Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E039105.430ON62562520370.0
NCAS0F033505.430ON63962413770.0
Suva_2.5385.430ON62957513620.0
CAGL0L11638g5.430ON60858413541e-180
Smik_4.6325.430ON62757413501e-179
YDR365C (ESF1)5.430ON62857213211e-175
ZYRO0F09944g5.430ON61161612921e-171
KNAG0C049405.430ON64263112951e-171
TPHA0H017805.430ON62258112791e-169
KLTH0F16148g5.430ON64664512541e-165
Skud_4.6355.430ON62957612351e-162
SAKL0G02442g5.430ON62341211491e-149
Kpol_1016.85.430ON63742111121e-143
NDAI0B056405.430ON66944311111e-143
TDEL0E019505.430ON61741910891e-140
TBLA0A065405.430ON65944810671e-136
KLLA0E21165g5.430ON62743110611e-136
Kwal_55.214445.430ON64443710451e-133
AER259W5.430ON61941310201e-130
Ecym_47905.430ON63041510121e-129
YGR145W (ENP2)4.77ON70733880.049
Smik_6.2484.77ON70733880.055
Suva_7.4354.77ON70833870.074
CAGL0E03069g4.77ON75431850.13
NDAI0D037804.77ON70731850.13
Kpol_1041.354.77ON70131850.13
TDEL0F027204.77ON69431850.13
KLTH0H09130g4.77ON69531840.17
Skud_7.4674.77ON70833840.18
AFR468W4.77ON68931820.25
KAFR0F036304.77ON69331810.33
NCAS0A018504.77ON70131810.40
TBLA0A088904.77ON69831800.45
KNAG0D037404.77ON69631800.52
Ecym_14124.77ON71931790.67
TPHA0F005204.77ON71331780.76
Kwal_14.22584.77ON69931780.85
KLLA0A04653g4.77ON70031742.5
SAKL0H20922g4.77ON70231742.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03910
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   789   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   535   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   529   0.0  
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   526   e-180
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   524   e-179
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   513   e-175
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   502   e-171
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   503   e-171
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   497   e-169
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   487   e-165
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   480   e-162
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   447   e-149
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   432   e-143
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   432   e-143
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   424   e-140
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   415   e-136
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   413   e-136
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   407   e-133
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   397   e-130
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   394   e-129
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    39   0.049
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    39   0.055
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    38   0.074
CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [226...    37   0.13 
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    37   0.13 
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    37   0.13 
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    37   0.13 
KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} simila...    37   0.17 
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    37   0.18 
AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic ...    36   0.25 
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    36   0.33 
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    36   0.40 
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    35   0.45 
KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {O...    35   0.52 
Ecym_1412 Chr1 (856549..858708) [2160 bp, 719 aa] {ON} similar t...    35   0.67 
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    35   0.76 
Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W...    35   0.85 
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    33   2.5  
SAKL0H20922g Chr8 (1826071..1828179) [2109 bp, 702 aa] {ON} high...    33   2.5  

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/625 (67%), Positives = 424/625 (67%)

Query: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60
           MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD
Sbjct: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60

Query: 61  EGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXX 120
           EGS                            PKVDRARGEVP                  
Sbjct: 61  EGSKKELDDFEKYFEKEDEEEKKDTEETEEKPKVDRARGEVPSDYVSSSDEYTSSESEDS 120

Query: 121 XXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISR 180
                         IENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISR
Sbjct: 121 EEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISR 180

Query: 181 ICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEEGDAEKD 240
           ICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKE            LYEEGDAEKD
Sbjct: 181 ICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEGDAEKD 240

Query: 241 VDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFD 300
           VDSKA             AVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFD
Sbjct: 241 VDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFD 300

Query: 301 DEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKA 360
           DEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKA
Sbjct: 301 DEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKA 360

Query: 361 YLAXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGASDGESEVDMEITFTPGLDXXXXXX 420
           YLA              KNKLKALVGESLDFGTNGASDGESEVDMEITFTPGLD      
Sbjct: 361 YLASDSDESEEEVNENSKNKLKALVGESLDFGTNGASDGESEVDMEITFTPGLDEAKESE 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXXXXXXXXXX 480
                                            ENEKKEKMRSLHDKKSR          
Sbjct: 421 EEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDKKSRKAETENEEAA 480

Query: 481 XXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDL 540
                             QSLNKKAHFNLNEIIRS               IVEDDFKPDL
Sbjct: 481 KAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDL 540

Query: 541 SDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXLDTSTSK 600
           SDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL                    LDTSTSK
Sbjct: 541 SDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLDTSTSK 600

Query: 601 NGKNAISNIVNKLKKNGKQNNRTSV 625
           NGKNAISNIVNKLKKNGKQNNRTSV
Sbjct: 601 NGKNAISNIVNKLKKNGKQNNRTSV 625

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/624 (49%), Positives = 353/624 (56%), Gaps = 15/624 (2%)

Query: 1   MSE--GGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKT 58
           MSE    K +DD RFS IYNDPKF+  K K+LKI+LD RFSK+DLEIR KAKVDKYGRK 
Sbjct: 1   MSEDNSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKI 60

Query: 59  K---DEGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXX 115
               D  +                              VDRARGEVP             
Sbjct: 61  HEDNDMNNKELKDFDKYFEKEGESADEKKEEEEIETVTVDRARGEVPADYVSSSDEYTSS 120

Query: 116 XXXXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKG 175
                              ++   PETGDA+KTLAVVNLDWDHV+S+DLM+TFS F+PKG
Sbjct: 121 ESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPKG 180

Query: 176 GKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKA-SHKEXXXXXXXXXXXXLYEE 234
           GKI +I + PSEFGKER+QREE EGPP+ELFQKK KK   +  E            LYEE
Sbjct: 181 GKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKDLYEE 240

Query: 235 GDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVP 294
           GDA+KDVD++A             AVVYCN+++ ARAIYENCDGTEYESTANMFDLRYVP
Sbjct: 241 GDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRYVP 300

Query: 295 DGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIE 354
           DGM FDDEPRD+C+SLPKNYKP QFSTDALQHSNVKLTWDETPA+RVEVAKRAF+QKEIE
Sbjct: 301 DGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKEIE 360

Query: 355 DMDFKAYLAXXXXXXXXXXXXXXKNKLKALVGESLD------FGTNGASDGE-SEVDMEI 407
           DMDFKAYLA              KNKLK+LVG+SL       FG+    +GE  EVDMEI
Sbjct: 361 DMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGEDEEVDMEI 420

Query: 408 TFTPGLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDK 467
           TF PGL                                        + EKK+K++SL  K
Sbjct: 421 TFDPGLSEGVEKTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKSLKGK 480

Query: 468 KSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXX 527
           K                                +NKKAHFN+ EI+RS            
Sbjct: 481 KHNDSTEGDASTAKSKAELELLMMDDEDDTETGINKKAHFNMKEILRSEKEKSKKGKYQD 540

Query: 528 XXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILXXXXXXXXXXXXXX 587
              IVED+FKPDL+DPRFKEVFEDHDFAIDPS+PEFK+T AMK+IL              
Sbjct: 541 KRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRSSKNAQKK 600

Query: 588 XXXXXXLDTSTSKNGKNAISNIVN 611
                 +D     N  + ISNIV+
Sbjct: 601 KRSHSLMDNQA--NETSDISNIVS 622

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/575 (51%), Positives = 338/575 (58%), Gaps = 10/575 (1%)

Query: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSXX 65
           K+S D RF+ IYNDPKFKN +T+  KI+LDSRFSK+DLE+++K+KVDKYGRK KD  +  
Sbjct: 8   KESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKD--AHN 65

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXX 125
                                       VDRARGEVP                       
Sbjct: 66  TKELEDFDKYFEKEAENEEDTEADVKATVDRARGEVPNDYVSSGDEFTSSDSESSGESEI 125

Query: 126 XXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYP 185
                     E+ KPE+GDASKTLAVVNLDWDHVKS DLM+TFS FVPKGGKI RI +YP
Sbjct: 126 ESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISVYP 185

Query: 186 SEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXX---XXLYEEGDAEKDVD 242
           SEFGKER+QREE+EGPPKELFQ+K + KAS KE               LYEEGDA+KDVD
Sbjct: 186 SEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDADKDVD 245

Query: 243 SKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDE 302
           S+A             A+V C++I TARAIYENCDGTEYESTANMFDLRYVPDGMTFDD 
Sbjct: 246 SRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDT 305

Query: 303 PRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYL 362
            RD C++LPKNY+P QFSTDALQHSNVKLTWDETPADRVEVAKRAF+QKEI+DMDFKAYL
Sbjct: 306 ARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYL 365

Query: 363 AXXXXXXXXXXXXXXKNKLKALVGESLDFGT--NGASDG-ESEVDMEITFTPGLDXXXXX 419
           A              K+KLK+LVG  L F +    A+DG E EVDMEITFTP L+     
Sbjct: 366 ASDSDESDEEVNEDAKSKLKSLVG-GLGFNSKKENANDGDEEEVDMEITFTPALEGGDEK 424

Query: 420 -XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXXXXXXXX 478
                                              E EK+ K +S + K           
Sbjct: 425 PIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKKHVADEEEIKNN 484

Query: 479 XXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKP 538
                                S+N KAHFN+NEI+RS               IVED+F P
Sbjct: 485 AKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDNFTP 544

Query: 539 DLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
           DL DPRFKEVFEDHDFAIDP+QPE+K T AM +IL
Sbjct: 545 DLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKIL 579

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  526 bits (1354), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 296/584 (50%), Positives = 338/584 (57%), Gaps = 24/584 (4%)

Query: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60
           MSE  +KS+DPRFSRIYNDPKFK + +K LKI+LD RF K+DLE+  +AKVDKYGRK K 
Sbjct: 1   MSE--EKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIK- 57

Query: 61  EGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPK----VDRARGEVPXXXXXXXXXXXXXX 116
           EGS                             K    VDRARGEVP              
Sbjct: 58  EGSSKDIEDFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSD 117

Query: 117 XXXXXXXXXXXXXXXXXXI--ENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPK 174
                                E TK ETGDA+KTLA VNLDWDHV+S D+MVTFSSF+PK
Sbjct: 118 SDTSGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPK 177

Query: 175 GGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEE 234
           GGKI +ICIYPSEFGKER++REEVEGPP+ELFQK  KKK  +              LYEE
Sbjct: 178 GGKIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEE 237

Query: 235 GDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVP 294
           G+A+  VD +A             AV+YCNN+++A+AIYENCDGTEYESTAN+ DLRYVP
Sbjct: 238 GNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVP 297

Query: 295 DGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIE 354
           DGM FDDEP+D+C  LPKNYKP QFSTDALQHSNVKLTWDETP DRVEVAKRAF+QKEIE
Sbjct: 298 DGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIE 357

Query: 355 DMDFKAYLAXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGASDGESEVDMEITFTPGLD 414
           DMDFKAYLA              KNKLK+LVGESL       SD +  +DMEITFTPGLD
Sbjct: 358 DMDFKAYLASDSDESEEEVNEEAKNKLKSLVGESLKIDGKDGSDEDEGMDMEITFTPGLD 417

Query: 415 XXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKS 469
                                                       E EKK+K++S HD+  
Sbjct: 418 EANAEGEDKDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKHDE-- 475

Query: 470 RXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXX 529
                                          +N KAHFN+NEI+RS              
Sbjct: 476 --------PLSDKKKAELELLMMDENESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQ 527

Query: 530 XIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
            IVEDDFKP+L D RFKEVFEDHDFAIDPSQPEFK+T AMK+IL
Sbjct: 528 RIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEIL 571

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  524 bits (1350), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 287/574 (50%), Positives = 338/574 (58%), Gaps = 10/574 (1%)

Query: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSXX 65
           K+  D RF+ IY+DPKFKN +TK  KI+LDSRFSK+DLE+++K+KVDKYGRK K+  +  
Sbjct: 8   KEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKN--TQN 65

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXX 125
                                       VDRARGE+                        
Sbjct: 66  NKELEDFDKYFQKEAENDEDTEASVKTVVDRARGEISGDYVSSSDEFTSSDSESSEQSEV 125

Query: 126 XXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYP 185
                    IE+ KPE GD SKTLAVVNLDWDHVKS DLM+TFSSFVPKGGK+ R+ IYP
Sbjct: 126 ESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYP 185

Query: 186 SEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXX---XXLYEEGDAEKDVD 242
           SEFGKER+QREEVEGPPKELFQKKNK K S K+               LYEEGDA+KDVD
Sbjct: 186 SEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDADKDVD 245

Query: 243 SKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDE 302
           S+A             A+VYC++I T++AIY+NCDGTEYESTANMFDLRYVPDGMTFDD 
Sbjct: 246 SRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDA 305

Query: 303 PRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYL 362
            RDEC  LPKNY+P QFSTDALQHSNVKLTWDETPADR+EVAKRAF+QKEI+DMDFKAYL
Sbjct: 306 VRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYL 365

Query: 363 AXXXXXXXXXXXXXXKNKLKALVGESLDFGT--NGASDGESEVDMEITFTPGLDXXXXX- 419
           A              KNKLK+LVG  ++F +      D + EVDMEITFTP L+      
Sbjct: 366 ASDSDESDEQIDEDAKNKLKSLVG-GINFNSKKENVKDSDEEVDMEITFTPALEGGNEQP 424

Query: 420 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXXXXXXXXX 479
                                             E +KK K++S++ KK           
Sbjct: 425 SEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSIN-KKYAEGEEDIKNN 483

Query: 480 XXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPD 539
                               ++N KAHFN+NEI+RS               IVED+F PD
Sbjct: 484 AKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDNFTPD 543

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
           L+DPRFKEVFEDHDFAIDP+QPE+K T AM +IL
Sbjct: 544 LNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKIL 577

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  513 bits (1321), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 292/572 (51%), Positives = 337/572 (58%), Gaps = 13/572 (2%)

Query: 10  DPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSXXXXXX 69
           D RF+ IY+DPKFKN KTK  KI+LDSRFSK+DLE+++K+KVDKYGRK K+  +      
Sbjct: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKN--AQNNREL 69

Query: 70  XXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXXXXXX 129
                                   VDRARGEVP                           
Sbjct: 70  EDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDDYVSSSDEFTSSDSESSGESEVESEE 129

Query: 130 XXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYPSEFG 189
                IEN KPE+GD SK LAVVNLDWDHVKS DLM+TFSSFVPKGGKI R+ IYPSEFG
Sbjct: 130 ENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFG 189

Query: 190 KERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXX---XXLYEEGDAEKDVDSKAX 246
           KER+QREEVEGPPKELFQKKNK K S K+               LYEEGDA+KDVDS+A 
Sbjct: 190 KERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDADKDVDSRAL 249

Query: 247 XXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDE 306
                       A+VYC++  T++AIY+NCDGTEYESTANMFDLRYVPDGMTFDD+ RDE
Sbjct: 250 RQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDE 309

Query: 307 CNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLAXXX 366
           C+ LPKNY+P QFSTDALQHS+VKLTWDETPADRVEVAKRAF+QKEI+DMDFKAYLA   
Sbjct: 310 CSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDS 369

Query: 367 XXXXXXXXXXXKNKLKALVGESLDFGTNGA----SDGESEVDMEITFTPGLDXXXXXXXX 422
                      KNKLK+LVG   DFG N      +D + EVDMEITFTP L+        
Sbjct: 370 DESDGQVDEEAKNKLKSLVG---DFGFNSKKETPNDEDEEVDMEITFTPALEGGNEKSSE 426

Query: 423 XXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXXXXXXXXXXX 481
                                           E +KK K++S++ K +            
Sbjct: 427 DKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEEEIEKNAKS 486

Query: 482 XXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLS 541
                             ++N KAHFN+NEI+RS               IVED F PDL 
Sbjct: 487 KAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLE 546

Query: 542 DPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
           DPRFKEVFEDHDFAIDP+QPEFK T AM +IL
Sbjct: 547 DPRFKEVFEDHDFAIDPTQPEFKGTQAMSKIL 578

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  502 bits (1292), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/616 (47%), Positives = 344/616 (55%), Gaps = 33/616 (5%)

Query: 4   GGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGS 63
           G K S DPRF+ I NDPKF+N K K LK++LD RFSK+DL++R KAKVDKYGR+   E  
Sbjct: 6   GSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGESK 65

Query: 64  XXX------XXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXX 117
                                               VDRARGE+P               
Sbjct: 66  DLKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESEDSESDL 125

Query: 118 XXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGK 177
                            +E  KPE+GD SKTLAVVNLDWDHV++ADLM+TFSSF+P GGK
Sbjct: 126 SEEESEADVAEA-----VEEAKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK 180

Query: 178 ISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEEGDA 237
           I +ICIYPSEFGKER+QREE EGPP+E+F   NKKK  H E            LYEEGDA
Sbjct: 181 IEKICIYPSEFGKERMQREEKEGPPREIF---NKKKKHHDEDSDSDVDIRD--LYEEGDA 235

Query: 238 EKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGM 297
           +K+VD+ A             A+VYCNN++T  +IY NCDGTEYESTAN+FDLRYVP+GM
Sbjct: 236 DKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGM 295

Query: 298 TFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMD 357
            FDDEP+DEC  LPKNYKP++FSTDALQHSNVKLTWDETP DR+EV+KRAFSQKE+EDMD
Sbjct: 296 EFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMD 355

Query: 358 FKAYLAXXXXXX--XXXXXXXXKNKLKALVGESLDFGTNGASDGESEVDMEITFTPGLDX 415
           F+AYLA                KNKLK+LVG+SL +G       E E DMEITFTPGLD 
Sbjct: 356 FQAYLASGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQ----QEEEPDMEITFTPGLDD 411

Query: 416 XX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXXXX 474
                                                  E EKKEK+RS  +KK      
Sbjct: 412 SKPQADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQ----V 467

Query: 475 XXXXXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVED 534
                                   +SLNKKAHFN+NEI++S               I+ED
Sbjct: 468 EDESDAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMED 527

Query: 535 DFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXL 594
           +FKPDL+DPRF EVFE+ DFAIDPSQPE+K T AMK+IL                     
Sbjct: 528 EFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLA------ 581

Query: 595 DTSTSKNGKNAISNIV 610
           D   SK+ K+ ISNIV
Sbjct: 582 DDGDSKDNKHDISNIV 597

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 303/631 (48%), Positives = 350/631 (55%), Gaps = 29/631 (4%)

Query: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD-EGSX 64
           K S DPRFS +YNDPKF++ K K LK++LDSRFSK+DLE++ KAKVDKYGRK K+ + + 
Sbjct: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDANK 63

Query: 65  XXXXXXXXXXXXXXXXXXXXXXXXXXXPK---VDRARGEVPXXXXXXX---XXXXXXXXX 118
                                      P    VDRARGEVP                   
Sbjct: 64  KELEDFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSESSG 123

Query: 119 XXXXXXXXXXXXXXXXIE--NTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGG 176
                           IE  + KPE+GD SKTLAVVNLDWDHVKS DLM+TF+ F+PKGG
Sbjct: 124 SSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGG 183

Query: 177 KISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKK--------ASHKEXXXXXXXXXX 228
           KI RICIYPSEFGKERL REE EGPPKELF KK  KK        A   +          
Sbjct: 184 KIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSDVDI 243

Query: 229 XXLYEEGDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMF 288
             LYEEGDAEKD+DSKA             AVVYCNN++TA+AIY+NCD TEYESTANMF
Sbjct: 244 KDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMF 303

Query: 289 DLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAF 348
           DLRYVP+GMTFDD+PRDEC +LPKNYKP+ F+TDALQHSNVKLTWDETPADRVE+AKRAF
Sbjct: 304 DLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAF 363

Query: 349 SQKEIEDMDFKAYLAXXXXXXXXXXXXXXKNKLKALVGESLDF-----GTNGASDGESEV 403
           SQKEI+DMDFKAYLA              KN+LKALVG +L       G     D E  +
Sbjct: 364 SQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDEEGM 423

Query: 404 DMEITFTPGLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEN---EKKEK 460
           DMEITFTPGLD                                       +N   EK++K
Sbjct: 424 DMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEKRDK 483

Query: 461 MRSLHDKKSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXX 520
           ++SL   +                               +LNKK HFN+NEI+RS     
Sbjct: 484 LKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEKEKK 543

Query: 521 XXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILXXXXXXX 580
                     IVED+FKPDLSD RFKEVFEDHDFAIDPS+PEFK+T AM++IL       
Sbjct: 544 KKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERSNRA 603

Query: 581 XXXXXXXXXXXXXLDTSTSKNGKNAISNIVN 611
                         DTS     K  IS IV+
Sbjct: 604 RSKGKKRKSAEQSTDTS----DKTDISQIVS 630

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  497 bits (1279), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 282/581 (48%), Positives = 336/581 (57%), Gaps = 13/581 (2%)

Query: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60
           MS     + D RFS ++NDPKFKNA+ K+LKI+LDSRFSK DLE+  KA+VDKYGRK   
Sbjct: 1   MSSDKPVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKI-- 58

Query: 61  EGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXX 120
             S                            P +DRARGEVP                  
Sbjct: 59  --SNLNNQEAKDFDKYFEKEEDGKGEEIAVKPLIDRARGEVPSDYQSSLDDYTSSESEDS 116

Query: 121 XXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISR 180
                         IE TKPE+GD+SKT+AVVNLDWDHVK+ DL+VTFSSFVPKGGKI R
Sbjct: 117 EDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIER 176

Query: 181 ICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXX-XXXXXXXXXXLYEEGDAEK 239
           I I+PSEFGK+R++REE+EGPPKELFQKK KK +                 LYEEGD +K
Sbjct: 177 IAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEEGDVDK 236

Query: 240 DVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTF 299
           +VDSK+             AVV+CNNI TA AIY NCDGTEYESTAN+FDLRYVPDGM F
Sbjct: 237 EVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDF 296

Query: 300 DDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFK 359
           +D+P DEC  LPKNY P+ F+TDALQHSNVKLTWDETPADRVE+AKRAF+QKEI++MDFK
Sbjct: 297 EDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFK 356

Query: 360 AYLAXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGASDGES-----EVDMEITFTPGL- 413
           AYLA              KNKLK+LVG S+  G     D +S     EVDMEITFTPGL 
Sbjct: 357 AYLA-SDSEESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFTPGLA 415

Query: 414 -DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXX 472
            +                                       E EK+EK++SL  ++S+  
Sbjct: 416 ENDNNDKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQEKREKLKSLKTERSKKS 475

Query: 473 XXXXXXXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIV 532
                                      ++NKKAHFN+ EI+RS               IV
Sbjct: 476 EDTESDKNAKAELELLMMDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKIV 535

Query: 533 EDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
           ED+FK DL+DPRF E+FEDHDFAIDP+Q E+K+T AMK+IL
Sbjct: 536 EDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEIL 576

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  487 bits (1254), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 284/645 (44%), Positives = 339/645 (52%), Gaps = 42/645 (6%)

Query: 3   EGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEG 62
           +GG  S DPRF+ + NDPKF+  + K  KI+LD RFSK+DLE + KA+VDKYGR+ K + 
Sbjct: 9   QGG--SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQE 66

Query: 63  SX--------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVP 102
           S                                                  +DRARGEV 
Sbjct: 67  SKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVH 126

Query: 103 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSA 162
                                           IE  + ++GD+SKTLAVVNLDWDHVKS 
Sbjct: 127 SDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKST 186

Query: 163 DLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXX 222
           DLMVTFSSFVPKGGKI+R+ IYPSEFGKERL +EE EGPP+E+F+ K K K SH +    
Sbjct: 187 DLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDE 246

Query: 223 XXXXXXXXLYEEGDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYE 282
                   LYEEGDA+ D D+K+             AVVYCNN  TA +IY+NCDGTEYE
Sbjct: 247 ELTVKD--LYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGTEYE 303

Query: 283 STANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVE 342
           STANMFDLRYVPDGM FDDE RDEC+S+PKNY+P +FSTDALQHS VK TWDETPADR  
Sbjct: 304 STANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTA 363

Query: 343 VAKRAFSQKEIEDMDFKAYLAXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGA-----S 397
           +AKRAF+Q+EIEDMDFKAYLA              KNKLK+LV +S+  G          
Sbjct: 364 MAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPK 423

Query: 398 DGESEVDMEITFTP----GLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 453
           DGES+VDM+ITF P    G                                         
Sbjct: 424 DGESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQA 483

Query: 454 ENEKKEKMRSLHDKKSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEII 513
           E++KK+K+     K++R                              LNKKAHFN+NEI+
Sbjct: 484 EDDKKQKL-----KEARRKPEPSATDSKSQAELELLMMDDSEEANSKLNKKAHFNMNEIV 538

Query: 514 RSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
           RS               IVED+FKPDL+DPRF EVFEDHDFAIDPSQPEFK T AMKQIL
Sbjct: 539 RSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQIL 598

Query: 574 XXXXXXXXXXXXXXXXXXXXLDTSTSKNGKNAISNIVNKLKKNGK 618
                               +      +G N +  +VNKLK + K
Sbjct: 599 QERNKRSQKGKNKKREANGDI---AEPSGNNDLKGLVNKLKHSSK 640

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  480 bits (1235), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 287/576 (49%), Positives = 335/576 (58%), Gaps = 12/576 (2%)

Query: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSXX 65
           K+S D RF+ I +DPKFKN +T+  KI+LDSRFSK+DLE+++K+KVDKYGRK KD  +  
Sbjct: 8   KESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKD--ARN 65

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXX 125
                                       VDRARGEVP                       
Sbjct: 66  NKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPSDYVSSSDEFTSSDSESSGESEV 125

Query: 126 XXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYP 185
                     E+   E+GD SKTLAVVNLDWDHVKS DLM+TFSSFVP+GGKI RI I+P
Sbjct: 126 ESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFP 185

Query: 186 SEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXX---XXLYEEGDAEKDVD 242
           SEFG+ER++REEVEGPPKELFQKKNK K + ++               LYEEGDA+KDVD
Sbjct: 186 SEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDADKDVD 245

Query: 243 SKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDE 302
           S+A             AVV C++  +A+AIY+NCDGTEYESTANMFDLRYVPDGMTFDD 
Sbjct: 246 SRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDA 305

Query: 303 PRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYL 362
            RDEC SLPKNY+P QFSTDALQHSNVKLTWDETPADR+EVAKRAF+QKEI+DMDFKAYL
Sbjct: 306 ARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYL 365

Query: 363 AXXXXXXXXXXXXXXKNKLKALVGESLDFGT--NGASDG--ESEVDMEITFTPGLDXXXX 418
           A              KNKLK+LVG  LDF     GA+DG  E EVDMEITFTP L+    
Sbjct: 366 ASDSDESDEQVDEDAKNKLKSLVG-GLDFNMKKKGANDGKEEGEVDMEITFTPALEGENE 424

Query: 419 X-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENEKKEKMRSLHDKKSRXXXXXXX 477
                                               E +KK K++S++ KK         
Sbjct: 425 KPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVN-KKHVADEEEIK 483

Query: 478 XXXXXXXXXXXXXXXXXXXXXQSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFK 537
                                 S+N KAHF++ EI+RS               IVED F 
Sbjct: 484 NNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFA 543

Query: 538 PDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQIL 573
           PDL DPRFKEVFEDHDFAIDP+QPE+K T AM  IL
Sbjct: 544 PDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTIL 579

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  447 bits (1149), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 238/412 (57%), Positives = 273/412 (66%), Gaps = 8/412 (1%)

Query: 8   SDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD-EGSXXX 66
           ++DPRFS I++DPKFK+AK K+LKI+LD RFSK+DLEI+ KAKVDKYGR+ KD +     
Sbjct: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXXX 126
                                      +DRARGEVP                        
Sbjct: 71  DFERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSSESEEESENSEL 130

Query: 127 XXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYPS 186
                   IE +KP TGDA++ LAVVNLDWDHVKS DLMVTFSSFVPKGGKI +I IYPS
Sbjct: 131 ESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPS 190

Query: 187 EFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEEGDAEKDVDSKAX 246
           EFGKER+QREEVEGPP+ELFQ K KKK+  K+            LYEEGDAEKD DSKA 
Sbjct: 191 EFGKERMQREEVEGPPRELFQGK-KKKSQRKDGDDSDVDIKD--LYEEGDAEKDYDSKAL 247

Query: 247 XXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDE 306
                       AVV+CNN++TA AIY+NCDGTEYESTANMFDLRYVP+GM F DEP+DE
Sbjct: 248 RRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDE 307

Query: 307 CNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLAXXX 366
           C  +PKNYKP QFSTDALQHSNVKLTWDETPA+RVE++KRAF+QKEIEDMDFKAYLA   
Sbjct: 308 CEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDS 367

Query: 367 XXXXXXXXXXXKNKLKALVGESLDFGTNGA---SDGE-SEVDMEITFTPGLD 414
                      +NKLK+LV ES+  G       SD E  +VDMEITFTPGLD
Sbjct: 368 EGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLD 419

 Score =  108 bits (269), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 501 LNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQ 560
           LNKKAHFN+ EI+RS               IVED+FKPDL+DPRF+EVFEDHDFAIDPSQ
Sbjct: 505 LNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQ 564

Query: 561 PEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXLDTSTSKNGKNAISNIVNKLKKNGKQN 620
           PEFK T AMK+IL                    L+     N  N ++ +V KLK+  K++
Sbjct: 565 PEFKGTTAMKEIL---KERNQRVSKKKGNKKRKLEQPRKNNNSNELNGLVAKLKRRNKKS 621

Query: 621 NR 622
            +
Sbjct: 622 RK 623

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  432 bits (1112), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 272/421 (64%), Gaps = 13/421 (3%)

Query: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSXX 65
           K+S DPRFS IY+DPKFKN+K K++KI+LD RF K DL+I++K+KVDKYGRK KD     
Sbjct: 8   KQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDVKDNK 67

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXPKV-DRARGEVPXXXXXXXXXXXXXXXXXXXXXX 124
                                      KV DRARGEVP                      
Sbjct: 68  ELEDFDKYFEKEDEEDKEEEIGTEAKVKVLDRARGEVPSDYESSSEEFTSSDSESSGESE 127

Query: 125 XXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIY 184
                     +E +KPE+GD+SKTLAVVNLDWD+VKS DLM+TFSSF+PKGGKI +ICIY
Sbjct: 128 VDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGKIEKICIY 187

Query: 185 PSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXX------XXLYEEGDAE 238
           PSEFGKER+ REEVEGPP+ELF KK  KK+S K                   LYEEGDAE
Sbjct: 188 PSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIRELYEEGDAE 247

Query: 239 KDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMT 298
           KDVDSKA             AVVYCNNI +A +IYENCDGTEYES+AN+FDLRYVPDG  
Sbjct: 248 KDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLRYVPDGTE 307

Query: 299 FDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDF 358
           FDDEPRDEC  LPKNYK  QF+TDALQHSNVKLTWDETPADRVE+AKRAF+QKEIE+MDF
Sbjct: 308 FDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIEEMDF 367

Query: 359 KAYLAXXXXXXXXXXXXXXKNKLKALVGESLDFG------TNGASDGESEVDMEITFTPG 412
           KAYLA              KNKLK+LV +S   G        G ++ E +VDMEITFTPG
Sbjct: 368 KAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDDVDMEITFTPG 427

Query: 413 L 413
           L
Sbjct: 428 L 428

 Score =  105 bits (261), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%)

Query: 500 SLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPS 559
           +LNKKAHFN+NEI+RS               IVEDDFKPDL+DPRFKE+FEDHDFAIDP+
Sbjct: 517 TLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPT 576

Query: 560 QPEFKQTNAMKQIL 573
           Q EFK+T AMK+IL
Sbjct: 577 QSEFKETTAMKEIL 590

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  432 bits (1111), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 269/443 (60%), Gaps = 34/443 (7%)

Query: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD----- 60
           K+S DPRF++IYNDPKF+  K K LKI+LD RFSK+DLEIR K+KVDKYGRK  D     
Sbjct: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68

Query: 61  -----------------EGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPX 103
                            E                                +DRARG+VP 
Sbjct: 69  KEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDRARGDVPA 128

Query: 104 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSAD 163
                                          +   +PE+G+ SKTLAVVNLDWDHVKS+D
Sbjct: 129 DYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLDWDHVKSSD 188

Query: 164 LMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXX 223
           LM+TFSSF+P+GG+I  I IYPSEFGKER+QRE+VEGPPKELFQK+ KK +  K+     
Sbjct: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKSKKISDEA 248

Query: 224 XXXXXXX-----LYEEGDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDG 278
                       LYEEGDA+KDVD+KA             AVVYCNNI+TA AIY+NCDG
Sbjct: 249 NDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETATAIYQNCDG 308

Query: 279 TEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPA 338
           TEYESTANMFDLRYVPDGM F DEPRD+C+SLPKNYKP QFSTDALQHSNVKLTWDETP 
Sbjct: 309 TEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPV 368

Query: 339 DRVEVAKRAFSQKEIEDMDFKAYLAXXXXXXXXXXXXXXKNKLKALV-----GESLDFGT 393
           +R EVAKRAF+QKEI+DMDFKAYLA              KNKLKALV     G    FG 
Sbjct: 369 ERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGGFGSREIFGG 428

Query: 394 NGASDG--ESEVDMEITFTPGLD 414
            GA  G  E EVDMEITF P LD
Sbjct: 429 KGAKAGEDEDEVDMEITFNPALD 451

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 2/114 (1%)

Query: 500 SLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPS 559
           ++N KAHFN+NEI+RS               IVED+FKPDL+DPRFKEVFEDHDFAIDPS
Sbjct: 540 TINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPS 599

Query: 560 QPEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXLDTSTSKNGKNAISNIVNKL 613
           +PEFK+T AMK+IL                     + + +++    I+NIVNKL
Sbjct: 600 RPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSD--ITNIVNKL 651

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 230/419 (54%), Positives = 270/419 (64%), Gaps = 11/419 (2%)

Query: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60
           MSE  K+S DPRFS+IY+DPKF N KTK  K++LD RFSK+DLEI+ K KVDKYGR+ +D
Sbjct: 1   MSE--KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRD 58

Query: 61  EGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXX 120
                                            VDRARGEVP                  
Sbjct: 59  --VEDSKESKDFDKYFEQSDEEKKKDKDTEILTVDRARGEVPSDYVSSSDEFTSSDSEVS 116

Query: 121 XXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISR 180
                          + T+P +GD+SKTLAVVNLDWD+V+S+DLM+TFSSF+P GG+I +
Sbjct: 117 DNEVESESESEVELEK-TEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEK 175

Query: 181 ICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEEGDAEKD 240
           I IYPSEFGKER+QREEVEGPPKELFQKK KK    ++            LYEEGDA+K+
Sbjct: 176 IAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKD-LYEEGDADKN 234

Query: 241 VDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFD 300
           VD+KA             AVVYCNN+  A +IY NCDGTEYESTAN+FD+RYVPDGM FD
Sbjct: 235 VDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFD 294

Query: 301 DEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKA 360
            +P+D C  LPKNYKP+QFSTDALQHSNVKLTWDETPADR++VAKRAF+QKEIEDMDFKA
Sbjct: 295 GKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKA 354

Query: 361 YLAXXXXXXXXXXXXXXKNKLKALV--GESLDFGTNGAS--DG-ESEVDMEITFTPGLD 414
           YLA              K+KLK+LV    + DF    A   DG + EVDMEITFTPGLD
Sbjct: 355 YLASDSDDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLD 413

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 68/121 (56%), Gaps = 4/121 (3%)

Query: 499 QSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDP 558
           +S+NKKAHFN+ EI++S               IV DDFKPDL DPRFKE+FE HDFAIDP
Sbjct: 496 KSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDP 555

Query: 559 SQPEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXLDTSTSKNGKNAISNIVNKLKKNGK 618
           +Q EF+ T AMK++L                     DT    N    I+NIV KLKK G+
Sbjct: 556 TQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDT----NENGDIANIVAKLKKGGR 611

Query: 619 Q 619
           +
Sbjct: 612 K 612

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  415 bits (1067), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 227/448 (50%), Positives = 276/448 (61%), Gaps = 36/448 (8%)

Query: 1   MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60
           MSE  K  +D RF+ ++ DPKF+ +K   LK++LD+RFSK+DL++  K+KVD+YGRK  D
Sbjct: 1   MSER-KPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID 59

Query: 61  EGSX-----------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRA 97
                                                                  ++DRA
Sbjct: 60  RNEKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRA 119

Query: 98  RGEVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWD 157
           RG+VP                                IE+ KPETGD SKT+AVVNLDWD
Sbjct: 120 RGDVPSDYVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWD 179

Query: 158 HVKSADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKK--AS 215
           HVKS DLM+TFS F+PKGGKI++I IYPSEFGKER+QREE+EGPPKELF+KKNKK   ++
Sbjct: 180 HVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKST 239

Query: 216 HKEXXXXXXXXXXXXLYEEGDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYEN 275
            ++            LYEEGDA+K++DSK+             AVVYCNNI TA +IY+N
Sbjct: 240 AEDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKN 299

Query: 276 CDGTEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDE 335
           CDGTEYESTAN+FD+RYVPD MTFDD PRDEC+ LPKNYKP+QFSTDALQHSNVKLTWDE
Sbjct: 300 CDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDE 359

Query: 336 TPADRVEVAKRAFSQKEIEDMDFKAYLAXXXXXXXXXXXXXXKNKLKALV---------G 386
           TPADRVE++KRAFSQKEI++MDFKAYLA              KNKLK+LV         G
Sbjct: 360 TPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFG 419

Query: 387 ESLDFGTNGASDGESEVDMEITFTPGLD 414
           +  ++  +G SD E  VDMEITFTPGLD
Sbjct: 420 KDTEYDLDG-SDDEDGVDMEITFTPGLD 446

 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/73 (58%), Positives = 54/73 (73%)

Query: 501 LNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQ 560
           +N KAHFN+NEI+RS               IV+D+FKP+L+D RF E+FEDH FAIDP+Q
Sbjct: 539 VNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQ 598

Query: 561 PEFKQTNAMKQIL 573
           PEFKQT+AMK+IL
Sbjct: 599 PEFKQTSAMKEIL 611

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  413 bits (1061), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/431 (53%), Positives = 266/431 (61%), Gaps = 26/431 (6%)

Query: 2   SEGGKK---SDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKT 58
           S+G KK   ++DPRFS I+NDPKF++ K+K+ KI+LD RFSK+DLE+R KAKVDKYGRK 
Sbjct: 3   SKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKI 62

Query: 59  KDEG----------SXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXX 108
            D            +                              VDRARGE P      
Sbjct: 63  VDANKDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYVSS 122

Query: 109 XXXXXXXXXXXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTF 168
                                        +KP +G+A+ TLAVVNLDWDHVKSADL VTF
Sbjct: 123 SDEESSSESEEESGDSDIESEEIELE--ESKPASGNATNTLAVVNLDWDHVKSADLFVTF 180

Query: 169 SSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXX 228
            SFVPKGG+I +I IYPSEFGKER+QREE+EGPPKELFQ K  KK    +          
Sbjct: 181 KSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDDEINVES--- 237

Query: 229 XXLYEEGDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMF 288
             +YEEGDAE D DSKA             AVVYC++I TA +IY+NCDGTEYESTAN+F
Sbjct: 238 --IYEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANVF 294

Query: 289 DLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAF 348
           DLRYVPDGM  DD+PRDEC SLPKNYKP QFSTDALQHS VKLTWDETPADRVE++KRAF
Sbjct: 295 DLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAF 354

Query: 349 SQKEIEDMDFKAYLAXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGASD-----GESEV 403
           +QKEIE+MDFKAYLA              KNKLKALV +S+  G     D      ++E 
Sbjct: 355 TQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEA 414

Query: 404 DMEITFTPGLD 414
           DMEITFTPGLD
Sbjct: 415 DMEITFTPGLD 425

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 70/120 (58%), Gaps = 1/120 (0%)

Query: 500 SLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPS 559
           ++N KAHFN+NEI++S               IV+D+F PD++DPRFKEVFEDHDFAIDP+
Sbjct: 506 TINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDPT 565

Query: 560 QPEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXLDTSTSKNGKNAISNIVNKLKKNGKQ 619
           QPEFK+T AM++IL                     +T  SK+  N I  +V KLK   K+
Sbjct: 566 QPEFKKTPAMEKILKERTVRSSKKSRGKKRNHEIANTEHSKDI-NKIGGLVEKLKAKNKR 624

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  407 bits (1045), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/437 (51%), Positives = 266/437 (60%), Gaps = 30/437 (6%)

Query: 4   GGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDE-- 61
           G ++S DPRF+ +++DPKF+  K K  KI+LD RFSK+DL+ + KA+VDKYGR  K +  
Sbjct: 8   GKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQEN 67

Query: 62  --------------------GSXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEV 101
                                                               +DRARGEV
Sbjct: 68  KDKKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEV 127

Query: 102 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKS 161
           P                                IE+TKP++GD+SKTLAVVNLDWDHVKS
Sbjct: 128 PSDYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKS 187

Query: 162 ADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXX 221
            DLM+TFSSFVP GGKI +I +YPSEFGKERL+REE+EGPP+E+F+ KN KK SH +   
Sbjct: 188 TDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSD 247

Query: 222 XXXXXXXXXLYEEGDAEKDVDSKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEY 281
                    LYEEGDAE D D+K+             AVVYCNN+ TA AIY+NCDGTE+
Sbjct: 248 SDVDVRD--LYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEF 304

Query: 282 ESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRV 341
           ESTANMFDLRYVPDGMTFDDE RDEC S+PKNY+P QFSTDALQHS VKLTWDETPADRV
Sbjct: 305 ESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRV 364

Query: 342 EVAKRAFSQKEIEDMDFKAYLAXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGASD--- 398
            ++KRAF+QKEIEDMDFKAYLA              K KLK+LV +S+  G     D   
Sbjct: 365 AMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQAP 424

Query: 399 --GESEVDMEITFTPGL 413
             GES+VDM+ITF PGL
Sbjct: 425 EEGESDVDMQITFAPGL 441

 Score =  108 bits (271), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 69/118 (58%), Gaps = 3/118 (2%)

Query: 501 LNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQ 560
           LNKKAHFN+NEI+RS               IVED+FKPDL+DPRF EVFED DFAIDPSQ
Sbjct: 527 LNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQ 586

Query: 561 PEFKQTNAMKQILXXXXXXXXXXXXXXXXXXXXLDTSTSKNGKNAISNIVNKLKKNGK 618
           PEFK T AMKQIL                    L    ++NG++ +  +V KLK + K
Sbjct: 587 PEFKGTAAMKQILQERTKRSHKGQNKKRKADGNL---ANQNGQSDLKGLVKKLKHSSK 641

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  397 bits (1020), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/413 (53%), Positives = 257/413 (62%), Gaps = 8/413 (1%)

Query: 5   GKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDE-GS 63
           GK S D RF+RI +DPKF+  K K+LKI+LD RFSK+DLE + KAKVDKYGR+     G 
Sbjct: 9   GKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGK 68

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXXX 123
                                        K+DRARGEVP                     
Sbjct: 69  EEKDFEKYFTKESSESAAEESDKEDSSVAKLDRARGEVPADYVSSSDEESSSESEADSDD 128

Query: 124 XXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICI 183
                       E    E+GD SK LAVVNLDWDHVK ADL+V F+SFVP+GGKI R+ I
Sbjct: 129 ATAESDEEVEIEEEKP-ESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAI 187

Query: 184 YPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEEGDAEKDVDS 243
           YPSEFGKER+QREEVEGPP+E+F+ K  KKA   +            LYE+GDAEKD DS
Sbjct: 188 YPSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDEIGLKD----LYEQGDAEKDYDS 243

Query: 244 KAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEP 303
           KA             AVVYCNN+ TA AIY+NCDGTEYESTANMFDLRYVP+G+TFDDEP
Sbjct: 244 KALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEP 303

Query: 304 RDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLA 363
           R+EC S+PK+YKP+QFST ALQH  VKLTWDETPADRVE+AKRAFSQKEIEDMDFKAYLA
Sbjct: 304 REECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLA 363

Query: 364 XXXXXXXXXXXXXXKNKLKALVG--ESLDFGTNGASDGESEVDMEITFTPGLD 414
                         KNKL++LV   +  D         E E D++ITFTPGL+
Sbjct: 364 SDSEESEADDNSEAKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTPGLE 416

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/75 (66%), Positives = 56/75 (74%)

Query: 499 QSLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDP 558
           QS+N  AHFN+N+I+RS               IVEDDFKPDL+DPRFKEVFED DFAIDP
Sbjct: 498 QSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDP 557

Query: 559 SQPEFKQTNAMKQIL 573
           SQPEFK+T AMKQIL
Sbjct: 558 SQPEFKETAAMKQIL 572

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  394 bits (1012), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/415 (50%), Positives = 253/415 (60%), Gaps = 11/415 (2%)

Query: 8   SDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKT-----KDEG 62
           ++D RF+ I+NDPKF+  K   LKI LD RFSK+DLE + KAKVDKYGR+      K+  
Sbjct: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAK 71

Query: 63  SXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVDRARGEVPXXXXXXXXXXXXXXXXXXXX 122
                                          +DRARGEVP                    
Sbjct: 72  DFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDENSSSESEEESE 131

Query: 123 XXXXXXXXXXXXIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRIC 182
                       IE +KPETGD +K  AVVNLDWDHV+S DL+ TF+SFVP GG I ++ 
Sbjct: 132 DSALDPDSELE-IEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVA 190

Query: 183 IYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEXXXXXXXXXXXXLYEEGDAEKDVD 242
           IYPSEFGKER++REEVEGPP+ELF++K  KK   K+            LYE  DAEKD D
Sbjct: 191 IYPSEFGKERMKREEVEGPPRELFKRKQSKK--EKDSDDENSDIDINDLYEVDDAEKDYD 248

Query: 243 SKAXXXXXXXXXXXXXAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDE 302
           SKA             AVVYC+++ TA+AIY+NCDGTE+ESTANMFDLRYVPD M F+D+
Sbjct: 249 SKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDD 308

Query: 303 PRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYL 362
           PRD+C S+PK+YKP QFST ALQHS VKLTWDETPADRVE++KRAF+QKEIE+MDFKAYL
Sbjct: 309 PRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYL 368

Query: 363 AXXXXXXXXXXXXXXKNKLKALVGESLDFGTNGASD---GESEVDMEITFTPGLD 414
           A              KN L++LV +S+        D    E E D+EITFTPGL+
Sbjct: 369 ASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLE 423

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/74 (64%), Positives = 56/74 (75%)

Query: 500 SLNKKAHFNLNEIIRSXXXXXXXXXXXXXXXIVEDDFKPDLSDPRFKEVFEDHDFAIDPS 559
           +LN  AHFN+NEII+S               IV+D+FKPDL+DPRFKEVFEDHDFAIDPS
Sbjct: 508 TLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPS 567

Query: 560 QPEFKQTNAMKQIL 573
           QPEFK+T AMK+IL
Sbjct: 568 QPEFKKTPAMKEIL 581

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQI 572
           L+D RFKE+FED +F +D    +FKQ N +K I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQI 572
           L+D RFKE+FED +F +D    +FKQ N +K I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQI 572
           L+D RFKE+FED  F +D    +FKQ N +K I
Sbjct: 477 LTDDRFKEMFEDEQFQVDEDDYDFKQLNPVKSI 509

>CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [2265
           bp, 754 aa] {ON} highly similar to uniprot|P48234
           Saccharomyces cerevisiae YGR145w ENP2
          Length = 754

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED DF +D +  ++KQ N +K
Sbjct: 538 LTDDRFKEMFEDEDFKVDENDYDYKQLNPVK 568

>NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {ON}
           Anc_4.77 YGR145W
          Length = 707

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED DF +D    ++KQ N +K
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQLNPVK 507

>Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {ON}
           complement(87507..89612) [2106 nt, 702 aa]
          Length = 701

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED DF +D    ++KQ N +K
Sbjct: 481 LTDDRFKEMFEDEDFQVDEEDYDYKQLNPVK 511

>TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {ON}
           Anc_4.77 YGR145W
          Length = 694

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED DF +D    ++KQ N +K
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQLNPVK 507

>KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} similar
           to uniprot|P48234 Saccharomyces cerevisiae YGR145W ENP2
           Essential nucleolar protein of unknown function contains
           WD repeats interacts with Mpp10p and Bfr2p and has
           homology to Spb1p
          Length = 695

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED DF +D    ++KQ N +K
Sbjct: 480 LADDRFKEMFEDEDFQVDEDDYDYKQLNPVK 510

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQI 572
           L+D RFKE+FE+ +F +D +  +FKQ N +K +
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSL 509

>AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR145W (ENP2)
          Length = 689

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L D RFKE+FED DF +D    ++KQ N +K
Sbjct: 480 LEDERFKEMFEDEDFLVDEDDYDYKQLNPVK 510

>KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {ON}
           Anc_4.77 YGR145W
          Length = 693

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED +F +D +  ++KQ N +K
Sbjct: 478 LTDDRFKEMFEDEEFQVDENDYDYKQLNPVK 508

>NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {ON}
           Anc_4.77 YGR145W
          Length = 701

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED +F +D    ++KQ N +K
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDAYDYKQLNPVK 507

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L D RFKE+FED DF I+    ++KQ N +K
Sbjct: 477 LQDDRFKEMFEDEDFQINEDDYDYKQLNPVK 507

>KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {ON}
           Anc_4.77 YGR145W
          Length = 696

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           ++D RFKE+FED DF +D    +++Q N +K
Sbjct: 477 VTDDRFKEMFEDEDFQVDEESYDYRQLNPVK 507

>Ecym_1412 Chr1 (856549..858708) [2160 bp, 719 aa] {ON} similar to
           Ashbya gossypii AFR468W
          Length = 719

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L D RFKE+FED +F ID    ++KQ N +K
Sbjct: 505 LDDDRFKEMFEDENFQIDEDDYDYKQLNPVK 535

>TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.77
           YGR145W
          Length = 713

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           ++D RFKE+FED +F +D    ++KQ N +K
Sbjct: 488 MTDDRFKEMFEDEEFQVDEDDYDYKQLNPVK 518

>Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W -
           Protein required for cell viability [contig 227] FULL
          Length = 699

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RFKE+FED  F +D    ++KQ N +K
Sbjct: 480 LTDDRFKEMFEDEAFQVDEQDYDYKQLNPVK 510

>KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {ON}
           similar to uniprot|P48234 Saccharomyces cerevisiae
           YGR145W ENP2 Essential nucleolar protein of unknown
           function contains WD repeats interacts with Mpp10p and
           Bfr2p and has homology to Spb1p
          Length = 700

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L D RFKE+FED  F +D    ++KQ N +K
Sbjct: 477 LEDDRFKEMFEDDAFQVDEDDYDYKQLNPVK 507

>SAKL0H20922g Chr8 (1826071..1828179) [2109 bp, 702 aa] {ON} highly
           similar to uniprot|P48234 Saccharomyces cerevisiae
           YGR145W ENP2 Essential nucleolar protein of unknown
           function contains WD repeats interacts with Mpp10p and
           Bfr2p and has homology to Spb1p
          Length = 702

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 540 LSDPRFKEVFEDHDFAIDPSQPEFKQTNAMK 570
           L+D RF E+FED DF ++    ++KQ N +K
Sbjct: 480 LTDDRFAEMFEDADFQVNEDDYDYKQLNPVK 510

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,908,702
Number of extensions: 1707065
Number of successful extensions: 3692
Number of sequences better than 10.0: 41
Number of HSP's gapped: 3677
Number of HSP's successfully gapped: 76
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)