSLKYFNRLKDLQPARV-----------KDMEIYSTLLWHLHDK--------------- 527

Query: 329 IFNFLRNDLVTAQDLFNQSISASP-RVNSYIYLALISADKNEKDESNKYFDEALKLDPNC 387
                    V + +L N  +   P +  ++  +  + + + + D + K F++A +LDPN 
Sbjct: 528 ---------VKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNF 578

Query: 388 SPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFEL 447
           +  Y  +G  +       +AK  + KA   D  +   Y  L   S + G +E+    FE 
Sbjct: 579 AYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEK 638

Query: 448 ARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENT 488
           AR   PV   +    G  L   G  +   + YE   +L+ T
Sbjct: 639 ARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQPT 679

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 382 KLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDC 441
           + DP+ +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+   + D 
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 338

Query: 442 QNQFELARKKFPVAPEIPTFLGEILADKGDL 472
            + +  A +  P       ++ E+  D G L
Sbjct: 339 LDAYTRAIRLNP-------YISEVWYDLGTL 362

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y  ++L++D   +  +YH G+++ +  DY  A + F +A   D  N   +  +  L Y+ 
Sbjct: 299 YLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 358

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 359 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 388

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 65/145 (44%), Gaps = 17/145 (11%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +   SF    +    LL+S E    +  + A    ++G  + +RND   A D F 
Sbjct: 280 GCLYGMNNVSFYDPQKALGYLLKSLE----VDSQDATTWYHLGRVHMIRNDYTAAYDAFQ 335

Query: 346 QSISASPRVNSYIYLAL------ISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNF 399
           Q+++   R N   + ++      IS  ++  D     +  A++L+P  S ++Y  G L  
Sbjct: 336 QAVNRDSR-NPIFWCSIGVLYYQISQYRDALDA----YTRAIRLNPYISEVWYDLGTLYE 390

Query: 400 VTQDYVN-AKNDFLKAKELDENNIF 423
              + +N A + + +A  LD  NI 
Sbjct: 391 TCNNQLNDALDAYKQAARLDPENIH 415

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 36.2 bits (82), Expect = 0.049,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLN 155
           LK +GN  ++++DY  AL++YD  L     +P+ +SN + C + LN
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLN 52

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F  +     +LL+S E    +    A    ++G  + +RND   A D F 
Sbjct: 281 GCLYGMQNVQFYDTQTALNLLLKSLE----VDSTDATTWYHLGRIHMVRNDYTAAYDAFQ 336

Query: 346 QSISASPRVNS-YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQL-NFVTQD 403
            +++   R  + +  + ++    ++  ++   +  A++L+P  S ++Y  G L       
Sbjct: 337 HAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQ 396

Query: 404 YVNAKNDFLKAKELDENNIF 423
             +A + + +A  LD NN+ 
Sbjct: 397 LTDALDAYKQAARLDTNNVH 416

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 379 EALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDF 438
           ++L++D   +  +YH G+++ V  DY  A + F  A   D  N   +  +  L Y+   +
Sbjct: 303 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQY 362

Query: 439 EDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
            D  + +  A +  P       ++ E+  D G L
Sbjct: 363 RDALDAYTRAIRLNP-------YISEVWYDLGTL 389

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F  +     +LL+S E    +    A    ++G  + +RND   A D F 
Sbjct: 285 GCLYGMQNVQFYNTQTALNLLLKSLE----VDSTDATTWYHLGRIHMVRNDYTAAYDAFQ 340

Query: 346 QSISASPRVNS-YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQL-NFVTQD 403
            +++   R  + +  + ++    ++  ++   +  A++L+P  S ++Y  G L       
Sbjct: 341 HAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQ 400

Query: 404 YVNAKNDFLKAKELDENNIF 423
             +A + + +A  LD NN+ 
Sbjct: 401 LTDALDAYKQAARLDTNNVH 420

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 379 EALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDF 438
           ++L++D   +  +YH G+++ V  DY  A + F  A   D  N   +  +  L Y+   +
Sbjct: 307 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQY 366

Query: 439 EDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
            D  + +  A +  P       ++ E+  D G L
Sbjct: 367 RDALDAYTRAIRLNP-------YISEVWYDLGTL 393

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILKKDPV-----FYSNMSACYVSLNELDKVIE 162
           A   K++GN+ +K K +++A   Y  AL +K D +      Y N++AC + +      I 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 163 MSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNGA 210
              +AL+L     KA  R   A  +L  + D++  + V    +  NGA
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGA 177

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 75/192 (39%), Gaps = 22/192 (11%)

Query: 379 EALKLDPNCSPIYYHR---------GQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLA 429
           +A++L  NC P +  +         G+L++   +Y  A   F++  EL    I      +
Sbjct: 465 KAIRLFHNCIPDHIVKNMPWCLAQLGKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFS 524

Query: 430 CLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQ 489
            L +   D++   +  +     +P  PE    +G  L+ K D + A + +E   +++   
Sbjct: 525 TLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKID--- 581

Query: 490 KSIHVGIAPLIGKATALARQPTPEN--FSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEE 547
                   P    A  L       N  F  A K  + A+  DPR   A  G+    ++  
Sbjct: 582 --------PKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLG 633

Query: 548 DVDTAIELFEKA 559
             D A+  FEKA
Sbjct: 634 HYDEALLYFEKA 645

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 4/128 (3%)

Query: 359 YLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELD 418
           YL+L    K + +++ + F++A K+DP  +  Y  +G        +  AK  F KA   D
Sbjct: 560 YLSL----KKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACD 615

Query: 419 ENNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQ 478
             +   Y  +   S + G +++    FE AR+ +P+   +    G  L      D A + 
Sbjct: 616 PRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEY 675

Query: 479 YEFGIRLE 486
           YE    L+
Sbjct: 676 YELACTLQ 683

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 76/182 (41%), Gaps = 3/182 (1%)

Query: 307 LESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPR-VNSYIYLALISA 365
           +E+ E    I  KFA A    G      +    A+  F ++I+  PR  N+Y  + + S 
Sbjct: 571 IEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSM 630

Query: 366 DKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLK-AKELDENNIFP 424
                DE+  YF++A ++ P  + +    G +     +Y +   ++ + A  L  N+   
Sbjct: 631 KLGHYDEALLYFEKARQIYPINAVLICCCG-VALEKLEYQDKALEYYELACTLQPNSNLA 689

Query: 425 YIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIR 484
             + A L Y  G +      FE   K  P  P +   LG++    G  + A +++   + 
Sbjct: 690 RFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEAIREFTVAMN 749

Query: 485 LE 486
           L+
Sbjct: 750 LD 751

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           E K +GN  FK  DY  A KFYD  ++ +  +P+ YSN +   +     D+ I      L
Sbjct: 5   ENKTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

Query: 169 ELKPDYSKALLRR 181
               D     ++R
Sbjct: 65  LYSSDPEHEAIKR 77

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 75/185 (40%), Gaps = 1/185 (0%)

Query: 303 YKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRV-NSYIYLA 361
           YK+ L   E    I       LE      +  +D V   +L N+ I   P    ++  L 
Sbjct: 442 YKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNLANELIDNFPEAAQTWCVLG 501

Query: 362 LISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
              + + + DE+ K F++A +LDP  +  Y  +G      + +  A+  + KA   D  +
Sbjct: 502 NHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQH 561

Query: 422 IFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEF 481
              Y  L     + G+ +     FE AR   PV   +    G  L    + +LA K Y+F
Sbjct: 562 YNAYYGLGTCDSQNGNHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYDF 621

Query: 482 GIRLE 486
             +L+
Sbjct: 622 ASKLQ 626

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 110 ELKDKGNEYFKEKDYENALKFY-DFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
            L+ KGN+ + + +YE A+ +Y + +L    +PV  +NMS   + L   +  +    +AL
Sbjct: 10  HLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRAL 69

Query: 169 EL 170
           E+
Sbjct: 70  EI 71

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 65/140 (46%), Gaps = 7/140 (5%)

Query: 287 GC-YEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFN 345
           GC Y +    F        +LL+S E   T +  +     ++G  + +RND   A D F 
Sbjct: 281 GCLYGMNNVQFYDPQTALNLLLKSLEADSTDATTW----YHLGRIHMVRNDYTAAYDAFQ 336

Query: 346 QSISASPRVNS-YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDY 404
           Q+++   R  + +  + ++    ++  ++   +  A++L+P  S ++Y  G L     + 
Sbjct: 337 QAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQ 396

Query: 405 V-NAKNDFLKAKELDENNIF 423
           + +A + + +A  LD NN+ 
Sbjct: 397 LSDALDAYKQAVRLDPNNVH 416

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 379 EALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDF 438
           ++L+ D   +  +YH G+++ V  DY  A + F +A   D  N   +  +  L Y+   +
Sbjct: 303 KSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 362

Query: 439 EDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
            D  + +  A +  P       ++ E+  D G L
Sbjct: 363 RDALDAYTRAIRLNP-------YISEVWYDLGTL 389

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKD-----PVFYSNMSACYVSLNELDKVIEMST 165
            K++GNE++K K Y +A + Y   + +K D        Y+N +AC + L    K IE   
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 166 KALELKPDYSKALLRRATA 184
           KAL       K   R   A
Sbjct: 137 KALSFNVKNIKCYYRMGKA 155

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.4 bits (80), Expect = 0.081,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           K++GN  FK+  Y  A+  YD  +  + ++PV YSN +   + L E  + I+M  + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTK 166
           A E K++GN   KEK +  A++ Y  A+ L     +++SN +  +  ++     +    +
Sbjct: 12  AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDE 71

Query: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           A++L P   KA  RRA +   L  +  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 92/237 (38%), Gaps = 23/237 (9%)

Query: 379 EALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDF 438
           ++L+LDP  S  +Y+ G+++   +D+  A     +A   D  N   +  +  L Y+ G  
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 439 EDCQNQFELARKKFPVAPEIPTFLGEILADKGD-LDLAAKQYEFGIRLENTQKSIHVGIA 497
            D  + +  A +  P   E+   LG +     D +  A   YE  + L+     I     
Sbjct: 465 HDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYERALSLDPENPVIQ---- 520

Query: 498 PLIGKATALARQPT-----PENFSEASKLLQDAVE--KDPRSEQAIVGLAQLKLQ---EE 547
              G+  AL  Q       P N   +  L   ++    +P+    I  +A+  LQ   + 
Sbjct: 521 ---GRLNALKIQDKKSEYDPNNVVPSKNLHPSSLSNLNNPQPIVDISTMARPVLQVNTQG 577

Query: 548 DVDTAIELFEKASDYSRSMDEKLQAT-----TFAEAAKVQKRIRADPVIKAKVEETL 599
            VD  I   E   D+  S D  + ++       +++     ++ A  + K K   +L
Sbjct: 578 TVDNTIMKRESEKDFFHSSDPNMSSSNTPLNNISQSGMPNTKLEAADITKDKPSNSL 634

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 98  NLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNE 156
           N+T+ +KDK       +GN  FK+  Y  A+  YD  +  + ++PV YSN +   + L E
Sbjct: 4   NMTSFEKDK------QQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGE 57

Query: 157 LDKVIEMSTKALE 169
             + I+   + L+
Sbjct: 58  HAQAIQACQQGLQ 70

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
            K +GN+YFKE +Y +A+K Y+  + I  ++P+ YSN +   +  N+  + +      L
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 106 KWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV---FYSNMSACYVSLNELDKVIE 162
           K A +LK+KGNE  K K Y  A+  Y  A+ L   P    +Y+N +  Y+  N  D  I 
Sbjct: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY--PTNFNYYNNRALAYIKANNFDHAII 189

Query: 163 MSTKALE----LKPDYSKALLRRATANEQLENYSDAM 195
            + K++E    + P   KA  R   A  ++ +Y  ++
Sbjct: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 25/111 (22%)

Query: 110 ELKDKGNEYFKEKDYENALKFYD--FALILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K+ G +YF   DY NAL  ++  F  +  K P   +  SN+ +C + L E  K +E  
Sbjct: 335 EFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKALESV 394

Query: 165 TKALELK---PDYS-----------------KALLRRATANEQLENYSDAM 195
             AL+L    P+ S                 K  L+ A   E LENY  A+
Sbjct: 395 KLALDLSDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKAL 445

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 53/132 (40%), Gaps = 18/132 (13%)

Query: 92  DFTGVDNLTADQKDKWAIE---------LKDKGNEYFKEKDYENALKFYDFALIL----- 137
           D  G  N+T D     A E          K +GNE +K K Y NA   Y+  + +     
Sbjct: 49  DGNGGSNVTLDALKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNND 108

Query: 138 KKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAM-- 195
           K + + + N +AC + +      I    KAL   P   K   R A A   +E Y ++   
Sbjct: 109 KINELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRES 168

Query: 196 --FDLSVLSLNN 205
             F L V S N+
Sbjct: 169 IEFGLKVDSRNS 180

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 80/192 (41%), Gaps = 5/192 (2%)

Query: 335 NDLVTAQDLFNQSISASP-RVNSYIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYH 393
           +D +    L N+ +   P +  ++  L  + + + + DE+ +YF++A ++DP+ +  Y  
Sbjct: 489 HDKINLSHLSNELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTL 548

Query: 394 RGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELARKKFP 453
           +G  +        AK  + KA   D  +   Y  L     + G +E+    FE AR   P
Sbjct: 549 QGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINP 608

Query: 454 VAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALARQPTP- 512
           V   +    G  L      + A + YE    L+ +        A L+     +AR     
Sbjct: 609 VNVILICCCGVALEKMSYQEKALQYYELASELQPSSSLAKFKKAHLL---YVMARYSVAL 665

Query: 513 ENFSEASKLLQD 524
           ENF E ++L  D
Sbjct: 666 ENFEELAELAPD 677

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           E K KGN  +K+ ++ +A+ FY  A+     +PV YSN +   + LN      +M  + L
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 49/120 (40%)

Query: 367 KNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYI 426
           K + +ES K F  + +LDP+ +  Y  +G        +  A   + KA   +  +   Y 
Sbjct: 423 KKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYY 482

Query: 427 QLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE 486
            L   S + G +E+C   FE AR   PV   +    G  L      + A + Y+    L+
Sbjct: 483 GLGMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQ 542

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 32/163 (19%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K +G +YFK  DY +A++ Y+ +L  +  K P   + YSN+ A  + + +  + +  +
Sbjct: 364 EFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDA 423

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203
            +A++L P+                     + K +LR+A + E +E Y  A+     L  
Sbjct: 424 QEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDAYQTLLE 483

Query: 204 NNDFNGATIEPMLERNLNKQAIKVLDQKSKN--PSKNESELPS 244
            N F+    E ++      Q    LD K K+  PSK+ +  P+
Sbjct: 484 KNLFS----EKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPA 522

>KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}
           Anc_2.665 YKL022C
          Length = 780

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 102 DQKDKWAIELK-DKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDK 159
           D   K AI ++ + G+ Y K  DYE+A+K + + L   ++D   Y  +   Y+  N+L K
Sbjct: 613 DSNSKTAISIQTNLGHTYKKLGDYEHAIKCFKYILEDSERDVDTYCTLGFLYLKTNQLQK 672

Query: 160 VIEMSTKALELKPDYSKA--LLRRA----TANEQLENYSDAMFDLSVLSLNNDFNGA--- 210
            +++  +AL ++P    A  +L RA     A E   ++   M    +  L N  N A   
Sbjct: 673 AVDILHRALAIEPSNQNANEMLVRALELNVAKELDSDHPLVMNSYEMNPLKNRDNTALSR 732

Query: 211 --TIEPMLERN-LNKQAIKVLDQKSKNPSKNESELPS 244
             T+ P L+ + L+K++ +      ++P +  S++PS
Sbjct: 733 KRTLMPFLQSSGLSKRSKRNEHGPIESPLEGPSKVPS 769

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 7/97 (7%)

Query: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435
           Y   +L++D   S  +YH G+++ +  DY  A   F +A   D  N   +  +  L Y+ 
Sbjct: 274 YLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQI 333

Query: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDL 472
             + D  + +  A +  P       ++ E+  D G L
Sbjct: 334 YQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 363

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKDPVFYS-----NMSACYVSLNELDKVIEMST 165
            K++GN+ +K K + +A   Y+  + +K D    S     N +AC + L    + I    
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           +AL+L P   KA  R   A  QL+   +A
Sbjct: 140 EALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 24/110 (21%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K+KG   F+  DY  A + Y+ +L  +    P   V +SN+  C + + E  + +  +
Sbjct: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386

Query: 165 TKALELKPD-------------------YSKALLRRATANEQLENYSDAM 195
           + AL+L P                    +SK +  +A A E++ENY  A+
Sbjct: 387 SSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 49/112 (43%), Gaps = 26/112 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K KG   FK  DY N+L+ Y+ AL  +    P   +  SN+ A  + + E  K I  S
Sbjct: 358 EFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNS 417

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195
             AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 418 DLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 6/97 (6%)

Query: 105 DKWAIELKDKGNEYFKEKDYENALKFYDFAL-ILKKD--PV---FYSNMSACYVSLNELD 158
           ++ AI+LK +GN+  + ++Y++A+  Y  A+ +LKK+  PV   + SN S         +
Sbjct: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140

Query: 159 KVIEMSTKALELKPDYSKALLRRATANEQLENYSDAM 195
           +  + +   +++ P +SK   R A A      Y DAM
Sbjct: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 5/90 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKK-----DPVFYSNMSACYVSLNELDKVIEMST 165
            K +GN+ +K K + +A + Y   + +K      +   Y+N +AC + +    + I    
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 166 KALELKPDYSKALLRRATANEQLENYSDAM 195
           +AL+L P   K   R A A   LE   +A+
Sbjct: 144 QALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 75/187 (40%), Gaps = 23/187 (12%)

Query: 300 MELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIY 359
           +E+Y  LL    DK  +S               L N+LV        +I  +P+  ++  
Sbjct: 504 LEIYSTLLWHLHDKVKLS--------------ILANELV-------MNIPNAPQ--TWCC 540

Query: 360 LALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDE 419
           +    + + + +++ K F++A ++DPN +  Y  +G  +     +  AKN + KA   D 
Sbjct: 541 MGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDP 600

Query: 420 NNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQY 479
            +   Y  L     + G +++    FE AR   P+   +    G  L      + A   Y
Sbjct: 601 QHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYY 660

Query: 480 EFGIRLE 486
           E    L+
Sbjct: 661 ELACELQ 667

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 60/139 (43%), Gaps = 26/139 (18%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKD-----PVFYSNMSACYVSLNELDKVIEMST 165
            K +GNE +K K +++A + Y   + ++ +        ++N +AC + L    + IE  +
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 166 KALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND---FNGATIEPMLERNLN- 221
           KAL + P   K   R           S A F LS L        F   +IEP  +  LN 
Sbjct: 146 KALTINPKNIKCYYR----------TSKAFFSLSKLEEAKSAAIFANQSIEPENKSILNM 195

Query: 222 -------KQAIKVLDQKSK 233
                  +Q +K+ +QK +
Sbjct: 196 LSVIERKEQELKIKEQKKQ 214

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 8/89 (8%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKAL- 168
           +K++GN  F+  ++ +A ++Y   + L+ ++P+ YSN +   + L +  + I+   + L 
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 169 ------ELKPDYSKALLRRATANEQLENY 191
                 + +P   K L R   A E L  +
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 136/311 (43%), Gaps = 35/311 (11%)

Query: 303 YKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQS-----ISASPRVNSY 357
           +KILL+S   K +  +      E +   + L N   T   LF++S     +  +P + S 
Sbjct: 473 FKILLKSNPTKYSFWQSLKKLCEKLNKMDELYNTFETL--LFDESENFRILKQNPLL-SL 529

Query: 358 IYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKEL 417
           +Y   I  + ++  +S +  D A  + PN   ++  + +   +T     A+  F  A E 
Sbjct: 530 MYSKEIWKNGHDIPKSLEILDRAQNILPNSLEVWLAKLKFLCLTDQVELAQKSFAMAMER 589

Query: 418 DENNIFPYIQ------LACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGD 471
             ++  P+++      ++ L +R  +    +   E    KFP  P+    LG+I  D G 
Sbjct: 590 LRDSQVPHLEKLYYKYISFLRFRRQNTAAIKMLNETCIPKFPNCPKFYLQLGQIHYDLGQ 649

Query: 472 LDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPR 531
            + +   +E G ++      + + +A +  +   L R       ++A  +   A+ K+P 
Sbjct: 650 TEESQMAFERGTKMLPQGIPLWISLARI--EEIDLKRP------AKARSIFDLALLKNPA 701

Query: 532 SEQAIVGLAQLKLQEEDVDTAIELFEKA-SDYSRSMDEKLQATTFAEAAKVQKRIRADPV 590
           +E   +  AQ++ +  + D A  + +++   +S+S      AT +AE       IR  P+
Sbjct: 702 NETLSLARAQMEARLGNYDQARFIIQQSLQKHSKS------ATLWAE------NIRILPL 749

Query: 591 IKAKVEETLAQ 601
            +A V++T+ Q
Sbjct: 750 KRANVKKTVFQ 760

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           +LK +GN +F++ DY  A  +YD  + L+  +P+ YSN +   +        +E   + L
Sbjct: 5   DLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGL 64

Query: 169 ELKPDYSKALLRRAT 183
           +    Y+ +  + AT
Sbjct: 65  K----YTSSSTKEAT 75

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 18/97 (18%)

Query: 119 FKEKDYENALKFYDFALI----LKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD- 173
           F++K++  +LK +   L+    LK DP     + AC+  L +    I    ++LEL P  
Sbjct: 208 FRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPTN 265

Query: 174 -----------YSKALLRRATANEQLENYSDAMFDLS 199
                      + K L+     +E  +N+ DAM DLS
Sbjct: 266 KNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 146 NMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDA 194
           N+ ACY  L++L   + +S K+L+L PD +K  +R      +L+++  A
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIRCTRTLIKLKDWKRA 131

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 112 KDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKALE- 169
           K+ GN  FK+  Y  A+  YD  +  + ++PV YSN +   + L E    I+   + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 170 -LKPDYS 175
            L P+++
Sbjct: 72  ALGPEHA 78

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 118 YFKEKDYENALKFYDFALILKKD-PVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSK 176
           ++   DY+  +  +  AL ++ D  + ++ + A   + N  ++ I+   KAL+LKP + +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 177 ALLRRATANEQLENYSDAM-FDLSVLSLN 204
           A    A +   +  Y +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>CAGL0K05599g Chr11 (545761..547893) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q08496 Saccharomyces cerevisiae YOR080w
          Length = 710

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 146 NMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDA 194
           N+SAC+   N LD  +++S K ++L+P   K  +R+     +L  Y DA
Sbjct: 83  NLSACWEKQNILDNALKLSHKMVKLEPFNIKTYIRKGRILMKLTKYRDA 131

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKDPV-----FYSNMSACYVSLNELDKVIEMST 165
            K++GN+ +K K +++A + Y+  + +K D        Y+N +AC + +    + +    
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 166 KALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAI 225
            AL+  P   K   R   A   LE   +A   +    L  D +   ++ +L+  L KQ  
Sbjct: 141 TALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKKQEA 199

Query: 226 K 226
           K
Sbjct: 200 K 200

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 9/107 (8%)

Query: 108 AIELKDKGNEYFKEKDYENALKFYDFALILK--KDPV---FYSNMSACYVSLNELDKVIE 162
           A   K++GN+ +K K Y++A   Y   + +K   D +    Y N +AC + L      I 
Sbjct: 79  AANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCIN 138

Query: 163 MSTKALELKPDYSKALLRRATANEQLENYSDA----MFDLSVLSLNN 205
              KAL       KA  R   A  +L+   +A    +F L + S NN
Sbjct: 139 DCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGLKLDSQNN 185

>KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 59/161 (36%), Gaps = 9/161 (5%)

Query: 399 FVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEI 458
           +V  D   A+  + K  + D  N   Y  L  + + +G F DC N + LA        E 
Sbjct: 122 YVRNDIQVAEQLYNKVIKADAKNFAAYKTLGDIYHLQGRFNDCCNSWFLAAHLNSTDWEF 181

Query: 459 PTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEA 518
              + E+ A+   +  A   Y   IR+ N +       A L  +   L R         A
Sbjct: 182 WKMVAELSAELAHVRQAIYCYTRAIRINNEEWECIYNRALLYKEIGQLGR---------A 232

Query: 519 SKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKA 559
               Q     DP     +  LA + ++   V  AIEL+ K 
Sbjct: 233 FDGFQKLYAYDPLDANILRELAVIYVEYNRVSEAIELYMKV 273

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
           E K  GN YFK+ +Y  A+++Y   + +  ++P+ YSN +   + L +  + +E     L
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

Query: 169 ELKPD-----YSKALLRRATANEQLENYSD 193
           +   D     Y K   R   A+ +L   S+
Sbjct: 65  KYVNDADSQVYKKLQYRYNLADTELRKLSN 94

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 98/239 (41%), Gaps = 16/239 (6%)

Query: 289 YEIA--ESSFNKSMELYKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQ 346
           YEI   E S N   +L ++    T+D E  S      L      + L N+LV       +
Sbjct: 425 YEILNYEESLNHFNQLRRMQPTRTQDIEIFST-LLWHLHDSTRLSHLSNELV-------E 476

Query: 347 SISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVN 406
           ++   P+  ++  L  + + + + +++ KYF++A K+D N +  Y  +G  +        
Sbjct: 477 TLPNKPQ--TWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDT 534

Query: 407 AKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEIL 466
           AKN + +A   D  +   Y  L     + G ++     FE AR   PV   +    G  L
Sbjct: 535 AKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVAL 594

Query: 467 ADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALARQPTP-ENFSEASKLLQD 524
                 + A + YE    L+ +        A L+    ++AR     ENF E +KL  D
Sbjct: 595 EKLSYQEKALQYYEQACELQPSSSLAKFKKAHLL---YSMARYSAALENFEELAKLAPD 650

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 115 GNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNEL---DKVIEMSTKALELK 171
           G  Y K   Y+ AL F++ A  +  +PV    +  C V+L +L   +K ++   +A EL+
Sbjct: 557 GMCYMKLGQYDKALLFFEKARNI--NPVNVILICCCGVALEKLSYQEKALQYYEQACELQ 614

Query: 172 PDYSKALLRRATANEQLENYSDAM 195
           P  S A  ++A     +  YS A+
Sbjct: 615 PSSSLAKFKKAHLLYSMARYSAAL 638

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 70/184 (38%), Gaps = 13/184 (7%)

Query: 359 YLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELD 418
           Y +LI    N+ D++ KY  +A  ++P  +  Y   G        +  AKN + KA   D
Sbjct: 627 YFSLI----NDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKNCYRKAIACD 682

Query: 419 ENNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQ 478
            N+   Y  L     R G ++     FE A+   P    +    G  L      + A   
Sbjct: 683 PNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNAILLCCCGSALEKLNFNEKALNY 742

Query: 479 YEFGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVG 538
           YE    L+         +A L+    +++R      ++ A ++L+  +E  P        
Sbjct: 743 YELACNLQPNSSFAKFKLAKLL---YSMSR------YNLALEILEQVIEMAPEEVTPHFL 793

Query: 539 LAQL 542
           L QL
Sbjct: 794 LGQL 797

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 26/111 (23%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFA--LILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E KD+  E FK  DY  AL+ Y+ +   +    P   + YSN+ A  +   +  + + ++
Sbjct: 347 EFKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVA 406

Query: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDA 194
           + AL+L P+                     + K + RRA A E  EN+ +A
Sbjct: 407 SMALKLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEA 457

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 24/116 (20%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164
           E K+KG   F   DY  A + ++ ++  +    P   +  SNM  C + L E  K IE S
Sbjct: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365

Query: 165 TKALEL-------------------KPDYSKALLRRATANEQLENYSDAMFDLSVL 201
           + AL+L                   K  + K +  +A A E +E+Y  A+ +  +L
Sbjct: 366 SVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 118 YFKEKDYENALKFYDFALILKKD-PVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSK 176
           ++   DY+  +  +  AL +K D  + ++ + A   + N  ++ I+   KAL+LKP + +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 177 ALLRRATANEQLENYSDAM-FDLSVLSLN 204
           A    A +   +  + +A  + L+ LS++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKD-----PVFYSNMSACYVSLNELDKVIEMST 165
            K +GNE +K K +++A + Y   + ++ +        ++N +AC + L    K +E   
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           KAL + P   K   R + +  QL    +A
Sbjct: 146 KALTINPKNIKCYYRISKSFFQLRKLEEA 174

>TDEL0G02640 Chr7 (504079..505212) [1134 bp, 377 aa] {ON} Anc_2.333
           YDL107W
          Length = 377

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 327 VGIFNFLRNDLVTAQDLFNQSISASP---RVNSYIYLALI 363
           +G F+F + DL+ A+  F +SI  SP    V+SY YLA I
Sbjct: 197 LGQFSFHKTDLIPAERYFLKSIQYSPLEYSVHSYFYLAQI 236

>KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {ON}
           Anc_2.665 YKL022C
          Length = 704

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 115 GNEYFKEKDYENALKFYDFALI-LKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173
           G+ Y K  D E A++ + + L   +KDP  Y  +   Y+   +L K I+   +AL +KP 
Sbjct: 560 GHTYRKLGDNERAIECFKYVLQDSEKDPDLYVTLGFLYLQTKQLQKGIDCLHRALAIKPG 619

Query: 174 YSKA 177
            + A
Sbjct: 620 MTSA 623

>KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1055

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 61/160 (38%), Gaps = 9/160 (5%)

Query: 399 FVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEI 458
           FV  D   A++ + +  + D  N   Y  L  +   +G F DC N + LA    P   E 
Sbjct: 163 FVRNDIQVAEHLYNEVIKKDVKNFAAYKTLGDIYQLQGRFNDCCNSWFLAAHLNPSDWEF 222

Query: 459 PTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALARQPTPENFSEA 518
              +  + +D G +  A   Y   +R+ +       G + L  K   L R         A
Sbjct: 223 WKVVATLSSDLGHIRQAIYCYTRALRMNSDDWECLYGRSILYKKTNQLGR---------A 273

Query: 519 SKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEK 558
            +  Q     +P     +  LA L +    ++ AIEL+ K
Sbjct: 274 LEGFQRLHNNNPYDGNLLRELAILYVDYNRINEAIELYIK 313

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 146 NMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDA 194
           N+ ACY  L++L   +++S ++L+L PD  K  +R      +L+++  A
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIRCTRTLIKLKDWKRA 140

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 82/201 (40%), Gaps = 36/201 (17%)

Query: 361 ALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDEN 420
           AL   D +E  E +K    AL LD NC       G+     ++   +K ++LKA E+D+ 
Sbjct: 14  ALSDGDYDEAIECSK---SALNLDKNCYFALVFLGKAYSCVKELGKSKQNYLKAIEIDQE 70

Query: 421 NIFPYIQLACLSYREGD----------FEDCQNQFE-LARKKFPVAPEIPTFLGEILADK 469
           N+  +  L  L     D          F+ C    E L  ++FP+               
Sbjct: 71  NVLAWKGLFMLFKNTNDITSFTSFDEYFDLCGRYAEILTSQQFPM--------------- 115

Query: 470 GDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALARQ-PTPENFSEASKLLQDAVEK 528
             +DL     EF  + +++Q+S    + P    A  L+R   +P+   +A K L + V  
Sbjct: 116 --VDLVNDIREFRRKFKDSQESFLRHMRPGTPMAERLSRHLISPQ---DALKGLLETVST 170

Query: 529 DPRSEQA-IVGLAQLKLQEED 548
             R + + +V   +LK+   D
Sbjct: 171 SERQQVSKVVSRERLKISAND 191

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 93/204 (45%), Gaps = 27/204 (13%)

Query: 300  MELYKILLESTEDKETISKKFAI--------ALEYVGIFNFLRNDLVTAQDLFNQSISAS 351
            + L  +L + T+D  +I+ KF +        + EY  I   +R  L      +N  I+  
Sbjct: 878  INLENLLSDETQDNTSIATKFLVLSAKCSLASCEYENIPRTVRASL-----WYNLGIA-- 930

Query: 352  PRVNSYIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDF 411
              + +YI L      +N +D +   + +++KL  N +  +   G ++ +  +Y  A++ F
Sbjct: 931  -ELFTYITLK----AENYRDAAIICYKQSIKLQSNTTEAWIGLG-ISCMDVNYRVAQHCF 984

Query: 412  LKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPT-FLGEILA--D 468
            +KA  L    I  +  LA L+ + GD E  +   ++  K   +AP+  + + G  LA   
Sbjct: 985  IKAIALAPKEIGIWYDLAILALKNGDIEFAR---DVLMKSQSIAPQDSSPWFGMALAHEH 1041

Query: 469  KGDLDLAAKQYEFGIRLENTQKSI 492
            + +L+ ++K +     + N +  +
Sbjct: 1042 ENNLEESSKMFAHSFVISNGRSKV 1065

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQA-IVGLAQLKLQEEDVD-------TAIE 554
            T +A     +N  E  + L   VEKDP  E + + GL Q  +Q  D+        +  +
Sbjct: 413 TTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSITQ 472

Query: 555 LFEKASDYSRSM-DEKLQATTFA 576
           L+   + YS SM D K+Q T +A
Sbjct: 473 LYSGKNQYSESMTDGKIQWTAYA 495

>Ecym_5061 Chr5 complement(135182..136468) [1287 bp, 428 aa] {ON}
           similar to Ashbya gossypii ADR359W
          Length = 428

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 9/83 (10%)

Query: 143 FYSNMSACYVSLNEL------DKVIEMSTKALELKPDYSKALLRRATANEQLENYSD--A 194
           F  ++  C + LNEL      DK+ ++  K+ EL   Y K+LL R T +E LE+  D  A
Sbjct: 175 FKHHLGVCGMILNELEDEIDRDKLRDLLIKSKELTSFYQKSLLIRDTLDELLESAEDLAA 234

Query: 195 MFDLSVLSLNNDFNGATIEPMLE 217
           M+     S  N+ N + +E +LE
Sbjct: 235 MYLSETRSTQNN-NFSDVEMLLE 256

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 146 NMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQL 188
           N++AC+  LN+L + +  S K ++L+P   K  +RR    ++L
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKL 114

>YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}
           DIA2Origin-binding F-box protein; forms an SCF ubiquitin
           ligase complex with Skp1p and Cdc53p; plays a role in
           DNA replication; plays a role in transcription; required
           for correct assembly of RSC complex, correct
           RSC-mediated transcription regulation, and correct
           nucleosome positioning; involved in invasive and
           pseudohyphal growth
          Length = 732

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 146 NMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDA 194
           N+ ACY  LN+L   +++S + L+L+P   K  +R      +L+++  A
Sbjct: 83  NICACYEKLNDLKSCLDVSQRLLKLEPGNIKCYIRCTRTLIKLKDWKRA 131

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 36/89 (40%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKDPV-----FYSNMSACYVSLNELDKVIEMST 165
            K++GN+ +K K + +A + Y   + +K D        Y+N +AC + L      I    
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
            AL   P   K   R   A   +  +  A
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESA 169

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 357 YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKE 416
           Y  + +   ++ ++ ES ++F  AL++DPN    +   GQ  F       +   F KA E
Sbjct: 688 YRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIE 747

Query: 417 LDENNIFPYIQLACLSYRE-GDFEDC 441
           +D  +++       LS  E G FE+C
Sbjct: 748 IDPLHLYAQ-YFNSLSLAEMGCFEEC 772

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 362 LISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENN 421
           L S  K+ K E+ K F++  KLDP  +  Y  +         +  AKN F KA   D  +
Sbjct: 574 LFSLQKDHK-EAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQH 632

Query: 422 IFPYIQLACLSYREGDFEDCQNQFELARKKFP 453
              Y  +   S + G+FE     FE AR   P
Sbjct: 633 YNAYYGIGMCSMKLGEFEHALLYFEKARSINP 664

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 78/185 (42%), Gaps = 9/185 (4%)

Query: 307 LESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPR-VNSYIYLALISA 365
           +++ E   ++ +KFA A    G  +       TA+ ++ ++I+  P+  N+Y  L   ++
Sbjct: 541 IKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCAS 600

Query: 366 DKNEKDESNKYFDEALKLDPNCSPIYYHRGQ----LNFVTQDYVNAKNDFLKAKELDENN 421
              + D++  YF++A  ++P  + +    G     LN   Q    A   +  A++L    
Sbjct: 601 RLGKYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQ----ALTYYELAEKLQPEM 656

Query: 422 IFPYIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEF 481
             P  + A L +  G F      FE   K  P    +   LG+I    G    A K+Y  
Sbjct: 657 TIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIKEYTI 716

Query: 482 GIRLE 486
            + L+
Sbjct: 717 ALNLD 721

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 23/97 (23%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALI----------LKKDPV---------FYSNMSACY 151
           +K+ G   FK+KDY+NAL  Y  +L           + KD            Y N+S  Y
Sbjct: 241 IKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCILFTVLKMKLYLNISLVY 300

Query: 152 VSLNELDKVIEMSTKALELK--PDY--SKALLRRATA 184
            +L + D  I  +T  L+++  PD   +KA  RR  A
Sbjct: 301 FNLKDNDNCITYTTYLLDMENVPDLDQAKAYYRRGNA 337

>NCAS0A10540 Chr1 (2097795..2100428) [2634 bp, 877 aa] {ON}
           Anc_3.265 YBR055C
          Length = 877

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 81/199 (40%), Gaps = 27/199 (13%)

Query: 303 YKILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQD-LFN-----QSISASPRVNS 356
           Y+ILL+ +     + K      E +  F  L   + T Q  LFN      ++ A+P +  
Sbjct: 488 YRILLQDSPTNFRLWKALRTVCESINRFEEL---IKTFQHILFNDRDNYATLKANPHL-C 543

Query: 357 YIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLK--- 413
            +Y   +    +  +E+    +++L++ P C  I+  + +L  +++ Y +A+  F     
Sbjct: 544 LMYAKEVWKYDDNIEEAQMILNKSLEIVPGCLDIWLAKTKLVILSKRYEDAEKLFQTILE 603

Query: 414 ----AKELDENNIFPYIQLACLSYREGDFEDCQNQFE-LARKKFPVAPEIPTF---LGEI 465
                 E  E   + Y+     S R       Q   E L+ K  P+ P    F   LG+I
Sbjct: 604 KYSVGSETMERVYYKYVSFLLFSGRN------QTAIEILSNKCLPMFPTKHKFYLQLGQI 657

Query: 466 LADKGDLDLAAKQYEFGIR 484
             + G  D   + Y  G++
Sbjct: 658 YHELGQFDKCKEVYNMGLK 676

>Smik_18.9 Chr18 complement(14576..15424) [849 bp, 282 aa] {ON}
           YNL199C (NOVEL)
          Length = 282

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 10/97 (10%)

Query: 502 KATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASD 561
           K  A  R+P PEN+S      +D +E + +S    VG   +K+ E D    ++  +K ++
Sbjct: 178 KEGAPHRKPLPENWSS-----RDLIESNLKS----VGFRDIKIAEIDSILEVKDVKKLAE 228

Query: 562 YSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEET 598
           +         A  F +    +K+I  D +IK  VEET
Sbjct: 229 FLVKSGNPRTAYIFEDFTDSEKKIACDLIIK-HVEET 264

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 46/120 (38%)

Query: 369 EKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQL 428
           + DE+ K F +A +LDP  +  Y  +G        +  AK  + KA   +  +      L
Sbjct: 429 DHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQHYNASYGL 488

Query: 429 ACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENT 488
                + G +E+    F+ A    PV   +    G +    G    A K YE    L+ T
Sbjct: 489 GMCCLKLGQYEESLLHFQKAHSINPVNVILICCCGVVFEKLGHQQDALKYYELACELQPT 548

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 111 LKDKGNEYFKEKDYENALKFYDFALILKKD-----PVFYSNMSACYVSLNELDKVIEMST 165
            K++GN+ ++ K Y++A + Y+  + +K D        +SN +AC + L    + +    
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 166 KALELKPDYSKALLRRATANEQLENYSDA 194
           +AL+      K   R A A   L    DA
Sbjct: 141 RALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 48/120 (40%)

Query: 367 KNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYI 426
           K + +ES K F  + +LDP+ +  Y  +G        +  A   + KA   +  +   + 
Sbjct: 422 KKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQHYNAHY 481

Query: 427 QLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE 486
            L     + G +E+C   FE AR   PV   +    G  L      + A + Y+    L+
Sbjct: 482 GLGMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQ 541

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 110 ELKDKGNEYFKEKDYENALKFYDFALILK-KDPVFYSNMSACYVSLNELDKVIEMSTKAL 168
             KD GNE+FK+ +Y+ A++ Y   + L+  + V YSN++  Y+     ++  + +  A 
Sbjct: 37  HFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLK----NRCPDEAKTAC 92

Query: 169 ELKPDYSK 176
           E+   Y K
Sbjct: 93  EMGLSYCK 100

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 321 AIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYI---YLALISADKNEKDESNKYF 377
           A+ L+  G     + D   A DL+ ++I      + Y     LA +  D  +   ++   
Sbjct: 12  ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLND--C 69

Query: 378 DEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDF---LKAKELD 418
           DEALKLDP  +  Y+ RG       ++  AKND    LKAK  D
Sbjct: 70  DEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGD 113

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRA 182
            Y N+SA Y  L ELDK  E S++ + ++P   K  +R  
Sbjct: 73  LYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMG 112

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
            Anc_7.546 YPR189W
          Length = 1403

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 44/90 (48%), Gaps = 1/90 (1%)

Query: 356  SYIYLALISADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAK 415
            ++I L + + D N +  +   F +A+ LDP  + I+++   L     D   AK    +++
Sbjct: 955  AWIGLGISTMDLNYR-VAQHCFIKAVALDPKNTEIWFNLAMLGLRHDDITFAKEVLNRSQ 1013

Query: 416  ELDENNIFPYIQLACLSYREGDFEDCQNQF 445
             +   +  P++ +A +S  +GD ++    F
Sbjct: 1014 SVAPQDSVPWLGMALVSELKGDKQESSRLF 1043

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 49/118 (41%)

Query: 369 EKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQL 428
           + DE+   F +A++LDP  +  Y  +G        + NAK+ F KA  +++ +      L
Sbjct: 507 DHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGL 566

Query: 429 ACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE 486
                + G FE+    FE AR   PV   +    G  L      + A   YE    L+
Sbjct: 567 GMCCVKLGKFEEALLFFEKARALNPVNVILNCCCGVALERLQQPERALNFYELATELQ 624

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 118 YFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSK 176
           ++   D++  L+ +  AL I   D + ++ + A   + N  ++ I+   KA+ LKP + +
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVR 510

Query: 177 ALLRRATANEQLENYSDAMFD-LSVLSL 203
           A    A A+  +  Y +A    L+VL +
Sbjct: 511 ARYNLAVASMNIGCYQEAAGHLLTVLKM 538

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,582,268
Number of extensions: 2886467
Number of successful extensions: 10714
Number of sequences better than 10.0: 345
Number of HSP's gapped: 10859
Number of HSP's successfully gapped: 461
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)