Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E039205.432ON49745122420.0
YOR119C (RIO1)5.432ON48441216600.0
NCAS0F033605.432ON50942916630.0
Kpol_1062.315.432ON51342416420.0
Suva_8.1725.432ON48641216350.0
Skud_15.2825.432ON48541216290.0
TBLA0A037605.432ON50441316190.0
SAKL0G02486g5.432ON50041616140.0
Smik_15.2975.432ON48641216120.0
KNAG0C049305.432ON49641216010.0
CAGL0L11594g5.432ON50741215950.0
TPHA0E017805.432ON50842015930.0
KLLA0E21121g5.432ON52642815750.0
Kwal_55.214335.432ON47642015700.0
AER257W5.432ON47741515570.0
KLTH0F16104g5.432ON54041415540.0
NDAI0B056505.432ON46238515450.0
TDEL0E019305.432ON50240715310.0
Ecym_47635.432ON53841514750.0
ZYRO0F09988g5.432ON46041313111e-178
TPHA0H009202.44ON4292511204e-06
NCAS0G015802.44ON4242481197e-06
CAGL0H08019g2.44ON4252531152e-05
Suva_14.1362.44ON4262511152e-05
NDAI0F036002.44ON4212481072e-04
Skud_14.1292.44ON4252481062e-04
Ecym_64492.44ON4172481026e-04
ABL166W2.44ON414299990.001
KNAG0F010602.44ON428152990.001
TDEL0A008602.44ON419248960.004
KLTH0B07722g2.44ON428292880.033
ZYRO0C10340g2.44ON416137870.048
KLLA0D19008g2.44ON422173820.16
TBLA0G003702.44ON444107820.21
KLLA0F15576g5.200ON51251800.31
Ecym_11191.104ON791116780.57
SAKL0A03806g6.241aON104195761.1
KLTH0B03432g5.200ON509107723.4
CAGL0H01199g5.298ON1648136705.9
Kpol_2002.985.200ON56863697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03920
         (497 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   868   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   644   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   645   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   637   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   634   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   632   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   628   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   626   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   625   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   621   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   619   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   618   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   611   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   609   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   604   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   603   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   599   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   594   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   572   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   509   e-178
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    51   4e-06
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      50   7e-06
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    49   2e-05
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    49   2e-05
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    46   2e-04
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    45   2e-04
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    44   6e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    43   0.001
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    43   0.001
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    42   0.004
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    39   0.033
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    38   0.048
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    36   0.16 
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    36   0.21 
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.31 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    35   0.57 
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    34   1.1  
KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {...    32   3.4  
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    32   5.9  
Kpol_2002.98 s2002 (234791..236497) [1707 bp, 568 aa] {ON} (2347...    31   7.5  

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/451 (94%), Positives = 424/451 (94%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
           SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYELXXXXXXXX 420
           DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL        
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYELEDDTDDDS 420

Query: 421 XXXXXXXXXXXXXXXXXXXNALYSDEEPRQL 451
                              NALYSDEEPRQL
Sbjct: 421 SDEVGGEDDDDDDEGEDSDNALYSDEEPRQL 451

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/412 (75%), Positives = 357/412 (86%), Gaps = 18/412 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS+EDKFD+L +S  +G+SDHINNQ+L+KY HKIKT+E S SR KT+KDKANRATVENVL
Sbjct: 1   MSLEDKFDSLSVS--QGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVL 58

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+     P + +E     V  
Sbjct: 59  DPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGK----APVIDEETGQYEVLE 114

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
           ++ S            R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 115 TDGS------------RAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 162

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRIYQS VIPAPKPIE+KNNVLVMEFL+RG+GFASP+LKD+PYK+R+EIFH
Sbjct: 163 WAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFH 222

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YYHT+VAY+RLLYQVC LVHADLSEYNT+VH  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 223 YYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIK 282

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           NVN YFEKMGI IFPER+IFQFVISETL+KF GDY +   L  Y+  NLPIK+T QDEAE
Sbjct: 283 NVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAE 342

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E 
Sbjct: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF 394

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/429 (72%), Positives = 360/429 (83%), Gaps = 18/429 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS+EDKFD L IS     ++H NN+ILDKY HK KT+E S +R KTNKDKANRATVENVL
Sbjct: 1   MSLEDKFDRLNISN-EPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVL 59

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMS----- 115
           DPRTM+FL+AL SRGVIS F+GCLSTGKEANVYHAFAG  +    V    +EE       
Sbjct: 60  DPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDE 119

Query: 116 -------VPVDPS-----ELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEF 163
                  +P+D +     E   + +     +  ++EYA+KI+KTSILVFKDRERYVDGEF
Sbjct: 120 NEEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179

Query: 164 RFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFA 223
           RFRN+RSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIE+KNNVLVMEFL RGDGFA
Sbjct: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239

Query: 224 SPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQS 283
           SPRLKDHPYKDREEIFHYYHT+VAY+RL+YQ+C LVHADLSEYN L+H+ ++Y+IDVSQS
Sbjct: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299

Query: 284 VEPEHPMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRD 343
           VEPEHPMSLDFLRMDIKN+NFYFEKMGIDIFPER+IFQF+IS+TL+ FNGDY+  +DLRD
Sbjct: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359

Query: 344 YVRQNLPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKN 403
           YV QNLPIK + QDEAEDEIFRSLYLVRNL GLEERDFDRYT+G+FDLLKSL+AHDNEKN
Sbjct: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419

Query: 404 FAASEQYEL 412
           F+A+EQ++L
Sbjct: 420 FSAAEQFDL 428

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/424 (72%), Positives = 361/424 (85%), Gaps = 17/424 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS ++KFD LKISG     + +N +IL+KYGHKIKT+E S ++GKTNKDKANRATVENVL
Sbjct: 1   MSFDEKFDRLKISG-----NDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVL 55

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+AL +RGVIS+F+GCLSTGKEANVYHAFAG G  +      V++ + +    
Sbjct: 56  DPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVE 115

Query: 121 SELSAQEDKDENS------------TDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNA 168
               ++ED  +N+             + R+EYAIKIYKTSILVFKDRERYVDGE+RFRN+
Sbjct: 116 VNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNS 175

Query: 169 RSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLK 228
           RSQHNPRKMIKIWAEKEFRNL+RI+QS VIPAPKP+E+K+NVLVMEFLNRG+GFASPRLK
Sbjct: 176 RSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLK 235

Query: 229 DHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEH 288
           D+PYKDR+EIF YYH LVAY+RLLYQVC LVHADLSEYNT+VHQG+LY+IDVSQSVEPEH
Sbjct: 236 DYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEH 295

Query: 289 PMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQN 348
           PMSLDFLRMDIKNVN YFEKMGIDIFPERIIFQFVISE L+ F GD  S+DDLR++V+ N
Sbjct: 296 PMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNN 355

Query: 349 LPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASE 408
           LPIK+T +DEAEDE+FRSL+LVRNL GLEERDFDR+T+G+FDLLK+L+A DN+KNF ASE
Sbjct: 356 LPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASE 415

Query: 409 QYEL 412
           QY +
Sbjct: 416 QYGM 419

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/412 (74%), Positives = 355/412 (86%), Gaps = 18/412 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS EDKF+ L +S  + +SDHINNQ+LDK+ HKIKT+E S S+ KT+KDK+NRATVENVL
Sbjct: 1   MSFEDKFEKLTVS--QRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVL 58

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+               PV  
Sbjct: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--------------APVVD 104

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
            E    E  + +    R EYAIKIYKTSILVFKDRE+YVDGEFRFRNARSQHNPRKMIKI
Sbjct: 105 EETGKYEVLETDGL--RAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKI 162

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRI+QS VIPAPKP+E+KNNVLVMEFL+RGDGFASP+LKD+PYKDREEIFH
Sbjct: 163 WAEKEFRNLKRIHQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFH 222

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YY+T+VAY+RLLYQVC LVHADLSEYNT++H  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 223 YYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIK 282

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           NVN YFEKMGI+IFPER+IFQFVISE L+KF GDYK+  DL  Y+ +NLPIK+T QDEAE
Sbjct: 283 NVNLYFEKMGINIFPERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAE 342

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E 
Sbjct: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF 394

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/412 (73%), Positives = 356/412 (86%), Gaps = 18/412 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS+ED+FD L +S  + +SDHINNQ+L+KY HKIKT+E S S+ KT+KDKANRATVENVL
Sbjct: 1   MSLEDRFDRLTVS--QRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVL 58

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+               PV  
Sbjct: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--------------APVID 104

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
            E    E  + +    R+EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 105 EETGQYEVLETDGL--RKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 162

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRI+QS VIPAP+P+E+KNNVLVMEFL+RG+GFASP+L+D+PY+DREEIFH
Sbjct: 163 WAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFH 222

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YYHT+VAY+RLLYQVC LVHADLSEYNT++H  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 223 YYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIK 282

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           NVN YFEKMG+ IFPER+IFQFVISE+L+KF GDY +  DL  Y+ +NLPIK+T QDEAE
Sbjct: 283 NVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAE 342

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E 
Sbjct: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF 394

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/413 (74%), Positives = 351/413 (84%), Gaps = 9/413 (2%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           M ++D F  L +S     ++H NN+ILDK+GHKIKT+EFS+SRGKTNKDKANRATVENVL
Sbjct: 1   MVLDDDFQKLDLS-----NNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVL 55

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAG-TGRPAGQVPTLVQEEMSVPVD 119
           DPRTM+FL+AL SRG+IS F+GC+STGKEANVYHAFAG T  P         E +    D
Sbjct: 56  DPRTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYD 115

Query: 120 PSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIK 179
           P    +  + ++   + R+EYAIKIYKTSILVFKDRERYVDGE+RFRN+RSQHNPRKMIK
Sbjct: 116 PY---SNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIK 172

Query: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239
           IWAEKEFRNLKRIYQS+VIP PKPIE+KNNVLVMEFLNRGDGFASPRLKD+PYKD  +I 
Sbjct: 173 IWAEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIV 232

Query: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDI 299
           HYYHT++ YIRLLYQVC LVHADLSEYNTLVH+ +LYVIDVSQSVEPEHPMSLDFLRMDI
Sbjct: 233 HYYHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDI 292

Query: 300 KNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEA 359
           KN+N YFE+MG+ IF ERIIFQF ISETLD FNG+Y + DDLR YV+ NLP+K  G+D+A
Sbjct: 293 KNINNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDA 352

Query: 360 EDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
           EDEIFRSL+LVRNL GLEERDFDRYT+G+FDLLKSL+AHDNEKNF+ASEQY  
Sbjct: 353 EDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQYNF 405

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/416 (73%), Positives = 353/416 (84%), Gaps = 24/416 (5%)

Query: 1   MSIEDKFDNLKISGGRGS-SDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENV 59
           MS+E  F  L +  G     DH+N++ILDKY H+IKT+E SL+RGKTNKDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVD 119
           LDPRTM+FL+ L+SRGV+S  +GCLSTGKEANVYHAFAG    A Q              
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGN---ANQ-------------- 103

Query: 120 PSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIK 179
           PSE + ++ KDE     + EYA+KIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIK
Sbjct: 104 PSEEAEKDSKDELV---KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 160

Query: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239
           IWAEKEFRNLKRI+QS VIP P+PIE+++NVLVMEFLNRG+GFASPRLKDHPYKDREEI 
Sbjct: 161 IWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIK 220

Query: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDI 299
           +YYHT+VAY+RLLYQVC LVHADLSEYNT+VH  RLY+IDVSQSV+PEHPMSLDFLRMDI
Sbjct: 221 YYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDI 280

Query: 300 KNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEA 359
           KN+N YFEK GIDIFPER+IFQF+ISETLDKF GDY +  DLRDYV +NLP+K+T +DEA
Sbjct: 281 KNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEA 340

Query: 360 EDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQYEL 412
           EDE+FRSL+LVRNLNGLEERDFDR+T+G+FDLLKSL+AHDN+K   NF ASEQ+E+
Sbjct: 341 EDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEI 396

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/412 (73%), Positives = 352/412 (85%), Gaps = 18/412 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS+ED FD L +S  + +SDHINNQ+L+KY HKIKT+E S +R KT+KDKANRATVENVL
Sbjct: 1   MSLEDNFDKLTVS--QRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVL 58

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+               PV  
Sbjct: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--------------APVID 104

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
            E    E  + +    R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 105 EETGKYEVLETDGP--RPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 162

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRIYQS VIPAPKPIE+KNNVLVMEFL+RG+GFASP+LKD+PY+DR EIFH
Sbjct: 163 WAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFH 222

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YY+T+VAY+RLLYQVC LVHADLSEYNT++H  +L++IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 223 YYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIK 282

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           NVN YFEKMGI IFPER+IFQFVISE+L+KF  DY +  DL  Y+ +NLPIK+T QDEAE
Sbjct: 283 NVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAE 342

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E 
Sbjct: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF 394

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/412 (74%), Positives = 346/412 (83%), Gaps = 11/412 (2%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSR-GKTNKDKANRATVENV 59
           MS+E+KF+ L I       D  NN++LDKY HKIK ++FS S+  KT KDKANRATVENV
Sbjct: 1   MSVEEKFEKLSIDH-HVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENV 59

Query: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTG--RPAGQVPTLVQEEMSVP 117
           LDPRTM+FLQALM+RG+IS F+GCLSTGKEANVYHAFAG G  R +G +P    +E S+ 
Sbjct: 60  LDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLP----DEESLL 115

Query: 118 VDPSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKM 177
              + L+ +E   + S   ++EYAIKI+KTSILVFKDRERYVDGEFRFRN+RSQHNPRKM
Sbjct: 116 ---ARLTQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKM 172

Query: 178 IKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREE 237
           IKIWAEKEFRNLKRIYQS  +P PKP+E+KNNVLVMEFLNRGDGFASPRL+D+PYKD + 
Sbjct: 173 IKIWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDS 232

Query: 238 IFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRM 297
           I  YY TLVAY+RL+YQVC LVHADLSEYN LVH  RLY+IDVSQSV+PEHPMSLDFLRM
Sbjct: 233 IRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRM 292

Query: 298 DIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQD 357
           DIKNVN YF KMGIDIFPERIIFQFVISE+LDKF GDYKSS DL +YV  NLP+K T QD
Sbjct: 293 DIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQD 352

Query: 358 EAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQ 409
           E EDE+FRSLYLVRNL GLEERDFDR+TEG+FDLLKSLLAHD EKNF A+EQ
Sbjct: 353 EMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQ 404

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/412 (71%), Positives = 353/412 (85%), Gaps = 11/412 (2%)

Query: 3   IEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVLDP 62
           + DKF N+K+S     +DHINNQI+DKYGHKIKT+E S+++ KTNKDKANRATVENVLDP
Sbjct: 4   LSDKFRNVKVS-----TDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDP 58

Query: 63  RTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSE 122
           RTM+FL AL++RGVI+  +GCLSTGKEANVYHAFAG+     Q     +E++     PS+
Sbjct: 59  RTMRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSK 118

Query: 123 --LSAQEDKDENSTD----RREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRK 176
             +   E++ + + D     R+EYAIKIYKTSIL+FKDRERYVDGEFRFRN+RSQHNPRK
Sbjct: 119 GNIDISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRK 178

Query: 177 MIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDRE 236
           MIKIWAEKEFRNLKRIYQ  VIP+P+PIE+KNNVLVMEFLNRGDGFASP+L+D+PYKDRE
Sbjct: 179 MIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDRE 238

Query: 237 EIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLR 296
           EI++YYH LV+Y+RLLYQVC LVHADLSEYNT+VH+ +LY+IDVSQSVEPEHPMSLDFLR
Sbjct: 239 EIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLR 298

Query: 297 MDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQ 356
           MDIKNVN YFEKMGI+IF E+ IFQFVI++TLDKF+GD  S +DLR YV  N+PIK T +
Sbjct: 299 MDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQE 358

Query: 357 DEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASE 408
           DEAEDE+FRSL+LVRNL GLEERDFDR+T+G+FDLLKSLLA DN+KN+ A++
Sbjct: 359 DEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQ 410

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/420 (71%), Positives = 354/420 (84%), Gaps = 12/420 (2%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS+E KFD LK+      S+HIN++IL+KYGHKIKT+E S ++GKTNKDKANRATVENVL
Sbjct: 1   MSLEGKFDKLKVH----ESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVL 56

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQ-----EEMS 115
           DPRTMK L+ L++RGVI  F+GCLSTGKEANVYHAFAG G+  G    L Q     + ++
Sbjct: 57  DPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLN 116

Query: 116 VPVDPSEL---SAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH 172
             + P ++   + + ++++    +R+EYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH
Sbjct: 117 KELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH 176

Query: 173 NPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPY 232
           NPRKMIKIWAEKEFRNL+RI+QS +IPAP+P+E+K N+LVMEFL RGDGFASPRL+DH Y
Sbjct: 177 NPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQY 236

Query: 233 KDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSL 292
           K REEI +YYHTLVAYIRLLYQVC LVHADLSEYNT+VH  +LYVIDVSQSVEPEHPMSL
Sbjct: 237 KTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSL 296

Query: 293 DFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIK 352
           DFLRMDIKNVN YFEKMGIDIFPERIIFQFVIS  LDKF GD +SS DLR+Y+   LP+K
Sbjct: 297 DFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVK 356

Query: 353 ATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
            T +DE +DEIFRSL+LVRNL+GLEERDFDR+T+G+FDLLK+L+A DN+KNF AS Q++ 
Sbjct: 357 CTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQFDF 416

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/428 (68%), Positives = 353/428 (82%), Gaps = 25/428 (5%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           M+I+DK + L ++      +H+N QIL++Y + IKT+E SL+RGKT+KDKANRATVENVL
Sbjct: 2   MNIDDKLEKLNLAN---RDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVL 58

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGT---------------GRPAGQ 105
           DPRTM+FL+++M+RG++S+F+GCLSTGKEANVYHAFAG                G P   
Sbjct: 59  DPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNI 118

Query: 106 VPTLVQEEMSVPVDPSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRF 165
             T  +   +   D +  S   D+ +N    ++EYA+KIYKTSILVFKDRERYVDGEFRF
Sbjct: 119 ESTKQKALTAESEDATSTSTATDEPKN----KKEYAVKIYKTSILVFKDRERYVDGEFRF 174

Query: 166 RNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASP 225
           RN+RSQHNPRKMIKIWAEKEFRNLKRIYQS VIP PKPIE+++NVLVMEFLNRGDGFASP
Sbjct: 175 RNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASP 234

Query: 226 RLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVE 285
           RLKDHPYKDREEI HYY+ ++AY+RLLYQVC LVHADLSEYN++VH+ +LY+IDVSQSV+
Sbjct: 235 RLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQ 294

Query: 286 PEHPMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYV 345
           PEHPMSLDFLRMDIKNVN YF+K+GIDIFPER+IFQF+ISE LDKF GDY+SSDDL  YV
Sbjct: 295 PEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYV 354

Query: 346 RQNLPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK--- 402
             NLP+K T +DEAEDE+FRSL+L+RNL GLEERDFDR+T+G+FDLLKSL+A++N K   
Sbjct: 355 ADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSE 414

Query: 403 NFAASEQY 410
           NF ASEQY
Sbjct: 415 NFTASEQY 422

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/420 (70%), Positives = 344/420 (81%), Gaps = 32/420 (7%)

Query: 1   MSIEDKFDNLKISGG-RGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENV 59
           MS++D+ DNL++        DHIN QILDK+ H IK +E S+SRGKT+KDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTG----RPAGQVPTLVQEEMS 115
           LDPRTM+FLQAL SRGVIS F+GC+STGKEANVYHAFA  G      AG+V   ++E   
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEE--- 117

Query: 116 VPVDPSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 175
                                R E AIKI+KTSILVFKDRERYVDGEFRFRN+RSQHNPR
Sbjct: 118 ---------------------RRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPR 156

Query: 176 KMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDR 235
           KMIKIWAEKEFRNLKRIYQS ++PAP+P+E+++NVLVMEFL+RG+GFASPRLKD+PYKDR
Sbjct: 157 KMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDR 216

Query: 236 EEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFL 295
           EE  HYY+T+VAYIRLLYQ C LVHADLSEYN +VH   LY+IDVSQSV+PEHPMSLDFL
Sbjct: 217 EETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFL 276

Query: 296 RMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATG 355
           RMDIKNVN YFE+M +D+FPER+IFQFVISETLDKF+GDY SS DLRDYV +NLP+K+  
Sbjct: 277 RMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGP 336

Query: 356 QDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQYEL 412
           QDEAEDE+FRSL+LVRNL GLEERDFDR+T G+FDLLKSL+AHDNE+    F ASEQ+EL
Sbjct: 337 QDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/415 (69%), Positives = 340/415 (81%), Gaps = 37/415 (8%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           M +ED+   LK+   R  +DH N +IL+K+ ++IKT+E SL++GKTNKDKANRATVENVL
Sbjct: 1   MDLEDQLRKLKL---RDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVL 57

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+AL++RGV+S F+GCLSTGKEANVYHA +G    A +               
Sbjct: 58  DPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE--------------- 102

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
                           + EYA+KIYKTSILVFKDRERYVDGEFRFRNARS HNPRKMIKI
Sbjct: 103 ----------------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKI 146

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRIYQS VIP P+P+EIK+NVLVMEFLNRGDGFASPRLKD+P+KDR+EI+H
Sbjct: 147 WAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYH 206

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YYH +V+YIRLLYQVC LVHADLSEYN++VHQ +LY+IDVSQSV+PEHPMSLDFLRMDIK
Sbjct: 207 YYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIK 266

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           N+N YFE+MGIDIFPER+IFQFVISETLDKF GD +S++DLR YV  NLP K T QDEAE
Sbjct: 267 NINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAE 326

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQYEL 412
           D++FRSL+LVRNL GLEERDFDR+T+G+FDLLKSL+A DN K    F ASEQY+L
Sbjct: 327 DQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDL 381

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/414 (71%), Positives = 341/414 (82%), Gaps = 24/414 (5%)

Query: 1   MSIEDKFDNLKISGGRGSS-DHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENV 59
           MS+ED    L +    G+  DHIN QILDK+ H IKT+E S++R KT+KDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVD 119
           LDPRTM+FLQAL SRGVIS F+GCLSTGKEANVYHAFAG G  + +     +E+  +P  
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSE-----EEQKVLP-- 165

Query: 120 PSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIK 179
                       N  +RRE YAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIK
Sbjct: 166 ------------NQGERRE-YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 212

Query: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239
           IWAEKEFRNLKRIYQS V+PAP+PIE+K+NVLVMEFLNRGDGFASP+LKD PYKDR+E  
Sbjct: 213 IWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETL 272

Query: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDI 299
           +YYHT+VAYIRLLYQ C LVHADLSEYNT+VH  +LYVIDVSQSV+PEHPMSLDFLRMDI
Sbjct: 273 YYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDI 332

Query: 300 KNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEA 359
           KN+N YFE+M IDIFPER IFQFVIS+ L+KF G+Y +++DLR YV + L  K+  +DEA
Sbjct: 333 KNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEA 392

Query: 360 EDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQY 410
           EDE+FRSL+LVRNL GLEERDFDR+T G+FDLLKSL+AHDN+K   NF ASEQY
Sbjct: 393 EDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/385 (73%), Positives = 326/385 (84%), Gaps = 19/385 (4%)

Query: 39  FSLSRGKTNKDKANRATVENVLDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAG 98
            S ++GKTNKDKANRATVENVLDPRTMKFL+AL SRGVIS F+GCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 99  --------TGRPAGQV---PTLVQEEMSVPVDPSELSAQEDKDENSTDRREEYAIKIYKT 147
                   T  P          ++E++   ++P E   Q+DK        +EYA+KI+KT
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDK--------KEYAVKIFKT 112

Query: 148 SILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIK 207
           SILVFKDRERYVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIE+K
Sbjct: 113 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVK 172

Query: 208 NNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYN 267
           NNVL+MEFLNRGDGFASPRL+D+PYKDREE+ HYYH  +AY+RL+YQVC LVHADLSEYN
Sbjct: 173 NNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYN 232

Query: 268 TLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISET 327
            L+H   +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YF++MGIDIFPER+IFQF+ISET
Sbjct: 233 ILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISET 292

Query: 328 LDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEG 387
           LDKF G+Y   +DLRDYV + LPIK T QDEAEDEIFRSLYLVRNL GLEERDFDRYT+G
Sbjct: 293 LDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDG 352

Query: 388 RFDLLKSLLAHDNEKNFAASEQYEL 412
           +FDLLKSL+AHDNEKNF+A+EQ+E+
Sbjct: 353 KFDLLKSLIAHDNEKNFSAAEQFEI 377

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/407 (71%), Positives = 338/407 (83%), Gaps = 27/407 (6%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           MS+ED+FD L IS GR   +H N QILDK+ + IKT+E S +R K++KDKANRATVENVL
Sbjct: 1   MSLEDQFDRLDISHGR---EHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVL 57

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL+++M+RGVIS F+GCLSTGKEANVYHAFAG                      
Sbjct: 58  DPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGE--------------------- 96

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
              S ++ KD +    ++E AIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 97  ---SIEDSKDGHVQGEKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 153

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNL+RI QS VIPAPKP+E+KNNVLVMEFL+RGDGFASPRLKDH + DR EI+H
Sbjct: 154 WAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYH 213

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           YYHT++AYIRLLYQVC LVHADLSEYN +VH  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 214 YYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIK 273

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           N+N YFEKMGIDIFPER+IFQFVISETL+KF+G+ KSS DL +YV + LP+K+T  D  E
Sbjct: 274 NINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEE 333

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAAS 407
           DEIFRSL+LVRNL GLEERDFDR+T+G+FDLLKSL+AHDNE++  A+
Sbjct: 334 DEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/415 (67%), Positives = 338/415 (81%), Gaps = 18/415 (4%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60
           M +E+K   LK+      S+H N++ILDK+ ++IKT+E S++RGKT+KDKANRATVENVL
Sbjct: 33  MDLENKLGRLKL---LDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVL 89

Query: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120
           DPRTM+FL++L+ RG+I+ F+GCLSTGKEANVYHAF       G    +V+++  V    
Sbjct: 90  DPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-------GNAVDIVEKQHKVIRQS 142

Query: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180
           S  S     D     ++ EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 143 SICS-----DSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 197

Query: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240
           WAEKEFRNLKRIY + VI  PKPIEIK+NVLVMEFLNRGDGFASP+LKD+PY DR+EI++
Sbjct: 198 WAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYY 257

Query: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           +YH +VAYIRLLYQVC LVHADLSEYN++VH+ +LY+IDVSQSV+PEHPMSLDFLRMDIK
Sbjct: 258 FYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIK 317

Query: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360
           N+N YF K+GI++F ER IFQFVISE L+KF GDY+S D L+ Y  + LP+K T +DE E
Sbjct: 318 NINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVE 377

Query: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNE---KNFAASEQYEL 412
           DEIFRSL+LVRNL GLEE DFDR+T G+FDLLKSL++ DN+   K F ASEQ+EL
Sbjct: 378 DEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFEL 432

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  509 bits (1311), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 254/413 (61%), Positives = 312/413 (75%), Gaps = 43/413 (10%)

Query: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRG-KTNKDKANRATVENV 59
           MS+E +FD L +S  +      N +IL+KY ++I+   F+  +G KT KDK++RATVENV
Sbjct: 1   MSLETEFDRLHVSKHQD-----NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENV 55

Query: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVD 119
           LDPRTMKFL AL +RGVIS F+GC+S+GKEANVYHAF     P GQ              
Sbjct: 56  LDPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFG----PEGQ-------------- 97

Query: 120 PSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIK 179
                              E AIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIK
Sbjct: 98  -------------------ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 138

Query: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239
           IWAEKEFRNL+RI+ S V+P   P+E+K+NVLVM+FLNRGDG  SPRLKD+ YKD  E+ 
Sbjct: 139 IWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVA 198

Query: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDI 299
           HYY+  +AY+RLLYQVC LVHADLSEYN +VHQ  L++IDVSQSVEP HPMSLDFLRMDI
Sbjct: 199 HYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDI 258

Query: 300 KNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEA 359
           KN+N YF KMG+ +F ER+IFQF+I+ETL+ F GDYK++DDL +Y+ ++LP+K   +   
Sbjct: 259 KNINAYFGKMGVSLFQERMIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGAD 318

Query: 360 EDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYEL 412
           EDEIFRSL+LVR+L GLEERDFDR+T+G+FDLLKSL+A+DNE+N    +Q E+
Sbjct: 319 EDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLKSLIANDNERNLQRPQQQEI 371

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 104/251 (41%), Gaps = 63/251 (25%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L++L+++  + S  G +  GKE+++Y                                 E
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIY---------------------------------E 111

Query: 128 DKDENSTDRREEYAIKIYK---TSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEK 184
             D+N   R     +KI++   TS    K+   Y+      R +    N   + K+ A K
Sbjct: 112 GSDKNGNKR----VLKIHRLGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANK 161

Query: 185 EFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHT 244
           E++ +  +Y ++    P+P +   +V+VME +    G+   RL+ H     ++I   Y  
Sbjct: 162 EYQFMSLLY-TKGFKVPEPFDNSRHVIVMELIR---GYPMRRLRKH-----KDIPKLYSD 212

Query: 245 LVAYIRLLYQVCHLVHADLSEYNTLV-------HQGRLYVIDVSQSVEPEHPMSLDFLRM 297
           L+ +I  L     L+H D +E+N ++       +     VID  Q +  +H  +  + + 
Sbjct: 213 LMKFILQLAN-SGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKR 271

Query: 298 DIKNVNFYFEK 308
           D+  +  +F+K
Sbjct: 272 DVDGIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 100/248 (40%), Gaps = 57/248 (22%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L+ +++R  I S  G +  GKE+++Y   A  G P                         
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGNP------------------------- 119

Query: 128 DKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFR 187
                    R     ++ +TS    ++   Y+      RN +   N   + ++ A KE++
Sbjct: 120 ---------RVMKIHRLGRTSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQ 164

Query: 188 NLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVA 247
            +  +Y ++    P+P +   +++VME +    G+   RL+ H     + I   Y  L+ 
Sbjct: 165 FMSMLY-TKGFEVPEPFDNSRHIIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMN 215

Query: 248 YIRLLYQVCHLVHADLSEYNTLV-------HQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           +I  L     L+H D +E+N ++       +     VID  Q +  +H  +  + + D+ 
Sbjct: 216 FIVKLGN-SGLIHCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVD 274

Query: 301 NVNFYFEK 308
            +  +F+K
Sbjct: 275 CIRRFFKK 282

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 100/253 (39%), Gaps = 65/253 (25%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L+ L+++ V+ S    +  GKE+++Y                                  
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQV-------------------------------- 112

Query: 128 DKDENSTDRREEYAIKIYK---TSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEK 184
             D N T +     +KI++   TS    K+   Y+      RN+R   N   + K+ A K
Sbjct: 113 -SDRNGTAK----VMKIHRLGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASK 161

Query: 185 EFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHT 244
           EF  +  +Y    I  P+      +V+VM+ +   DG+   RL++H     + I   Y  
Sbjct: 162 EFEFMSMLYAKGFI-VPQAYGCSRHVVVMDLI---DGYPMRRLREH-----KNIPKLYSD 212

Query: 245 LVAYIRLLYQVCHLVHADLSEYNTLVHQGR---------LYVIDVSQSVEPEHPMSLDFL 295
           L+ +I  L     L+H D +E+N ++               VID  Q +  +H  +  + 
Sbjct: 213 LMTFIVKLAN-SGLIHCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYF 271

Query: 296 RMDIKNVNFYFEK 308
           + D+  +  +F+K
Sbjct: 272 KRDVDCIRRFFKK 284

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 101/251 (40%), Gaps = 63/251 (25%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L+ +++R  + S    +  GKE+++Y                                  
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV-------------------------------S 113

Query: 128 DKDENSTDRREEYAIKIYK---TSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEK 184
           DKD N         IKI++   TS    ++   Y+      R +    N   + ++ A K
Sbjct: 114 DKDGNPR------VIKIHRLGRTSFHTVRNNRDYL------RKSSQGANWMHLSRLAANK 161

Query: 185 EFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHT 244
           E++ +  +Y S+    P+P +   +++VME +N   GF   RL+ H     + I   Y  
Sbjct: 162 EYQFMSMLY-SKGFKVPEPFDNSRHIVVMELIN---GFPMRRLRKH-----KNIPKLYSD 212

Query: 245 LVAYIRLLYQVCHLVHADLSEYNTLV-------HQGRLYVIDVSQSVEPEHPMSLDFLRM 297
           L+ +I  L     L+H D +E+N ++       +     VID  Q V  +H  +  + + 
Sbjct: 213 LMCFIVQLGN-SGLIHCDFNEFNVMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQR 271

Query: 298 DIKNVNFYFEK 308
           D+  +  +F+K
Sbjct: 272 DVDCIRRFFKK 282

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/248 (18%), Positives = 103/248 (41%), Gaps = 56/248 (22%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L+ +++R  + S  G +  GKE+++Y      G         V + M +           
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNG---------VSKVMKIH---------- 125

Query: 128 DKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFR 187
                          ++ +TS    ++   Y+      +N ++  N   + ++ A KE++
Sbjct: 126 ---------------RLGRTSFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQ 165

Query: 188 NLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVA 247
            +  +Y ++    P+P +   ++++M  +   +G+   RL+ H       I   Y+ L+ 
Sbjct: 166 FMSMLY-TKGFEVPEPFDNSRHIIIMGLI---EGYPMRRLRKH-----NNIPKLYNDLMK 216

Query: 248 YIRLLYQVCHLVHADLSEYNTLV-------HQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           +I  L     L+H D +E+N ++       +     VID  Q +  +HP +  + + D+ 
Sbjct: 217 FIVRLAN-SGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVD 275

Query: 301 NVNFYFEK 308
            +  +F+K
Sbjct: 276 CIRRFFKK 283

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/248 (19%), Positives = 98/248 (39%), Gaps = 57/248 (22%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L+ +++R  + S    +  GKE+++Y      G P                         
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYKVSDKNGNP------------------------- 119

Query: 128 DKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFR 187
                    R     ++ +TS    ++   Y+      +N+    N   + ++ A KE++
Sbjct: 120 ---------RVMKIHRLGRTSFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQ 164

Query: 188 NLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVA 247
            +  +Y S+    P+P +   +++VME +   +G+   RL+ H     + I   Y  L+ 
Sbjct: 165 FMSMLY-SKGFKVPEPFDNSRHIVVMELI---EGYPMRRLRKH-----KNIPKLYSDLMC 215

Query: 248 YIRLLYQVCHLVHADLSEYNTLV-------HQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           ++  L     L+H D +E+N +V             VID  Q V  +H  +  + + D+ 
Sbjct: 216 FVVELAN-SGLIHCDFNEFNIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVD 274

Query: 301 NVNFYFEK 308
            +  +F+K
Sbjct: 275 CIRRFFKK 282

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/248 (19%), Positives = 106/248 (42%), Gaps = 58/248 (23%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           L++L+++  + S    +  GKE+++Y           QV T   E + + +         
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIY-----------QVSTSTSEALVMKIH-------- 125

Query: 128 DKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFR 187
                          ++ +TS    K+   Y+    R ++A   H    +  + A KE++
Sbjct: 126 ---------------RLGRTSFHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQ 163

Query: 188 NLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVA 247
            +  +Y S+    P+P +   ++++ME++    G+   RL++H     +++   Y  L+ 
Sbjct: 164 FMNLLY-SKGFKVPRPYDNSRHIILMEYIK---GYPMRRLREH-----KDLPRLYSELMK 214

Query: 248 YIRLLYQVCHLVHADLSEYNTLVHQGR-------LYVIDVSQSVEPEHPMSLDFLRMDIK 300
           +I  L     L+H D +E+N ++             VID  Q +  +H  +  + + D++
Sbjct: 215 FIVQLGNH-GLIHCDFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVE 273

Query: 301 NVNFYFEK 308
            +  +F+K
Sbjct: 274 CIRRFFKK 281

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 117/299 (39%), Gaps = 74/299 (24%)

Query: 32  HKIKTNEFSLSRGKTNKDKANRATVENVLDPRTMKF--------------LQALMSRGVI 77
           H I  N    +   TN+   + A ++ V   R  K+              L++L+ +  I
Sbjct: 35  HLIHRNSGMRAMSGTNRSIGDLAKLKLVSKLRNAKYDGYVLTYNGFDYLALKSLLEKNAI 94

Query: 78  SSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQEDKDENSTDRR 137
            S    +  GKE+++Y           QV     + + + +                   
Sbjct: 95  YSVGNTIGVGKESDIY-----------QVSDAASQSLVMKIH------------------ 125

Query: 138 EEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEV 197
                ++ +TS    K +  Y+    R ++A    N  ++  + AE+E+  +  +Y S+ 
Sbjct: 126 -----RLGRTSFHTVKTKREYLK---RGQSA----NWMRLSHLSAEREYAYMCLLY-SKG 172

Query: 198 IPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCH 257
              PKP     + +VME++    G+   RL+ H       +   Y  L+A++  L     
Sbjct: 173 FSVPKPYANSRHAIVMEYIR---GYPMRRLRSH-----SNVPKLYSDLMAFVVKLAN-HG 223

Query: 258 LVHADLSEYNTLVH--------QGRLYVIDVSQSVEPEHPMSLDFLRMDIKNVNFYFEK 308
           ++H D +E+N ++         QG   VID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 224 MIHCDFNEFNIMIKDDIDDPEDQG-FVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 71/152 (46%), Gaps = 19/152 (12%)

Query: 166 RNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASP 225
           +N+++  N   + K+ A KE++ +  ++ S     P+P +   ++++ME +    GF   
Sbjct: 144 KNSKNGANWMFLSKLAAAKEYQFMSLLH-SRGFRVPEPFDHSRHIIIMELIK---GFPMT 199

Query: 226 RLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLV---------HQGRLY 276
           RL+ H     + +   Y  L+ +I  L     L+H D +E+N ++         +     
Sbjct: 200 RLRKH-----QNVPKLYSDLMKFILELGN-SGLIHCDFNEFNIMIKDKLDGSDPNDTGFI 253

Query: 277 VIDVSQSVEPEHPMSLDFLRMDIKNVNFYFEK 308
           VID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 254 VIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 99/248 (39%), Gaps = 57/248 (22%)

Query: 68  LQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQE 127
           ++++++R  + SF   +  GKE+++Y      G         V + M +           
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQVSDKNG---------VAKVMKIH---------- 125

Query: 128 DKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFR 187
                          ++ +TS    K+   Y+      +NA    N   +  + A+KE++
Sbjct: 126 ---------------RLGRTSFHTVKNNRDYLK-----KNAHGT-NWMHLSLLAAQKEYQ 164

Query: 188 NLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVA 247
            +  +Y    I  P+P +   ++++ME +   DGF    L++H       I   Y  L+ 
Sbjct: 165 FMSLLYSKGFI-VPQPYDNSRHIVLMELI---DGFPMRNLRNH-----SNIPKLYSDLMT 215

Query: 248 YIRLLYQVCHLVHADLSEYNTLVHQ-------GRLYVIDVSQSVEPEHPMSLDFLRMDIK 300
           +   L     L+H D +E+N ++             VID  Q +  +H  +  + + DI+
Sbjct: 216 FAVKLAN-SGLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIE 274

Query: 301 NVNFYFEK 308
            +  +F K
Sbjct: 275 CIRRFFRK 282

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 114/292 (39%), Gaps = 80/292 (27%)

Query: 42  SRGKTNKDKANRATVENVLDPRTMKF--------------LQALMSRGVISSFDGCLSTG 87
           S+  TN+   + A ++ V   R +K+              L+A++SR  I S    +  G
Sbjct: 45  SQSGTNRSIGDLAKLKLVSRMRNIKYDGFRLTYNGFDYLGLRAMLSRDTIYSVGNVIGVG 104

Query: 88  KEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDPSELSAQEDKDENSTDRREEYAIKIYK- 146
           KE++VY   A  G                       SA+               +KI++ 
Sbjct: 105 KESDVYRVSAKDG-----------------------SAR--------------VLKIHRL 127

Query: 147 --TSILVFKDRERYVDGEFRFRNARSQHNPRKMI-KIWAEKEFRNLKRIYQSEVIPAPKP 203
             TS    K+   Y+         R+Q      + ++ A KE++ +  +  S+    P+P
Sbjct: 128 GRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMS-LLHSKGFTVPEP 178

Query: 204 IEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADL 263
            +   ++++ME +   DG+    ++ H     + +   Y  L+ +I  L     L+H D 
Sbjct: 179 FDNSRHMILMELI---DGYPMRNMRLH-----KNLPKLYSDLMLFIVKLAN-HGLIHCDF 229

Query: 264 SEYNTLVHQG-------RLYVIDVSQSVEPEHPMSLDFLRMDIKNVNFYFEK 308
           +E+N ++             VID  Q +  +H  +  F + D+  +  +F+K
Sbjct: 230 NEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 18/137 (13%)

Query: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239
           + A KE+  L  +  S     P+  +   ++++MEF+    GF    L+ H       I 
Sbjct: 157 LAAHKEYEFLA-LLHSRGFQVPEAFDNSRHMVLMEFIK---GFPMKNLRTH-----SNIP 207

Query: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLV--------HQGRLYVIDVSQSVEPEHPMS 291
             Y  L+ +   L +   L+H D +E+N ++              VID  Q +  +HP +
Sbjct: 208 KLYSDLMKFAVDLAK-SGLIHCDYNEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDA 266

Query: 292 LDFLRMDIKNVNFYFEK 308
             F R DI+ +  +F+K
Sbjct: 267 EFFFRRDIECIRRFFKK 283

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 77/173 (44%), Gaps = 24/173 (13%)

Query: 143 KIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPK 202
           ++ +TS    K+   Y+      RN +S  +   + K+ A KE++ +  +Y       P+
Sbjct: 126 RLGRTSFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQ 177

Query: 203 PIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHAD 262
           P +   + ++ME +    G+   RL  H     + +   Y  L+ +I  L     L+H D
Sbjct: 178 PFDNSRHCVLMEHIR---GYPMRRLGKH-----KNLPKLYSDLMCFIVKLANHG-LIHCD 228

Query: 263 LSEYNTLVH---QGR----LYVIDVSQSVEPEHPMSLDFLRMDIKNVNFYFEK 308
            +E+N ++    +G       VID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 229 FNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 57/107 (53%), Gaps = 8/107 (7%)

Query: 166 RNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASP 225
           +N++   N   +  + A KE++ +  +Y ++    PKP +   ++++ME +   +G+   
Sbjct: 144 KNSKIGTNWMVLSGLAALKEYQFMSILYSND-FKVPKPFDNSRHIIIMELI---EGYPMR 199

Query: 226 RLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQ 272
           RL+    K++ ++   Y+ L+ +I  L     L+H D +E+N ++ +
Sbjct: 200 RLRS---KNQLKLAKLYNELMCFIVKLAD-HGLIHCDFNEFNIMIKE 242

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 149 ILVFKDRE-RYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVI 198
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S+VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 59/116 (50%), Gaps = 17/116 (14%)

Query: 144 IYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKP 203
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+   E    P+ 
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRVKLIE--NGPRC 366

Query: 204 IEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLV 259
           I++    +VM  + + DG        H   + +E+   +  ++    +L  +C LV
Sbjct: 367 IDLD---IVM--MKKSDG-------QHVLWNSDELVIPHSRMLERTFVLEPLCELV 410

>SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakly
           similar to uniprot|P36775 Saccharomyces cerevisiae
           YBL022C PIM1 Mitochondrial ATP-dependent protease
           involved in intramitochondrial proteolysis involved in
           degradation of misfolded proteins in mitochondria
           required for bigenesis and maintenance of mitochondria
          Length = 1041

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 8/95 (8%)

Query: 34  IKTNEFSLSRGKTNKDKANRATVENVLDPRTMKFLQALMSRGVISSFDGCLSTGKEANVY 93
           IKT   + + G T     N  TV N        F++++++RG+I   D  L     ++ Y
Sbjct: 824 IKTGNNAGANGPTITTTGNLGTVLNESIDIACSFVKSILTRGIIRGIDEALMKEFASSDY 883

Query: 94  H------AFAGTGRPAGQVPTLVQEEMSV--PVDP 120
           H      A +  G  AG   +L    +++  PVDP
Sbjct: 884 HLHVPMGAISKDGPSAGVAISLALLSLAIKRPVDP 918

>KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {ON}
           similar to uniprot|Q07950 Saccharomyces cerevisiae
           YLR020C YEH2 Steryl ester hydrolase catalyzes steryl
           ester hydrolysis at the plasma membrane involved in
           sterol metabolism
          Length = 509

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 21/107 (19%)

Query: 99  TGRPAGQVPTLVQEEMSVPVDPSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERY 158
           T  P+G  P   Q EM             ++++ +TD         Y   ++    ++R 
Sbjct: 413 TWFPSGGEPAKKQTEM-----------HSNQEKITTDE--------YPRILMFIPKQDRL 453

Query: 159 VDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIP-APKPI 204
           VDGE R  N  +   P+ + KIW   E+ +L  ++  +VI    KPI
Sbjct: 454 VDGE-RLINHFTNCEPQSLYKIWYIDEYSHLDVLWSHDVIERVGKPI 499

>CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highly
            similar to uniprot|P15442 Saccharomyces cerevisiae
            YDR283c GCN2 ser/thr protein kinase
          Length = 1648

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 64/136 (47%), Gaps = 12/136 (8%)

Query: 146  KTSILVFKDRERYVDGEFRFRNARSQHNP---RKMIKIWAEKEFRNLKRIYQSEVIPAPK 202
            KT+ L   +    +D  F F N      P   R + +I   K FR +K   +S++  A  
Sbjct: 1162 KTNTLFVVNHADILDNVFNFLNIDKAQRPVVSRLLSQIGFAKSFREIKAELKSQLNIAST 1221

Query: 203  PIEIKNNVLVMEFLNRGDGFASPRLK----DHPY-KDREEIFHYYHTLVAYIRLLYQVCH 257
             +   N++ + +F    +G A  RL+    D PY +  EE  ++   ++ Y++ L    +
Sbjct: 1222 AL---NDLEMFDFKLDFEG-AKKRLQKLMIDSPYLRKIEESLNHISKVLNYLKPLEVTRN 1277

Query: 258  LVHADLSEYNTLVHQG 273
            +V + LS YN+  ++G
Sbjct: 1278 IVLSPLSNYNSAFYKG 1293

>Kpol_2002.98 s2002 (234791..236497) [1707 bp, 568 aa] {ON}
           (234791..236497) [1707 nt, 569 aa]
          Length = 568

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 148 SILVFKDRE-RYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIP-APKPIE 205
           +IL+F  R+ R VDGE R  N    H P    KIW   E+ ++  ++ +++I    KPI 
Sbjct: 501 NILMFVPRQDRLVDGE-RLINHFINHEPHSTYKIWYIDEYSHMDVLWANDMIERIGKPI- 558

Query: 206 IKN 208
           +KN
Sbjct: 559 VKN 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,387,135
Number of extensions: 2231386
Number of successful extensions: 7213
Number of sequences better than 10.0: 50
Number of HSP's gapped: 7397
Number of HSP's successfully gapped: 50
Length of query: 497
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 383
Effective length of database: 40,409,475
Effective search space: 15476828925
Effective search space used: 15476828925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)