Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E039305.433ON21121111131e-156
Suva_2.5395.433ON2272267871e-106
YDR367W (KEI1)5.433ON2212207691e-104
NCAS0F033705.433ON2112157581e-102
Skud_4.6365.433ON2342337451e-100
CAGL0A02794g5.433ON2162157391e-99
Smik_4.6335.433ON2212217392e-99
KNAG0C049205.433ON2172167382e-99
TDEL0E019205.433ON2202167034e-94
SAKL0G02508g5.433ON2282206437e-85
TPHA0E017705.433ON2172046383e-84
ZYRO0F10010g5.433ON2082076192e-81
Kpol_1062.305.433ON2142116104e-80
TBLA0A065205.433ON2062065731e-74
Kwal_55.214325.433ON2072075497e-71
NDAI0B056605.433ON1611625292e-68
AER256C5.433ON2392135162e-65
KLLA0E21099g5.433ON2242165031e-63
TBLA0G020105.433ON2131984847e-61
Ecym_47625.433ON2212204849e-61
KLTH0F16082g5.433ON2062064637e-58
TPHA0M006303.221ON63686673.3
CAGL0M11440g8.283ON57564655.6
KAFR0H015508.480ON74640656.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03930
         (211 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   433   e-156
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   307   e-106
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   300   e-104
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   296   e-102
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   291   e-100
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   289   1e-99
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   289   2e-99
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   288   2e-99
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   275   4e-94
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   252   7e-85
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   250   3e-84
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   243   2e-81
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   239   4e-80
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   225   1e-74
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   216   7e-71
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   208   2e-68
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   203   2e-65
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   198   1e-63
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   191   7e-61
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   191   9e-61
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   182   7e-58
TPHA0M00630 Chr13 complement(114589..116499) [1911 bp, 636 aa] {...    30   3.3  
CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa...    30   5.6  
KAFR0H01550 Chr8 (286740..288980) [2241 bp, 746 aa] {ON} Anc_8.4...    30   6.4  

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  433 bits (1113), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/211 (100%), Positives = 211/211 (100%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS
Sbjct: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120
           TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120

Query: 121 TITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDD 180
           TITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDD
Sbjct: 121 TITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDD 180

Query: 181 IEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211
           IEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA
Sbjct: 181 IEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  307 bits (787), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 169/226 (74%), Gaps = 16/226 (7%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           MR++  +LPKSFLG +PLYLAVEIVLGI+  NK SGA+GILALFTGHPL FMQWV YLWS
Sbjct: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120
             TL VFAQGL+ IHKPN+L FSQI V Y++DT+C CFFTLWFT  WF +E        +
Sbjct: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADA 120

Query: 121 T----------------ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASF 164
           +                +T R+ D S QGAS+ YEYS+TI ITL SL+FRFYFNFILASF
Sbjct: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASF 180

Query: 165 VQELLRHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
           VQELL HPKY+ D+DD+EQDLKNK IWKR W K QK CYKLCKNLL
Sbjct: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  300 bits (769), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 168/220 (76%), Gaps = 10/220 (4%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           MR++  +LPKSFLG +PLYLAVEIVLGI+  NK SGA+GILALFTGHPL FMQW+ YLWS
Sbjct: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVES-------- 112
             TL VF+QGL+ IHKPN+L FSQI V Y+IDT+  CFFTLWFT  WF +E         
Sbjct: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN 120

Query: 113 --QTEAAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLR 170
             Q+       +T+R  DIS Q A++ YEY+MTI ITL SL+FRFYFNFILASFVQELL 
Sbjct: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180

Query: 171 HPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
           HPKY+ D+DD+EQ+LKNK IWKR W K QK CYKLCKNLL
Sbjct: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  296 bits (758), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 143/215 (66%), Positives = 168/215 (78%), Gaps = 8/215 (3%)

Query: 1   MRTTSFSLPK---SFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFY 57
           M   S +LPK   SF G++PLYL VEIVLGIT FNK SGA+GILALFTGHPL F+QWVFY
Sbjct: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60

Query: 58  LWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVE-SQTEA 116
           LWS  TL +FAQGL+EIHKP +LTFSQI VFYS+DT+C C FTLWFT  WF  E + TE 
Sbjct: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEE 120

Query: 117 AVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMF 176
           A    + +R E + SQGA++ YEY MTIFITL +L FR YFN +LA+FVQELL HPKY+ 
Sbjct: 121 A----LQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLV 176

Query: 177 DQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211
           DQDD+EQDLKNK +WKRWW+K QK  YK+C +LLA
Sbjct: 177 DQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  291 bits (745), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 169/233 (72%), Gaps = 23/233 (9%)

Query: 1   MRTTSFSLPK----SFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVF 56
           MRT+  +LPK    SFLG +PLYLAVEIVLGI+  NK SGA+GILALFTGHPL FMQWV 
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 57  YLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTE- 115
           YLWS  TL VF+QGL+ IHKPN+L FSQI + Y++DT+  CFFTLWFT  WF +E+ T+ 
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 116 ------------------AAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYF 157
                               +   +T R+ D S Q A++ YEYS+TIFITL SL+FRFYF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 158 NFILASFVQELLRHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
           N IL SFVQELL HPKY+ D+DD+EQDLKNK IWKR W K QKSCY+LCKNLL
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  289 bits (739), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 165/215 (76%), Gaps = 5/215 (2%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           MR    S PKSF G LPLYL VEIVLGIT  NK SGA+GILALFTGHPL +MQW+ YLWS
Sbjct: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNV----ESQTEA 116
             TL VF+QGLF IHKP ++ FSQI V+++ DT+  CFFTLWF+  WF      + +T A
Sbjct: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSA 120

Query: 117 AVG-STITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYM 175
            VG S   +R+ D++SQGAS+ YEY++T+  TL +L+FR YFNFILASFVQELLRHPKYM
Sbjct: 121 PVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYM 180

Query: 176 FDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
            DQDD+EQDLKNKS  KRWW+K QK CYKLC++ L
Sbjct: 181 VDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  289 bits (739), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 164/221 (74%), Gaps = 12/221 (5%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           MR+   +LPKSFLG +PLYLAVEIVLGI+  NK SG +GILALFTGHPL FMQWV YLWS
Sbjct: 1   MRSFLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120
             TL +F+QGL+ IHKPN+L FSQI   Y++DTL  CFFTLWFT  WF +E  T   V S
Sbjct: 61  VFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLE-DTAGGVAS 119

Query: 121 -----------TITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELL 169
                       +T R  DIS Q A++ YEYS+TI ITL SL+FRFYFN ILASFVQELL
Sbjct: 120 QSNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELL 179

Query: 170 RHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
            HPKY+ D+DD+EQ+LKNK IWKR + K QK CYKLCKNLL
Sbjct: 180 HHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  288 bits (738), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 136/216 (62%), Positives = 164/216 (75%), Gaps = 6/216 (2%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           M   S SLPK+F G+ PLY+ VEIVLG+T  NK SGAFGILALFTGHPL  MQW  YLWS
Sbjct: 1   MTKLSSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWS 60

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120
             TL V+AQGL++IHKP +LTFSQI V +SIDT+  C FTLWFTG WF  ES T+AA+G+
Sbjct: 61  VFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGT 120

Query: 121 T------ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKY 174
                  + KR  +I +QGA++ YEY  TI IT+ SLVFR YFNF+LASFVQELLRHP+Y
Sbjct: 121 AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQY 180

Query: 175 MFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
           + DQDDIEQDLKNK   +RWW+  QKS Y +C+++L
Sbjct: 181 LVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  275 bits (703), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 161/216 (74%), Gaps = 6/216 (2%)

Query: 2   RTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWST 61
           R+ S  LPKSFLG +PLY+ VEI LGI+  NK SGA+GILALFTGHPL  MQWV Y+WS 
Sbjct: 5   RSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSI 64

Query: 62  VTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQ------TE 115
            TL +  QGL++IHKPN+LTFS IF+ + IDTL   FFTLWFT  W+N+E        T+
Sbjct: 65  FTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTK 124

Query: 116 AAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYM 175
           ++        +  I+ QGAS+G+EY +T+FIT+ SL  + YF FI+ASFVQELL HP+YM
Sbjct: 125 SSYSDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYM 184

Query: 176 FDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211
            DQDD+EQDLK++S WKRWW+K QKSCYK+ K+LLA
Sbjct: 185 LDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  252 bits (643), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 120/220 (54%), Positives = 159/220 (72%), Gaps = 16/220 (7%)

Query: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67
           LPKSFLG LPLY+ VE+ LGI+ FNK SG +GILALFTGHPL FMQW FY  S +TL V+
Sbjct: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVY 68

Query: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTE--AAVGST---- 121
             GL++I KPN LT+S + V ++IDTL NCFFT+WF+  WF++E   +   AVG++    
Sbjct: 69  LSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128

Query: 122 ----------ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRH 171
                     + +R   ++SQ ASQGYEY+MT+  T+ +L  RFYFNFILA+FVQ++LRH
Sbjct: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188

Query: 172 PKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211
           PKY+ D+DD+EQDLKNKS+++R  +K +K CY  C+  LA
Sbjct: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  250 bits (638), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 148/204 (72%), Gaps = 3/204 (1%)

Query: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67
           LPKSF G LPLY+ VE VLGIT FNK SG +GILALFTGHPL  +QWV YLWS+ TL ++
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTITKRTE 127
           AQGLF++H PN+LT+ QI + YS DT+C CFFT++F   WF  ES     + S+    T 
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSS---TTV 133

Query: 128 DISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDLKN 187
           D  +QGAS+  E+  T+ +TL +LV RFYFNFILASF Q+L  HPKYM DQDD+EQDLKN
Sbjct: 134 DKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKN 193

Query: 188 KSIWKRWWLKCQKSCYKLCKNLLA 211
           KSI  +WW+K +K CY   K  LA
Sbjct: 194 KSIIVQWWIKSKKRCYYTSKRFLA 217

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  243 bits (619), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 115/207 (55%), Positives = 143/207 (69%), Gaps = 2/207 (0%)

Query: 4   TSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVT 63
           T  +LPK FLG LPLY+ VE+ LG+T  NK SG FGILALFTGHPL F+QWV YLWS  +
Sbjct: 3   TYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFS 62

Query: 64  LFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTIT 123
             V+AQGLF   KP++L FSQIF+ +SIDT   C FTLWFT  W+ +E  T      +I 
Sbjct: 63  FVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQ--KSIA 120

Query: 124 KRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQ 183
                  +QGASQ +E+ MTIFITL SL+ R YFNF+LASFVQ LL+HP+YM D  D+EQ
Sbjct: 121 AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ 180

Query: 184 DLKNKSIWKRWWLKCQKSCYKLCKNLL 210
           +L+ + +WKR W + Q  C +  K LL
Sbjct: 181 ELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  239 bits (610), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 151/211 (71%), Gaps = 6/211 (2%)

Query: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           ++T   +LP+SF G LPLY+ VE VLGIT  NK SGA+GILALFTGHPL   QWV YLWS
Sbjct: 10  VKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWS 69

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120
             TL +++QGLF++H P++LT+SQIFV +S DT   C FT+ F+  WF  E+ +  + GS
Sbjct: 70  VFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWF-TETGSGMSDGS 128

Query: 121 TITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDD 180
            +     D   QGAS+ YEY+ TI IT+ +LV R YFNFILA+F QEL  HPKYM D DD
Sbjct: 129 GV-----DEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDD 183

Query: 181 IEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211
           +EQDLKNK+   +WW+K +KSCY L +++L 
Sbjct: 184 VEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  225 bits (573), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 105/206 (50%), Positives = 140/206 (67%), Gaps = 12/206 (5%)

Query: 6   FSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLF 65
           F LPK F GV PLYL VE+VLGIT FNK  GA+GILALF GHPL F QWV Y WS V L 
Sbjct: 13  FILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLA 72

Query: 66  VFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTITKR 125
           ++AQGL ++H+P + TFSQ+F+F+S+DTL  C FT++FT +WF   + T           
Sbjct: 73  IYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPP-------- 124

Query: 126 TEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDL 185
               ++QGAS  YEYS+++ +TL SLV R YFNFI+ SF+QEL   P Y  D D++E +L
Sbjct: 125 ----AAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETEL 180

Query: 186 KNKSIWKRWWLKCQKSCYKLCKNLLA 211
           ++ S+ +R WL+ Q  CY L + +L+
Sbjct: 181 RHSSLLRRLWLQNQHYCYILSRRILS 206

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  216 bits (549), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 141/207 (68%), Gaps = 15/207 (7%)

Query: 20  LAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNI 79
           + VEI LGIT  NK SG +GIL L TGH L FMQWV YL S +T+ V++ GL  I+KP++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 80  LTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVES-----------QTEAA----VGSTITK 124
           L++S I + ++ DTL  CFFTLWF+G WF+ ++           Q+ A      G+ I+K
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 125 RTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQD 184
           R + +SSQ ASQG EY  TI +T+ +L  RFYFNFI+ +FVQ LLRHPKY+ DQDD+EQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 185 LKNKSIWKRWWLKCQKSCYKLCKNLLA 211
           LK++   +RWW++ +   YK+C+  LA
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  208 bits (529), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 100/162 (61%), Positives = 128/162 (79%), Gaps = 3/162 (1%)

Query: 52  MQWVFYLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVE 111
           MQWV YLWS   L +FAQGL++IHKP +LTFSQI VF+++DTL  CFFTLWFT  WF   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQ-G 59

Query: 112 SQTEAAVGST--ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELL 169
           S+ E+AV ++  + KR   ++SQGA+ GYEY +T+ IT  +L FRFYFN ILASFVQELL
Sbjct: 60  SEGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELL 119

Query: 170 RHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211
            +PK+M DQDD+EQDLKNKS+ KRWW+K +K CY+LCK++L+
Sbjct: 120 SNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  203 bits (516), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 104/213 (48%), Positives = 136/213 (63%), Gaps = 12/213 (5%)

Query: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67
           LPKSF G LPLY+ VE+ LGI  FNK  G FG+LALFTGHPL  +QW+FYLWS VTL V+
Sbjct: 29  LPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87

Query: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWF----------NVESQTEAA 117
             GL +I++P +  +  + V YS DT+  C +TLWFT  WF            E   +A 
Sbjct: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDADAT 147

Query: 118 VGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFD 177
            GS +T   E +S Q AS+ YEY+ T+  TL +L  RFY NF++ASFVQ + +H K+   
Sbjct: 148 QGS-VTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAG 206

Query: 178 QDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
            DD+EQDLK+KS+  R + K Q+ CY LC+  L
Sbjct: 207 CDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  198 bits (503), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 139/216 (64%), Gaps = 14/216 (6%)

Query: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67
           LP++FL   PLY+ VE+ LG+  FNK SG +G+LALFTGHPL F+QW FY+WS   L VF
Sbjct: 10  LPQTFLS-YPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68

Query: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTE------------ 115
             G+ +++KPNIL  S +   +S+DT+ +C + LWFT  WF+ E  T+            
Sbjct: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128

Query: 116 -AAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKY 174
            A  G+T T  T+  +S+ AS GYE+ + I +TL  L  RFYFNFI+ +F Q+LLR  K+
Sbjct: 129 PAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKF 188

Query: 175 MFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
            FDQ+DIE +L N++I  +W  K +K C+ LCK  L
Sbjct: 189 TFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  191 bits (484), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 136/198 (68%), Gaps = 8/198 (4%)

Query: 3   TTSFS--LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60
           T+S+S  LP SF  + PLYL VE++LGI   NK SG +GILALFTGHPL+ +QW+ Y+WS
Sbjct: 6   TSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWS 65

Query: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120
             TL ++ QG+F I KPN+  FSQIF  +S+DT+   F TL+F  DWF+ +   + +  S
Sbjct: 66  IFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENS 125

Query: 121 TITKRTE-DIS---SQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMF 176
              +RTE DI     QGAS  YE  + + +TL +L+ R Y+N +LASF+ +L  +PK++ 
Sbjct: 126 --LQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183

Query: 177 DQDDIEQDLKNKSIWKRW 194
           DQDD+E DLKNKS +K++
Sbjct: 184 DQDDVETDLKNKSFFKKF 201

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  191 bits (484), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 136/220 (61%), Gaps = 19/220 (8%)

Query: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67
           LP+SF G LPLY+ VE+ LG+  FNK  G +GILALFTG PL  +QW FY+WS   L VF
Sbjct: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAA---------- 117
            +GL +++KP ++T+  +   YS+DT+  CFF + FTGDWF+ E  +  +          
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 118 --VGSTIT-----KRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLR 170
             VG + T     +RT D  +Q AS  YEYS TI +TL     RFY NFI+ASFV+ +++
Sbjct: 123 VDVGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMK 181

Query: 171 HPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210
             +Y+ + DD+E DLKN S+  R ++  Q+ CY  C+  L
Sbjct: 182 QNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  182 bits (463), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 135/206 (65%), Gaps = 14/206 (6%)

Query: 20  LAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNI 79
           + VEI LGIT  NK SG +GIL L TGH L FMQWV YL S  TL V++ GL  ++KP +
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 80  LTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVES-----------QTEAAVGST---ITKR 125
            T++ + + ++ DTL  CFFTLWF+G WF  +            QT   + S    +T R
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 126 TEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDL 185
            E +SSQ ASQ  EY  TI ++L +LV RFYFNFI+ +FVQ L RHPKY+ DQDD++QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 186 KNKSIWKRWWLKCQKSCYKLCKNLLA 211
           K+K +W+RWW++ +   Y++C + LA
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206

>TPHA0M00630 Chr13 complement(114589..116499) [1911 bp, 636 aa] {ON}
           Anc_3.221 YBR021W
          Length = 636

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 110 VESQTEAAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELL 169
           ++S T   +G T TK  +DI+S       EY+ T  +  +S   RFY+ +I+A   +  +
Sbjct: 34  LDSSTADTIG-TFTKTLDDINSFEEESDTEYAYTTILEQSSKWERFYYEYIVAD--KSTI 90

Query: 170 RHP---KYMFDQDDIEQDLKNKSIWK 192
             P    +M++  D+    K + +W 
Sbjct: 91  GIPFLHSFMYNH-DLRPVEKARRVWS 115

>CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098c CHA4 transcription factor
          Length = 575

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 86  FVFYSIDTLCNCFFTLWFTGDWFNVESQTEA--AVGSTITKRTEDISSQGASQGYEYSMT 143
           F+F   +T  N FF  + T  ++  E    A  A+G+ I  R++D+++ GA + Y  S +
Sbjct: 156 FMFIHRETFLNSFFGDFNTKSYYCSEELVYAIFALGAQIADRSDDVANMGA-EYYRRSKS 214

Query: 144 IFIT 147
           + +T
Sbjct: 215 MVLT 218

>KAFR0H01550 Chr8 (286740..288980) [2241 bp, 746 aa] {ON} Anc_8.480
           YPL029W
          Length = 746

 Score = 29.6 bits (65), Expect = 6.4,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 154 RFYFNFILASFVQELLRHPKYMFDQDDIEQDLKNKSIWKR 193
           R   +F+L  F ++L  H K +F   D+E  LK   +++R
Sbjct: 552 RTKLSFLLKKFEEQLENHSKQLFKLPDLESKLKTIDLFER 591

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.140    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,714,702
Number of extensions: 862200
Number of successful extensions: 3231
Number of sequences better than 10.0: 37
Number of HSP's gapped: 3277
Number of HSP's successfully gapped: 37
Length of query: 211
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 106
Effective length of database: 41,441,469
Effective search space: 4392795714
Effective search space used: 4392795714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)