Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E038605.423ON37837820330.0
Suva_15.3085.423ON37837816250.0
YHR112C5.423ON37837816230.0
Smik_8.1905.423ON42037816230.0
Skud_8.1735.423ON37837816180.0
NDAI0B055905.423ON38037516130.0
NCAS0F032905.423ON40437415740.0
CAGL0I01276g5.423ON38037115320.0
CAGL0K05665gsingletonON37937614690.0
SAKL0G02222g5.423ON37837614340.0
TBLA0A036805.423ON38436814160.0
Kpol_1031.235.423ON37937814150.0
KNAG0C049905.423ON38037814000.0
KNAG0F01580singletonON37937313930.0
ZYRO0F09768g5.423ON37337413810.0
ZYRO0F15664gsingletonON37337413590.0
KLLA0E21319g5.423ON38037613490.0
TBLA0B03020singletonON37937213490.0
NDAI0F00140singletonON37837713430.0
TDEL0G00140singletonON38137913011e-180
TDEL0G04970singletonON38137912711e-175
TPHA0A06070na 1ON37335912351e-170
NDAI0B00595singletonON37837712181e-167
Ecym_55235.423ON38137511971e-164
AER250C5.423ON37437411861e-162
Kwal_55.222215.423ON38037711531e-157
KLTH0E16566g5.423ON38137711451e-156
NCAS0F015207.97ON4294033744e-40
Kpol_1044.107.97ON3914003709e-40
Ecym_26297.97ON3923973682e-39
NDAI0H024007.97ON3934003638e-39
TPHA0L005707.97ON3913993638e-39
KAFR0K007607.97ON3924023593e-38
CAGL0H06369g7.97ON3914023542e-37
SAKL0B09614g7.97ON3923923445e-36
YAL012W (CYS3)7.97ON3943983436e-36
Suva_1.567.97ON3953993429e-36
TDEL0H035307.97ON3913943429e-36
KLLA0F07909g7.97ON3914003411e-35
Smik_1.557.97ON3943983402e-35
KLTH0D02728g7.97ON3924003383e-35
ZYRO0D05742g7.97ON3913953374e-35
Skud_1.497.97ON3943953374e-35
TBLA0E022407.97ON3873983295e-34
KNAG0D047407.97ON3903983182e-32
AEL341W7.97ON3933983165e-32
YGL184C (STR3)8.145ON4654152614e-24
Smik_7.898.145ON4654122562e-23
CAGL0L06094g8.145ON4503982454e-22
Skud_7.888.145ON4654122446e-22
ZYRO0G19162g8.145ON4552822402e-21
Skud_19.6singletonON4013822302e-20
Suva_7.798.145ON4654182313e-20
ACL059C8.145ON4532552261e-19
NDAI0D028804.53ON4474692191e-18
TDEL0B046608.145ON4643912191e-18
SAKL0H24882g8.145ON4594062154e-18
TDEL0D06630singletonON4023522119e-18
NCAS0A058104.53ON4474632082e-17
KLTH0E06644g8.145ON4604112074e-17
Ecym_84058.145ON4722562074e-17
Smik_7.375na 1ON4013502054e-17
KLLA0C17028g8.145ON4604142066e-17
TPHA0F004204.53ON4424572031e-16
Suva_17.6singletonON4013811984e-16
KAFR0F030704.53ON4454581984e-16
Kwal_47.172218.145ON4632551986e-16
KNAG0I029204.53ON4454581942e-15
TBLA0C044004.53ON4454571852e-14
Kpol_1041.444.53ON4444541834e-14
ZYRO0G22198g4.53ON4454601772e-13
SAKL0H23892g4.53ON4424621772e-13
KLTH0D03652g4.53ON4444541773e-13
Kpol_1028.804.354ON6892931774e-13
YFR055W (IRC7)na 1ON3402511735e-13
Ecym_83654.53ON4444521737e-13
ADL031W4.53ON4674601729e-13
ZYRO0B08338g4.354ON6402541731e-12
KLTH0G00418gsingletonON5682541613e-11
KLLA0D04037g4.53ON4444551585e-11
Skud_12.3844.53ON4444541586e-11
Smik_12.3834.53ON4444541586e-11
Suva_10.3974.53ON4444541577e-11
YLR303W (MET17)4.53ON4444541542e-10
TPHA0L003304.354ON7172831533e-10
CAGL0D06402g4.53ON4424541505e-10
Suva_10.8na 2ON5722551506e-10
Skud_10.3534.354ON6402741507e-10
Smik_10.4234.354ON6392571507e-10
YLL058Wna 2ON5752501498e-10
TDEL0E05710singletonON5562521472e-09
KLTH0D17930g4.354ON6522711472e-09
Suva_12.2214.354ON6392551472e-09
TDEL0E056204.53ON4464611462e-09
SAKL0G18172g4.354ON6732661462e-09
TDEL0D006104.354ON6522781462e-09
YJR130C (STR2)4.354ON6392571436e-09
NCAS0A062704.354ON6592601427e-09
Kwal_26.74374.53ON4444541391e-08
Ecym_51694.354ON6812471392e-08
Kwal_14.791na 2ON5712571363e-08
KLLA0B04378g4.354ON6882571321e-07
KAFR0B068304.354ON6672951312e-07
KNAG0M003304.354ON6313011312e-07
NDAI0D032604.354ON6962701293e-07
Skud_12.10na 2ON5712501275e-07
AER164C4.354ON6453091267e-07
Suva_13.684.354ON6882601222e-06
Smik_12.3na 2ON5662021186e-06
Kwal_47.166444.354ON6523161142e-05
YML082W4.354ON6492581133e-05
Smik_13.554.354ON6992581123e-05
Skud_13.594.354ON6492751089e-05
Kwal_26.7197singletonOFF8767962e-04
CAGL0M00550g4.354ON5692491034e-04
KLTH0G09614g2.252ON3892521007e-04
SAKL0D15422gsingletonON154154880.009
Kwal_26.71947.97ON152157790.11
Kwal_34.160181.472ON379148800.18
KAFR0E043904.370ON1431103800.29
KAFR0E04410na 3ON1436103790.38
CAGL0H04169g4.354ON698136760.70
KLLA0A08162g1.500ON45783731.7
Kpol_541.428.128ON34263703.3
SAKL0B00770g8.14ON86334704.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03860
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   787   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   630   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   629   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   629   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   627   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   625   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   610   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   594   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   570   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   556   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   550   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   549   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   543   0.0  
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   541   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   536   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   528   0.0  
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   524   0.0  
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   524   0.0  
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                521   0.0  
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      505   e-180
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   494   e-175
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   480   e-170
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              473   e-167
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   465   e-164
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   461   e-162
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   448   e-157
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   445   e-156
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   148   4e-40
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   147   9e-40
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   146   2e-39
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   144   8e-39
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   144   8e-39
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   142   3e-38
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   140   2e-37
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   137   5e-36
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   136   6e-36
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   136   9e-36
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   136   9e-36
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   135   1e-35
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   135   2e-35
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   134   3e-35
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   134   4e-35
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   134   4e-35
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   131   5e-34
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   127   2e-32
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   126   5e-32
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...   105   4e-24
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...   103   2e-23
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...    99   4e-22
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    99   6e-22
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    97   2e-21
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    93   2e-20
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    94   3e-20
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    92   1e-19
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      89   1e-18
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    89   1e-18
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    87   4e-18
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    86   9e-18
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    85   2e-17
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    84   4e-17
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    84   4e-17
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    84   4e-17
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    84   6e-17
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    83   1e-16
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    81   4e-16
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    81   4e-16
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    81   6e-16
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    79   2e-15
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    76   2e-14
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    75   4e-14
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    73   2e-13
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    73   2e-13
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    73   3e-13
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    73   4e-13
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    71   5e-13
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    71   7e-13
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    71   9e-13
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    71   1e-12
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    67   3e-11
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    65   5e-11
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    65   6e-11
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    65   6e-11
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    65   7e-11
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    64   2e-10
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    64   3e-10
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    62   5e-10
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    62   6e-10
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    62   7e-10
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    62   7e-10
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    62   8e-10
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    61   2e-09
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    61   2e-09
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    61   2e-09
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    61   2e-09
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    61   2e-09
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    61   2e-09
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    60   6e-09
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    59   7e-09
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    58   1e-08
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    58   2e-08
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    57   3e-08
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    55   1e-07
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    55   2e-07
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    55   2e-07
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    54   3e-07
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    54   5e-07
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    53   7e-07
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    52   2e-06
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     50   6e-06
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    49   2e-05
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    48   3e-05
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    48   3e-05
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    46   9e-05
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    42   2e-04
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    44   4e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    43   7e-04
SAKL0D15422g Chr4 complement(1288743..1289207) [465 bp, 154 aa] ...    39   0.009
Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W ...    35   0.11 
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    35   0.18 
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    35   0.29 
KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {...    35   0.38 
CAGL0H04169g Chr8 (394311..396407) [2097 bp, 698 aa] {ON} simila...    34   0.70 
KLLA0A08162g Chr1 complement(727416..728789) [1374 bp, 457 aa] {...    33   1.7  
Kpol_541.42 s541 (140531..141559) [1029 bp, 342 aa] {ON} (140531...    32   3.3  
SAKL0B00770g Chr2 complement(67494..70085) [2592 bp, 863 aa] {ON...    32   4.0  

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 DDLIKDLETALQELHNGA 378
           DDLIKDLETALQELHNGA
Sbjct: 361 DDLIKDLETALQELHNGA 378

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 345/378 (91%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T+LIHADDKDNRV+DVAPPINVSTT+RYD+ DLIPW ERENLDFMEK+PVYSRLA
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN+TRLES+FS+IL+G+AV+YSSG AAF+AAMVHYNPKKIF+GQ YHG+RAIANI+TRN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           Y ++Q+ L+DIE+YA EGDIV +ESP+NPYGTS DI+S A +AH+KGA++++DSTFA PP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQYAW+ GAD+VL+SATKYFGGHSDLLSGV+VVKDE V ++L+DDRIYLGTNV NLES+M
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+YELRI KQSENATK+V+FL+ ++  FDKVLK +YHSSLQ E FVKKQLVGGYG
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVF+++L+T +QCK FP KLKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIRVS+G E+A
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIKDLETALQELHNGA 378
           DDLI+DL +AL+EL + A
Sbjct: 361 DDLIRDLASALKELQDAA 378

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/378 (76%), Positives = 342/378 (90%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T+LIH DDKDNRV+DVAPPINVSTT+RYD+ DLIPW ERENLDFMEKKPVYSRLA
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN+TRLES+FSEIL+G+AVIYSSG AAFYAAMVHYNPKKIF+GQ YHG+RAIANI+TRN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           YG+EQ+ L+DIEK A EGDIV +ESP+NPYGTS DI+S+A +AH+KGA+++VDSTFA PP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQYAW+ GAD+VL+SATKYFGGHSDLLSGV+VVK+E   ++L+DDRIYLGTNV NLES+M
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+YE+RI KQSENATK+V FL+ ++  FDKVLK +YHSSLQ E FVKKQLVGGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVF+++L T +QCK+ P KLKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIRVS+G E+A
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIKDLETALQELHNGA 378
           +DLIKDL +AL+EL + A
Sbjct: 361 NDLIKDLASALKELQDAA 378

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/378 (75%), Positives = 345/378 (91%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L TSLIH DDKDNRV+DVAPPINVSTT+RYD+ DL+PW ERENLDFMEKKP+YSRLA
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN+TRLES+FSEIL+G+AVIYSSG AAFYAAMVHYNPK+IF+GQ YHG+RAIANI++RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           Y ++QY L+DIEKYA EGDIV +E+P+NPYGTS DI+S+A +AH+KGA+++VDSTFA PP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQY W+ GAD+VL+SATKYFGGHSDLLSGV+VVK+EE  ++L+DDRIYLGTNV NLES+M
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+YE+RI KQSENATK+V+FL+ ++  F KVLK++YHSSLQ+E FVKKQLVGGYG
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVF+++LQT +QCK+ P KLKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIRVS+G E+A
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 361 DDLIKDLETALQELHNGA 378
           +DLIKDL +AL+EL + A
Sbjct: 403 NDLIKDLASALKELQDAA 420

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/378 (77%), Positives = 340/378 (89%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M +L T LIH DDKDNRV+DVAPPINVSTT+RYD+ DLIPW ERENLDFMEKKPVYSRLA
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN+TRLES+FSEIL+G+AVIYSSG AAFYAAMVHYNPKKIF+GQ YHG+RAI NI+ RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           Y V+QY L+DIEKYA EGDIV +ESP+NPYGTS DI+S+A +AH+KGA+++VDSTFA PP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQYAW+ GADVVL+SATKYFGGHSDLLSGV+VVKDE V ++L+DDRIYLGTNV NLES+M
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+YE+RI KQSENATK+V+FL+ ++  FDKVLK +YHSSLQ E FVKKQLVGGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVF++ L   +QCK+ P KLKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIRVS+G E+A
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIKDLETALQELHNGA 378
           +DLIKDL +AL+EL + A
Sbjct: 361 EDLIKDLSSALKELQDTA 378

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/375 (74%), Positives = 337/375 (89%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M HL T+LIH+DDKDNRVSDVAPPINV+TT+RYD  DL+PW ERENLDFMEK P+YSRLA
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN+TRLES+FSEIL+GHAVIYSSG AAF+AAM+HYNPK+IF+GQ YHG+RAIANI+TRN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           +  +Q+TLD+IE++AQ GDIV +E+P+NP+GTS+D++  A+KAH KGA++LVDSTFAPPP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ  WD   D+++HSATKYFGGHSDLLSGV+VVK+E V ++LRDDRIYLGTNV NLES+M
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR++E+R+LKQSENATK+V FL+ N++++DKVLK + HSSLQKE+FVKKQL GGYG
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS+SL   +QCKKFP  LKYFHHATSLGG+ESLVEWRAMTDPYI+QTLIRVSIG ENA
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 361 DDLIKDLETALQELH 375
           DDLI+DL  AL+ L 
Sbjct: 361 DDLIQDLANALETLQ 375

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/374 (74%), Positives = 329/374 (87%)

Query: 3   HLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHP 62
           HL T+LIH DDKDNRVSDVAPPINV+TT+RYD  DLIPW ERENLDFM+K P+YSRL HP
Sbjct: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88

Query: 63  NATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYG 122
           N+TRLES+FSE+L GHAVIYSSG +AF+AAMVHYNPK++FMGQ YHG RAIANI+TRNY 
Sbjct: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148

Query: 123 VEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQ 182
           VEQ+ L+DIEKYAQ+GDIV +E+P+NPYGTS+DI   A +AH+KGA++ VDSTFAPPPLQ
Sbjct: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQ 208

Query: 183 YAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLL 242
             W+  AD+V+HSATKYFGGHSDLLSGV+VVKDE+V ++LRDDRIYLGTNV NLESY+LL
Sbjct: 209 DVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268

Query: 243 RSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPV 302
           RSLR++++RI +QSENATKVV+FLN NK +F  VL ++YHSSLQ E FVKKQL GGY PV
Sbjct: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPV 328

Query: 303 FSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADD 362
           FS++L+  +QCKKFP  LKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIR+SIG E+ADD
Sbjct: 329 FSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADD 388

Query: 363 LIKDLETALQELHN 376
           LI DL  AL +L +
Sbjct: 389 LINDLSAALNKLQD 402

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/371 (71%), Positives = 330/371 (88%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T+LIH DD  NRV DVAPPINV+TT+RYDE DL+PW ERE+L+FM++ P+YSRL HPN
Sbjct: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65

Query: 64  ATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGV 123
           ATRLES+FSEILEGHAVIYSSG AAF+AAM H+NPK++F+GQ YHG+  IA+I++RNYG+
Sbjct: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125

Query: 124 EQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQY 183
            Q +LDDIE+YAQ+GDIV +E+P+NP+GTS D++S A+KAHS+GA+++VDSTFAPPPLQY
Sbjct: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185

Query: 184 AWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLR 243
           AW+ GAD+++HSATK+FGGHSDLLSGV+V KDEEV K+L+DDRIYLGTNV NLES++LLR
Sbjct: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245

Query: 244 SLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVF 303
           SLR++E+RILKQS+N TK+VE L  N++++ KVL++V+HSSLQ E+FVKKQL+GGY PVF
Sbjct: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305

Query: 304 SMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDL 363
           S++L   +QCK+ P KLKYFHHATSLGGVESL+EWRAMTDPYIDQTLIR SIG E+ADDL
Sbjct: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDL 365

Query: 364 IKDLETALQEL 374
           I DL+ A  EL
Sbjct: 366 IADLDAAFIEL 376

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/376 (67%), Positives = 322/376 (85%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T LIH DDK NRVSDVAPPINVSTTYRY E DLIPW +REN DFM++ PVYSR  
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN TRLE++FS+ILEGHAV+Y+SG AAF+AAM+HYNPK++F+GQCYHG+  I+++ TRN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           + V+Q TL+DI ++A++GD+V +ESP+NP+GT ID+K +A+ AHSKGAIV++DSTFAPPP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQYAWDLGAD+++HSATKYFGGHSDLL G++V KD+E+ + L++DRI LG+ +GNLESY+
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           L+RSLR+YE+RI+KQSEN  K+V++LN NKE++  VL ++YHSS+Q +AFVK QLVGGY 
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
            VFS  L++ +QCKKFP KLKYFHHATSLGG+ESL+EWRA++D  IDQ L+RVS+G E+A
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 361 DDLIKDLETALQELHN 376
            DLI DL  ALQEL N
Sbjct: 361 KDLIDDLSQALQELEN 376

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 315/376 (83%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T+LIHADDKDNRV+D+  PINV+TT+RYD  +LI W +REN DF+E  PVYSRLA
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPNATRLES+FSEIL GHAVIYSSG AA++A + HYNPKK+F+GQ YHG   IA+I TRN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
            G++QY LD IE+ A EGDIV +E+P+NP+GTS DI+  A KAH+KGA++++DSTFAPPP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ  W  GADVV+HS TKYFGGHSDLLSGV+VVK  EV KK+++DRIYLGTN+ NLESY+
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR++E+R+ KQSENAT +V++L+ +K  F+KVL ++YHSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS+ L++  QCKK PGKL+ F HATSLGGVESLVEWRA+TDPYI+QTLIRVS+G E  
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 361 DDLIKDLETALQELHN 376
           +DLIKDL  AL++L +
Sbjct: 361 EDLIKDLAGALKQLQD 376

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/368 (67%), Positives = 311/368 (84%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T LIH DD +NRV+DVAPPIN++TT+RYD  DLIPW ER +L FME KP+YSRLAHPN
Sbjct: 9   LETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPN 68

Query: 64  ATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGV 123
           ++RLE+LFS+IL+G+AVIY+SG +AF+AAM ++NPK++F+GQ YHG  A  NI+ RN  +
Sbjct: 69  SSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTL 128

Query: 124 EQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQY 183
           +++T  +IE++AQ+GDIV +ESP+NPYGTS DI+   +KAHSKG +V++DSTFAPPPLQY
Sbjct: 129 KKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQY 188

Query: 184 AWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLR 243
            WD   D+V+HSATK+FGGHSDLLSGV+VVKDE + K LR+DRIYLGTN+ NLESY+LLR
Sbjct: 189 VWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLR 248

Query: 244 SLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVF 303
           SLR++E+RILKQS +AT++V+FLN N+ +F+KVLKE+YHSSLQKE FVKKQL GGY PVF
Sbjct: 249 SLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPVF 308

Query: 304 SMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDL 363
           S+ L   +QCK  P  LKYF HATSLGGVESL+EWRA+TDPYI QTLIRVS+G EN  DL
Sbjct: 309 SIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDL 368

Query: 364 IKDLETAL 371
           I DL+ AL
Sbjct: 369 INDLDQAL 376

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/378 (66%), Positives = 323/378 (85%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T LIHADDK+NRV+DVAPPINV+TT+RY+E DLIP  ERE++ F++++PVYSR  
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN TRLE+LFSE L GHAVIYSSG +A++AA++ +NPK+IFM Q YHG  AIA +  RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
             V++YTLD+IE+YA++GDIV +ESP+NP+GTS DI++ A++AH+KGA++LVD TFAPPP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ  WD GAD+V+HSATKYFGGHSDLL GV+VVKD++  + L++DRI LGTN+ NLESY+
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR++E+RI+KQSEN TK+V++L+ NK ++ KVL+++ HSSLQKE FVKKQL GGY 
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS++L T++QCK F  +LKYF HATSLGGVESLVEWRA++DP+IDQTL+RVS+G E+A
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 361 DDLIKDLETALQELHNGA 378
           DDLIKDL +ALQ L + A
Sbjct: 361 DDLIKDLASALQNLQDEA 378

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/378 (65%), Positives = 317/378 (83%), Gaps = 2/378 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M HL T+LIHADD+DNRV DVAPPINVSTTYRYD+ DL+PWR+RE+L+FM+K+P+YSRLA
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN+TRLESLFS+IL GHAV+Y+SG AAF+AA++HYNPK++F+ Q YHG RAIA+I+TR 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGT-SIDIKSIAEKAHSKGAIVLVDSTFAPP 179
            G++Q +LDD+ + AQ GD+V +ESP+NP GT   D+  +AE+AH +GA+++VDSTFAPP
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ  W  G D+V+HSATKYFGGHSDLLSGV+V +D++    LRDDRIYLGTNV NLE+Y
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQK-EAFVKKQLVGG 298
           +LLRSLR++ELRI +QS N T VV +LN ++  +  VL ++YHSSLQ  E +V +QL GG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 299 YGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVE 358
           + PVF+++L++IDQCK+FP  L YF HATSLGGVESLVEWRAMTDP+IDQTL+RVS+G E
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 359 NADDLIKDLETALQELHN 376
           NA+DLI DL TAL  L +
Sbjct: 361 NAEDLIADLTTALNALQS 378

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/373 (65%), Positives = 309/373 (82%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           MTH  TS IHADD++NRV DVAPPINVS TYRYD  +L    E+E L+ M+  PVYSR A
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN TRLES+ S IL GHAV+Y+SGC+AFYAA+VHYNPK++F+ + Y G+ AIA+IMTRN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           YG++Q+T D+IEKYAQ GDIV +ESP+NPYG S DI+++A++AH+KGA+++VDST APPP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ  WD G D+++HSATKYFGGHSDLL+G++V KD++V  +L+ DRIYLGT  GNLES++
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+ E+R+LKQSENATK+V++L  NKE FDKVL E+YHSSLQ E FV  Q+ GGY 
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           P+FS  LQTIDQ K FP KLK F HATSLGG+ESL+EWR +++P +DQTL+R+S+G EN 
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 DDLIKDLETALQE 373
           DDLI DL+ ALQ+
Sbjct: 361 DDLIADLQNALQQ 373

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/374 (65%), Positives = 306/374 (81%), Gaps = 1/374 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T L+H DD+ NRV+DVAPPINV++T+RYD  +LIPWR++ NLDF+++ PVYSR  
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN  RLE+LFS  L GHA+ YS G   F   MVH+NPK++FM QCYHG++ I  I+ RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           YGVE+Y L DIEK+AQ+GDIV VE+P+NP+GTS+DI  +A +AHSKGA+++VDSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ AWD GAD+++HSATKYF GHSDLLSGV+VVKD+EV  KL++DRIYLG+N+ NLESY+
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+Y+LRI +Q+ENATKVV++LN +K+++   L E+YHSSLQ E FVKKQL GGY 
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS++ +T +QCKKF   LK F HATSLGGVESLVEWRAM D  IDQ L+RVSIG E+A
Sbjct: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 DDLIKDLETALQEL 374
           DDLI DL T L +L
Sbjct: 360 DDLINDLSTVLSQL 373

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/374 (64%), Positives = 304/374 (81%), Gaps = 1/374 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L T L+H DD+ NRV+DVAPPINV++T+RYD  +L+PWR+  NLD +++ PVYSR  
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN  RLE+LFS  L GHAV YS G   F +AMVH+NPK++FM QCYHG++ I  IM RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           YGVE+Y L DIEK+AQ+GDIV VE+P+NP+GTS+DI  +A +AH+KGA+++VDSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ AWD GAD+++HSATKYFGGHSDLLSGV+VVKD+E   KL++DRI LG+N+ NL+SY+
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+Y+LRI +QSE+ATK+V++LN +K  F   L ++YHSSLQ + FVKKQL GGYG
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYG 299

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS++L+T +QCKKF   LK F HATSLGGVESLVEWRAM D  IDQ L+RVSIG E+A
Sbjct: 300 PVFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 DDLIKDLETALQEL 374
           +DL  DL T L +L
Sbjct: 360 EDLTNDLTTVLSQL 373

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/376 (63%), Positives = 308/376 (81%), Gaps = 2/376 (0%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T L+HADDK NRV+D+  PINV+TT+RY+E DLIPW ERE+   +EKKP+YSRLAHPN
Sbjct: 3   LSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAHPN 62

Query: 64  ATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGV 123
           + R+ES+ S++LEG AV+Y++G AA++A + +YNPK++F+G+ YHG R+IA+I TRN+ +
Sbjct: 63  SLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNWNL 122

Query: 124 EQYTL--DDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPL 181
           EQ+ L  D+I ++A +GD+V +E+P+NPYGTS DIK+ A+  HSKGAI+++DSTFAPPPL
Sbjct: 123 EQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPPPL 182

Query: 182 QYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYML 241
           Q  WD G DV+LHSATKYFGGHSDLL+GV+ VKD+EV  KLR DRIYLGTN+ NLE+++L
Sbjct: 183 QNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAFLL 242

Query: 242 LRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGP 301
           LRSLR++E+RI  QSENATK+V +L  +K  F+ VL+ V+HSSLQ E FVK+QL GGYGP
Sbjct: 243 LRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGYGP 302

Query: 302 VFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENAD 361
           VF+++L + +QC+KFP  L  F HATSLGGVESLVEWRA+TDPYI  TLIRVS+GVEN D
Sbjct: 303 VFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVENVD 362

Query: 362 DLIKDLETALQELHNG 377
           DLIKD   AL+ L   
Sbjct: 363 DLIKDFANALKTLQGA 378

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/372 (63%), Positives = 313/372 (84%), Gaps = 1/372 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWREREN-LDFMEKKPVYSRL 59
           M HL T+LIH+DDK+NRV+DVAPPINVS+T+RYD  +LIP  E ++ L  +E+ PVYSR 
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRE 60

Query: 60  AHPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTR 119
           +HPN++R++S+ S++L GHAVIY+SGC+AF+A M HYNPK+ FM   Y G+ AIA+++TR
Sbjct: 61  SHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPP 179
           NYG+EQ++LD+IE++AQ GD+V +ESP+NP+GT+ DIK++A++ HSKGAI+ +DST APP
Sbjct: 121 NYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ  W+ GAD+VLHSATKYFGGHSDLL+GV+ VK +E   +L +DRI+LGTN+GNLESY
Sbjct: 181 PLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGY 299
           +LLRSLR+YE+RI+KQS+NATK+V++L+ +KE     LKE++H+SLQ E+F+ KQL GG+
Sbjct: 241 LLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGH 300

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359
           G VFS+ L +I+QCKK P  LKYF HATSLGG+ESL+EWRAM+D  IDQ LIRVS+G EN
Sbjct: 301 GAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

Query: 360 ADDLIKDLETAL 371
            +DLIKDLE AL
Sbjct: 361 VEDLIKDLENAL 372

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/377 (63%), Positives = 313/377 (83%), Gaps = 1/377 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRE-RENLDFMEKKPVYSRL 59
           M HL T+LIH DDK NRV+DVAPPINVSTT+R+D  +LIP  E ++ L  +++ PVY+R 
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  AHPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTR 119
           +HPN++R++++ S++L GHAVIY+SGC+AF+A M HYNPK+ FM   Y G+ AIA+++TR
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPP 179
           NYG+EQ++LD+IE++AQ GDIV +E+P+NP+GTS DI+++A++ H KGAI+ +D+T APP
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ AW  GAD++LHSATKYFGGHSDLL+GV+VVK +E   +L +DRI+LGTN+GNLESY
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGY 299
           +LLRSLR+YE+RI+KQ  N  KV+ +LN NK +F+KVL ++YHSSLQ + FV+KQL G Y
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359
            PVF+++L +IDQCK+ P  LKYF HATSLGGVESL+EWRAM+D  IDQ LIRVSIG EN
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 360 ADDLIKDLETALQELHN 376
           ADDLIKDLE ALQ L N
Sbjct: 361 ADDLIKDLENALQILQN 377

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  505 bits (1301), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 233/379 (61%), Positives = 304/379 (80%), Gaps = 1/379 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWREREN-LDFMEKKPVYSRL 59
           MTHL T+ IHADD  NRV+DVAPPINVSTT+RYD  +L+P  E EN ++ +E+ PVYSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  AHPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTR 119
           +HPN+ RL+++ S+IL GHA +Y+SG +AF+A + HYNPK+ FM   Y G+R IA +   
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPP 179
            +G+E Y L  IE++A++GD++ +E P+NPYGT  DI ++A++ H KGAI+ +DST APP
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ AWD GADVV+HSATKY GGHSDLL+GV+VVK  E  +KL  +RI+LGTNVGNLES+
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGY 299
           +LLRSLR++E+R+LKQSENA K+V FL+ NK ++ KVL EVYHSSLQKEAFV++QL GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359
           G VFS++L++++QCKK P KL YF HATSLGGVESL+EWRA++D  ID  L+R+SIG EN
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 ADDLIKDLETALQELHNGA 378
           ADDLI+DL+ ALQ L   A
Sbjct: 361 ADDLIQDLDNALQVLQGAA 379

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  494 bits (1271), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 298/379 (78%), Gaps = 1/379 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWREREN-LDFMEKKPVYSRL 59
           MTHL T+ IHADD  NRVSDVAPPINV+TT+R+D  +LIP  E EN ++ +E+ PVY+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  AHPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTR 119
            HPN+ R++S+ S IL GHA +Y+SGC+AF+A M   NPK++FM   Y G+  IA+++  
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPP 179
            YG++ + LD IE++A++GD+V +E+P+NP+G   +I ++AE+ H KGA++ VDST APP
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ AWD GAD+V+HSATKY GGHSDLL+GV+VVKD E  + L  +RIYLGTN+GNLES+
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGY 299
           +LLRSLR++E+R+ KQSENA KVV FL+ N  ++ KVL ++YHSSLQKE FV+KQL GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359
           G VFSM L++++Q KK P KL YF HATSLGGVESL+EWRAM+D  ID  L+R+S+G EN
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 ADDLIKDLETALQELHNGA 378
            DDLI+DL+  LQ L N A
Sbjct: 361 VDDLIQDLDQGLQALQNAA 379

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  480 bits (1235), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 293/359 (81%), Gaps = 1/359 (0%)

Query: 17  RVSDVAPPINVSTTYRYDETDLIPWRE-RENLDFMEKKPVYSRLAHPNATRLESLFSEIL 75
           ++SD+APPINVSTTYRYDE +LIP  E ++ L  +E+ PVYSR +H N++R++ + S++L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  EGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGVEQYTLDDIEKYA 135
            GHAVIY+SGC+AF+A M HYNPK+IF  + Y G++AIAN++TRNYG++QY+L DI+K+A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 QEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHS 195
           QEGDI+ +E+P+NP+GT+I+IK IA KAH+K A++ VDST APPPLQ A+D GAD+VLHS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 ATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQ 255
           ATKY GGHSDLL+GV+VVK E+  + L +DRI+LGTN+GNLES++LLRSLR+YE+R+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 SENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTIDQCKK 315
           S+N  K+V FL  N+ ++  V++ +YHSSLQKE FV +QL  G+  VF++  ++ +QCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 316 FPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDLIKDLETALQEL 374
           F   LKYF HATSLGGVESLVEWRAM+DP ID  LIR SIG ENA+DLI+DL++AL  L
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRL 366

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  473 bits (1218), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 302/377 (80%), Gaps = 1/377 (0%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRE-RENLDFMEKKPVYSRL 59
           M HL T+LIH DDK NRV+ VAPPINVSTT+R+D  +LIP  E ++ L  +++ PVY++ 
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKE 60

Query: 60  AHPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTR 119
           ++PN++R++++ S++L GHAVIY+SGC+ F+A M HYNPK+ FM   Y G+ AIA+++TR
Sbjct: 61  SYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTR 120

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPP 179
           NYG+EQ  LD+IE++AQ GDIV +E+P+NP+GTS D++++ E+ H+KGAI+ +D+T A P
Sbjct: 121 NYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ AW  GAD++LHSATKY GGHSDLL+GV+VVK +E   +L +DRI+LGTN+GNLESY
Sbjct: 181 PLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGY 299
           +LLR L +YE+RI+KQ +N  KV+ +LN NK +F+KV+ ++YHSS Q + F++KQL G Y
Sbjct: 241 LLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLY 300

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359
            PVF+++L +IDQCK+ P  LKYF HATSLG  ESL+EWRA++D  IDQ LI VSIG EN
Sbjct: 301 CPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

Query: 360 ADDLIKDLETALQELHN 376
           ADDLIKDLE ALQ L N
Sbjct: 361 ADDLIKDLENALQILQN 377

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  465 bits (1197), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 218/375 (58%), Positives = 285/375 (76%), Gaps = 1/375 (0%)

Query: 1   MTHLGTSLIHADDK-DNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRL 59
           M  L T LIHADD   + V+DVAPPINVSTT+RYD  +L+      +    E  PVYSR 
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSRE 60

Query: 60  AHPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTR 119
            HPN+ R  S+ S  L G+AV Y+SG +AF AA+ HYNPK++F+GQ YHG   +A+I  R
Sbjct: 61  GHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVR 120

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPP 179
           NYG+ +  LD+IE+ AQ GD+V +ESPMNPYGT++DI+    K H KGAIV++DSTFAPP
Sbjct: 121 NYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPP 180

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
           PLQ AW+ G D+++HS TKY GGHSDLL GV+VVKD+ V ++L  DRIYLGTN+ NL+SY
Sbjct: 181 PLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSY 240

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGY 299
           +L+RSLR+ ELR++KQS+ ATK+V +L  +   F  VL E+ H+SLQ+E FVKKQL GG+
Sbjct: 241 LLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGH 300

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359
            PVFS+ L+T+DQC++ P KLK+FHHATS GGVESL+EWRA++DP I++TL+RVS+G E+
Sbjct: 301 TPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCED 360

Query: 360 ADDLIKDLETALQEL 374
            +DLI DL  AL+ L
Sbjct: 361 HNDLINDLANALRYL 375

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/374 (55%), Positives = 283/374 (75%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M  L TSLIHADD  NRV+DVAPPINV+TT+RY E DLIP  ER           YSR++
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPN  R E L +E L G AV+YSSG AAF AA+ H+NPK++F+G+ YHG   +A+I  RN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           +G+++ +L+++ + ++ GD+V +ESP+NPYGT +D+  IA  AH KGA V++D+TFAPPP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           LQ  W+ GADVV+HS TKYFGGHSDLL GV  V+D  V ++LR DR+YLGTN+ NLE+Y+
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           L+RS+R+ E+R+++QS +ATKVV +L  +K  F  VL +V+HSSLQ E +V++ L GG  
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS+ L+T++QCK+ P  LK FHHATSLGGVESL+EWRAM+D  ++Q L+R+S+G E+ 
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 361 DDLIKDLETALQEL 374
           +DLI DL  A ++L
Sbjct: 361 EDLIADLAGAFRQL 374

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  448 bits (1153), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 196/377 (51%), Positives = 285/377 (75%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M    T+ IH+DD  NRVSDVAPPINVSTT+RYD   L+P      +   +   +YSRL 
Sbjct: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPNA RLE++ S++L+ HAV+Y+SG AA++A +VH+ PK++F+  CYHG + +A I++R 
Sbjct: 61  HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
            G+E  +L+DIE   QEGD+V +E P+NP+G ++D+   A + HS G ++++DST  PPP
Sbjct: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           L+ AWD GAD+++HS TKYFGGHSDLLSG++ V DE + ++L++DR YLGT   +LES++
Sbjct: 181 LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+ ++R+ +QS+N T++V +L  N E+F  V++E+ H+SLQ EAFVK+Q+ GG+G
Sbjct: 241 LLRSLRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVF++ L++ DQC+K    + +F HATSLGGVESL+EWRAM+DP   +TLIRVS+G+EN 
Sbjct: 301 PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI 360

Query: 361 DDLIKDLETALQELHNG 377
           +DLI DL  +L++++ G
Sbjct: 361 EDLIADLAGSLEKINKG 377

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  445 bits (1145), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 206/377 (54%), Positives = 279/377 (74%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           M    T+ IH DD+ NRVSDVAPPINVSTT+RYD+  L P          +   +YSRL 
Sbjct: 1   MPFSSTATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLG 60

Query: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
           HPNA RLE + +EIL+G  V+Y+SG AA++A ++H NPK++F   CYHG  A+A I++R 
Sbjct: 61  HPNADRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRI 120

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
            G+E   L+++E   Q GD+V +E P NPYG  +++   AEK H  GA++LVDST APPP
Sbjct: 121 SGMEILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPP 180

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240
           L+  W+ GAD+V+HS TKYFGGHSDLLSG++ V+DE+V ++LR+DR YLGT   +LESY+
Sbjct: 181 LRNTWEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYL 240

Query: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300
           LLRSLR+ E+R+LKQS N T++VE+L  +K+R++ V+K++ H+SLQKE FVKKQL GGYG
Sbjct: 241 LLRSLRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYG 300

Query: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360
           PVFS+ L + +QCK        F HATSLGG ESL+EWRAM+DP+ ++ LIRVS+G+ENA
Sbjct: 301 PVFSLLLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENA 360

Query: 361 DDLIKDLETALQELHNG 377
           +DLI+DL   L+++  G
Sbjct: 361 EDLIEDLAGTLEKIEKG 377

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  148 bits (374), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 199/403 (49%), Gaps = 58/403 (14%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  IHA    +    V  PI++STT++                     PV    YSR 
Sbjct: 46  FATKAIHAGTHTDVHGSVIEPISLSTTFKQSS---------------PANPVGIYEYSRS 90

Query: 60  AHPNATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIAN 115
            +PN   LE+  + +  G + + +SSG A   A ++   P+    I +G  Y G      
Sbjct: 91  QNPNRENLENAIAALENGKYGLAFSSGSAT-TATVLQSLPQGSHAISIGDVYGGTHRYFT 149

Query: 116 IMTRNYGVEQYTLDDIEK-----YAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGA 168
            +   +GVE    +D+ K       +   +V +ESP NP     DI+++A+  K+ +K  
Sbjct: 150 KVANAHGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDI 209

Query: 169 IVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIY 228
           I++VD+TF  P L    D GAD+V+HSATKY  GHSD++ GV+   D+ + +KL+  +  
Sbjct: 210 ILVVDNTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNA 269

Query: 229 LGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL--- 285
           +G      +S++  R L++  LR+ + S NATK+ +FL     +   ++K V +  L   
Sbjct: 270 IGAIPSPFDSWLAHRGLKTLHLRVRQASLNATKIAQFL-----QSSPLVKAVNYPGLPTH 324

Query: 286 QKEAFVKKQ----LVGGYGPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA 340
           +  A V+KQ    L GG   + S  +Q   +   KF    + F  A SLGG+ESL+E  A
Sbjct: 325 ENYAVVQKQHREALGGG---MISFRIQGGSEAASKFSSSTRLFTLAESLGGIESLLEVPA 381

Query: 341 -MTDPYIDQT----------LIRVSIGVENADDLIKDLETALQ 372
            MT   I +           L+R+S+G+E+ DDL+ D++ AL+
Sbjct: 382 VMTHGGIPKEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALE 424

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  147 bits (370), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 125/400 (31%), Positives = 198/400 (49%), Gaps = 44/400 (11%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +  G + + +SSG A   + ++   P+    + +G  Y G       +  
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSAT-TSVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQ-YTLDDIEKYAQ----EGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLV 172
            +GVE  +T + +E+  Q       +V +ESP NP     DI  +++  K+  K  I++V
Sbjct: 117 THGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVV 176

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN 232
           D+TF  P L    + GAD+V+HSATKY  GHSD++ GV+   D+++ ++L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAI 236

Query: 233 VGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF-- 290
               +S+++ R L++  LR+ + + NATK+ EFL  N    + V+   Y      E F  
Sbjct: 237 PSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASN----ENVIAVNYPGLPSSENFEV 292

Query: 291 VKKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYI 346
           VKKQ    +GG    F +     +   KF    + F  A SLGG+ESL+E  A MT   I
Sbjct: 293 VKKQHRDALGGGMISFRIK-GGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 DQT----------LIRVSIGVENADDLIKDLETALQELHN 376
            +           LIR+S+G+E++DDL+ D++ ALQ   N
Sbjct: 352 PKEQREASGVFDDLIRLSVGIEDSDDLLDDIKQALQGATN 391

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  146 bits (368), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 201/397 (50%), Gaps = 44/397 (11%)

Query: 3   HLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHP 62
            + T ++HA +  +    V  PI++STT++   +  +P    E          YSR  +P
Sbjct: 8   QISTKVVHAGEHVDIHGSVIEPISLSTTFK-QASPAVPVGAYE----------YSRSQNP 56

Query: 63  NATRLESLFSEILEG--HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIM 117
           N   LE   + +LE   H + +SSG A   A ++   P+    I +G  Y G     N +
Sbjct: 57  NRKNLEDAIA-VLENAKHGLAFSSGSAT-TAVILQSLPQGSHAISIGDVYGGTHRYFNNV 114

Query: 118 TRNYGVEQ-YT---LDDIEKYAQEG-DIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIV 170
              +GVE  +T   ++D+    +E   +V +ESP NP     DI+ +++  K+ +K  I+
Sbjct: 115 ANAHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIIL 174

Query: 171 LVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLG 230
           +VD+TF  P L    + GAD+V+HSATKY  GHSD++ GV+    + +  KL+  +  +G
Sbjct: 175 VVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIG 234

Query: 231 TNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYH--SSLQKE 288
                 ++++  R L++  LR+   S +A ++ EFL     + DKV+   Y   SS    
Sbjct: 235 AVPSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFL----VKSDKVISVNYPGLSSHPNN 290

Query: 289 AFVKKQLVGGY-GPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPY 345
             VKKQ   G  G + S  ++   D   KF    + F  A SLGG+ESL+E  A MT   
Sbjct: 291 DIVKKQHRDGLGGGMISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 I--DQT--------LIRVSIGVENADDLIKDLETALQ 372
           I  DQ         LIR+S+G+E+  DL+KD+E AL 
Sbjct: 351 IPKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  144 bits (363), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 197/400 (49%), Gaps = 52/400 (13%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  IHA    +    V  PI++STT++                    +P+    YSR 
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFKQS---------------APAQPIGTYEYSRS 53

Query: 60  AHPNATRLESLFSEILEG-HAVIYSSGCA--AFYAAMVHYNPKKIFMGQCYHGLRAIANI 116
            +PN   LE+  + +  G + + +SSG A  A     +  N   I +G  Y G       
Sbjct: 54  QNPNRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTK 113

Query: 117 MTRNYGVEQYTLDDIEK-----YAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAI 169
           +   +GVE    +D+ K       +   +V +ESP NP     DI+++++  K+ +K  +
Sbjct: 114 VANAHGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDIL 173

Query: 170 VLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYL 229
           ++VD+TF  P L    + GAD+V+HSATKY  GHSD++ GV+   ++E+ ++L+  +  +
Sbjct: 174 LVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAV 233

Query: 230 GTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL---Q 286
           G      +S++  R L++  LR+ + S  ATK+ EFL+ N       +K V +  L   +
Sbjct: 234 GAIPSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYPGLPTHE 288

Query: 287 KEAFVKKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MT 342
               VKKQ    +GG    F ++  + +   KF    + F  A SLGG+ESL+E  A MT
Sbjct: 289 NYDIVKKQHREALGGGMISFRINGGS-EAAAKFSSSTRLFTLAESLGGIESLLEVPAVMT 347

Query: 343 DPYIDQT----------LIRVSIGVENADDLIKDLETALQ 372
              I +           LIR+S+G+E+A DL+ D++ AL+
Sbjct: 348 HGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  144 bits (363), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 198/399 (49%), Gaps = 42/399 (10%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAEPIGEYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCA--AFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120
              LE   + +  G + + +SSG A  A     +  N   I +G  Y G     + +   
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVANT 117

Query: 121 YGVE-QYTLD---DIEKYAQEGD-IVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLVD 173
           +GV+  +T D   D+ K  +E   +V +ESP NP     DI+ +A+  K+ +K  +++VD
Sbjct: 118 HGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVVD 177

Query: 174 STFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNV 233
           +TF  P L    + GAD+V+HSATKY  GHSD++ GV+     ++ ++L+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAIP 237

Query: 234 GNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHS--SLQKEAFV 291
              ++++  R L++  LR+ + + NATK+ EFL     + D V+   Y    +    A V
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAALNATKIAEFL----AQSDNVVAVNYPGLPTNPDYAIV 293

Query: 292 KKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYID 347
           KKQ    +GG    F +     +   KF    + F  A SLGG+ESL+E  A MT   I 
Sbjct: 294 KKQHRDALGGGMISFRVK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 348 QT----------LIRVSIGVENADDLIKDLETALQELHN 376
           +           L+R+S+G+E+ DDL++D++ ALQ+  N
Sbjct: 353 KEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQKASN 391

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  142 bits (359), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 200/402 (49%), Gaps = 54/402 (13%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  IHA    +    V  PI++STT+R                    +P+    YSR 
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFRQS---------------APAQPIGTYEYSRS 53

Query: 60  AHPNATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIAN 115
            +PN   LE   + +  G + + +SSG A   A ++   P+    I +G  Y G      
Sbjct: 54  QNPNRENLEVAIASLENGKYGLAFSSGSAT-TAVILQSLPQGSHAISIGDVYGGTHRYFT 112

Query: 116 IMTRNYGVE-QYT---LDDIEKYAQEG-DIVEVESPMNPYGTSIDIKSIAEKAHS--KGA 168
            +   +GVE  +T   L+D+ K  +E   +V +ESP NP     DI+++++K  S  K  
Sbjct: 113 KVANAHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDI 172

Query: 169 IVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIY 228
           +++VD+TF  P L    + GAD+V+HSATKY  GHSD++ GV+   ++++ ++L+  +  
Sbjct: 173 LLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNA 232

Query: 229 LGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKE 288
           +G      ++++  R LR+  LR+ + S +A K+ EFL  N+      ++ V +  L   
Sbjct: 233 IGAIPSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VEAVNYPGLPTH 287

Query: 289 A---FVKKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-M 341
                VKKQ    +GG    F +     +   KF    + F  A SLGGVESL+E  A M
Sbjct: 288 KDYDVVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVM 346

Query: 342 TDPYIDQ----------TLIRVSIGVENADDLIKDLETALQE 373
           T   I +           L+R+S+G+E+ DDL++D++ AL++
Sbjct: 347 THGGIPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  140 bits (354), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 200/402 (49%), Gaps = 54/402 (13%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  IHA   ++    V  PI++STT++  E                 KP+    YSR 
Sbjct: 9   FATKAIHAGAHEDIHGSVIEPISLSTTFKQSE---------------PAKPIGTYEYSRS 53

Query: 60  AHPNATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIAN 115
            +PN   LE+  + +  G + + +SSG A   A ++   P+    + +G  Y G      
Sbjct: 54  QNPNRENLEAAIASLEGGKYGLAFSSGSAT-TAVILQSLPQGSHAVSIGDVYGGTHRYFT 112

Query: 116 IMTRNYGVE-QYT---LDDIEKYAQEG-DIVEVESPMNPYGTSIDIKSIAE--KAHSKGA 168
            +   +GV+  +T   ++D+ K  ++   +V +ESP NP     DI+ +AE  K  +K  
Sbjct: 113 KVANAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDI 172

Query: 169 IVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIY 228
           +++VD+TF  P L      GAD+V+HSATKY  GHSD++ GV+    +++ ++L+  +  
Sbjct: 173 LLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNA 232

Query: 229 LGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKE 288
           +G      ++++  R L++  LR+ + S NATK+  FL  N+      +  V +  LQ  
Sbjct: 233 IGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNEN-----VVAVNYPGLQSH 287

Query: 289 A---FVKKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-M 341
                VKKQ    +GG    F +     +   KF    + F  A SLGG+ESL+E  A M
Sbjct: 288 PNYDVVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVM 346

Query: 342 TDPYIDQT----------LIRVSIGVENADDLIKDLETALQE 373
           T   I +           L+R+S+G+E+ +DL++D++ ALQ+
Sbjct: 347 THGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  137 bits (344), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 119/392 (30%), Positives = 193/392 (49%), Gaps = 36/392 (9%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHTDVHGSVIEPISLSTTFK-QTAPAQPVGEYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RKNLEDAVAALENAKYGLAFSSGSAT-TAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQ-YTLDDIEKYAQ----EGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLV 172
            +GVE  +T + +E  AQ       +V +ESP NP     DI+ +++  K+ +K  +++V
Sbjct: 117 AHGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVV 176

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN 232
           D+TF  P L    + GAD+V+HSATKY  GHSD++ GV+   D+E+ ++L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAI 236

Query: 233 VGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVK 292
               ++++  R L++  LR+ + +  ATK+ EFL+   E    V      +       +K
Sbjct: 237 PSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLS-QSEDVVAVNYPGLPTHPNHNVVLK 295

Query: 293 KQLVGGYGPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYI--DQ 348
           +   G  G + S  ++   +   KF    + F  A SLGG+ESL+E  A MT   I  DQ
Sbjct: 296 QHRDGLGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQ 355

Query: 349 T--------LIRVSIGVENADDLIKDLETALQ 372
                    LIR+SIG+E+ DDL+ D++ AL+
Sbjct: 356 REASGVFDDLIRLSIGIEDTDDLLDDIKQALE 387

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  136 bits (343), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 113/398 (28%), Positives = 198/398 (49%), Gaps = 37/398 (9%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA +  +    V  PI++STT++   +   P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RENLERAVAALENAQYGLAFSSGSAT-TATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVE-QYT---LDDIEKYAQEG-DIVEVESPMNPYGTSIDIKSIAE--KAHSKG--AIV 170
            +GVE  +T   L+D+ +  +E   +V +E+P NP     DI+ +A+  K H+ G   I+
Sbjct: 117 AHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 LVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLG 230
           +VD+TF  P +    + GAD+V+HSATKY  GHSD++ GV+   ++ + ++L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIG 236

Query: 231 TNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF 290
                 ++++  R L++  LR+ + + +A K+ EFL  +KE    V      +    +  
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLKTHPNYDVV 296

Query: 291 VKKQLVGGYGPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYIDQ 348
           +K+      G + S  ++   +   KF    + F  A SLGG+ESL+E  A MT   I +
Sbjct: 297 LKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPK 356

Query: 349 T----------LIRVSIGVENADDLIKDLETALQELHN 376
                      L+R+S+G+E+ DDL++D++ AL++  N
Sbjct: 357 EAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQATN 394

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  136 bits (342), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 112/399 (28%), Positives = 191/399 (47%), Gaps = 38/399 (9%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA +  +    V  PI++STT++   +   P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RENLERAVAALENAQYGLAFSSGSAT-TATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQYTLDDIEK-----YAQEGDIVEVESPMNPYGTSIDIKSIAEK-----AHSKGAI 169
            +GVE    +D+ K           +V +E+P NP     DI+ +A+      A S+  I
Sbjct: 117 AHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVI 176

Query: 170 VLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYL 229
           ++VD+TF  P +    + GAD+V+HSATKY  GHSD++ GV+    + + ++L+  +  +
Sbjct: 177 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAI 236

Query: 230 GTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEA 289
           G      ++++  R L++  LR+ + + +A K+ EFL  +KE    V      +    + 
Sbjct: 237 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKENIVAVNYPGLKTHPNYDV 296

Query: 290 FVKKQLVGGYGPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYID 347
            VK+      G + S  ++   +   KF    + F  A SLGG+ESL+E  A MT   I 
Sbjct: 297 VVKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIP 356

Query: 348 QT----------LIRVSIGVENADDLIKDLETALQELHN 376
           +           L+R+S+G+E+ADDL+ D++ AL++  N
Sbjct: 357 KEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQASN 395

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  136 bits (342), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 118/394 (29%), Positives = 190/394 (48%), Gaps = 42/394 (10%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++   +   P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDIHGSVIEPISLSTTFK-QSSPAAPLGEYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RKNLEEALAALENAKYGLAFSSGSAT-TAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQYTLDDIEK-----YAQEGDIVEVESPMNPYGTSIDIKSIAEKAH--SKGAIVLV 172
            +GV+    +D+ K       +   +V +ESP NP     DI  + + A   +K  +V+V
Sbjct: 117 AHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVV 176

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN 232
           D+TF  P L    + G D+V+HSATKY  GHSD++ GV+   D+ + +KL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAI 236

Query: 233 VGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVY---HSSLQKEA 289
               +S++  R L++  LR+ + +  ATK+ EFL    E+   VL   Y    S+  +E 
Sbjct: 237 PSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFL----EQDSNVLAVNYPGLASNPDREI 292

Query: 290 FVKKQLVGGYGPVFSMSLQTIDQ-CKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYID 347
             ++   G  G + S  ++   Q   KF    + F  A SLGG+ESL+E  A MT   I 
Sbjct: 293 VQRQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 348 QT----------LIRVSIGVENADDLIKDLETAL 371
           +           LIR+S+G+E++DDL+ D++ AL
Sbjct: 353 KEQREASGVYDDLIRLSVGIEDSDDLLTDIKEAL 386

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  135 bits (341), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/400 (29%), Positives = 194/400 (48%), Gaps = 44/400 (11%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGTHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +  G + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSAT-TAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQYTLDDI-----EKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHS--KGAIVLV 172
            +GVE    +++         +   +V +E+P NP     DI+ +A+ A S  K  +++V
Sbjct: 117 AHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVV 176

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN 232
           D+TF  P L    + GAD+V+HSATKY  GHSD++ GV+   D+ + +KL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAI 236

Query: 233 VGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF-- 290
               +S+++ R +++  LR+ + S +A K+ EFL+ N    + V+   Y      E++  
Sbjct: 237 PSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSN----ENVIAVNYPGLPTHESYAV 292

Query: 291 VKKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYI 346
           VKKQ    +GG    F +     +    F    + F  A SLGG+ESL+E  A MT   I
Sbjct: 293 VKKQHRDALGGGMISFRIK-GGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 DQT----------LIRVSIGVENADDLIKDLETALQELHN 376
            +           L+R+SIG+E+ DDL++D++ AL    N
Sbjct: 352 PKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQALASASN 391

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/398 (27%), Positives = 194/398 (48%), Gaps = 37/398 (9%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA +  +    V  PI++STT++   +   P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHIDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RENLEKAVAALENAQYGLAFSSGSAT-TATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQYTLDDI-----EKYAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKG--AIV 170
            +GVE    +D+     +       +V +E+P NP     DI+ +A+  K H+ G   I+
Sbjct: 117 AHGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 LVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLG 230
           +VD+TF  P +    + GAD+V+HSATKY  GHSD++ GV+   ++++ ++L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIG 236

Query: 231 TNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF 290
                 ++++  R L++  LR+ + + +A K+ EFL  +KE    V      +    +  
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENVVAVNYPGLKTHPNYDVV 296

Query: 291 VKKQLVGGYGPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYIDQ 348
           +K+      G + S  ++   +   KF    + F  A SLGG+ESL+E  A MT   I +
Sbjct: 297 LKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPK 356

Query: 349 T----------LIRVSIGVENADDLIKDLETALQELHN 376
                      L+R+S+G+E+ DDL++D++ AL++  N
Sbjct: 357 EAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQATN 394

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  134 bits (338), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 117/400 (29%), Positives = 189/400 (47%), Gaps = 50/400 (12%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  IHA    +    V  PI++STT++                    +P+    YSR 
Sbjct: 9   FATLAIHAGAHTDVHGSVIEPISLSTTFKQS---------------APAQPIGAYEYSRS 53

Query: 60  AHPNATRLESLFSEILEGH-AVIYSSGCA--AFYAAMVHYNPKKIFMGQCYHGLRAIANI 116
            +PN   LE+  + +      + +SSG A  A     +  +   I +G  Y G       
Sbjct: 54  QNPNRANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQ 113

Query: 117 MTRNYGVEQYTLDDIEK-----YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGA--I 169
           +   +GV+    +D+E+           +V +ESP NP     DI+ +A+ AH+     +
Sbjct: 114 VAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDIL 173

Query: 170 VLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYL 229
           V+VD+TF  P +      GAD+V+HSATKY  GHSD++ GV+   +E + ++LR  +  +
Sbjct: 174 VVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAI 233

Query: 230 GTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYH--SSLQK 287
           G      +S++  R L++  LR+   +++A ++ +FL    E  D+V    Y   SS   
Sbjct: 234 GAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFL----EASDRVEHVNYPGLSSHPA 289

Query: 288 EAFVKKQ---LVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTD 343
            A V+KQ    +GG    F +         +F    + F  A SLGG+ESLVE  A MT 
Sbjct: 290 YAVVQKQHRDALGGGMISFRIK-GGAGAAARFTSTTRLFTLAESLGGIESLVEVPAVMTH 348

Query: 344 PYIDQ----------TLIRVSIGVENADDLIKDLETALQE 373
             I +           LIR+S+G+E+ DDL++D+  AL++
Sbjct: 349 GGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  134 bits (337), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 191/395 (48%), Gaps = 42/395 (10%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFK-QSAPAQPLGEYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +  G H + +SSG A   A ++   P+    I +G  Y G       +  
Sbjct: 58  RKNLEDAIASLENGKHGLAFSSGSAT-TAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQYTLDDIEK-----YAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLV 172
            +GV+    +++ K           ++ +ESP NP     DI  + +  K  +K  +V+V
Sbjct: 117 AHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVV 176

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN 232
           D+TF  P L    D G DVV+HSATKY  GHSD++ GV+     E+ ++L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAI 236

Query: 233 VGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYH--SSLQKEAF 290
               ++++  R L++  LR+ + +  ATK+ EFL  N    D+V+   Y   +S      
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSN----DRVIAVNYPGLASHPSHDV 292

Query: 291 VKKQLVGGY-GPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYI- 346
           V++Q   G  G + S  ++   +   KF    + F  A SLGG+ESL+E  A MT   I 
Sbjct: 293 VQRQHRDGLGGGMISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 347 -DQT--------LIRVSIGVENADDLIKDLETALQ 372
            DQ         LIR+S+G+E+ +DL++D++ AL+
Sbjct: 353 EDQREASGVYDDLIRLSVGIEDTEDLLEDIKQALK 387

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  134 bits (337), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 191/395 (48%), Gaps = 37/395 (9%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA +  +    V  PI++STT++   +   P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    + + +SSG A   A ++   P+    + +G  Y G       +  
Sbjct: 58  RENLERAVAALENAQYGLAFSSGSAT-TATILQSLPQGAHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQYTLDDI-----EKYAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKG--AIV 170
            +GVE    +D+     +       +V +E+P NP     DI+ +A+  K H+ G   I+
Sbjct: 117 AHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 LVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLG 230
           +VD+TF  P +    D GAD+V+HSATKY  GHSD++ GV+    + + ++L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIG 236

Query: 231 TNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF 290
                 ++++  R L++  LR+ + + +A K+ EFL  +KE    V      +    +  
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENIVAVNYPGLKTHPNYDVV 296

Query: 291 VKKQLVGGYGPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDPYIDQ 348
           +K+      G + S  ++   +   KF    + F  A SLGG+ESL+E  A MT   I +
Sbjct: 297 LKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPK 356

Query: 349 T----------LIRVSIGVENADDLIKDLETALQE 373
                      LIR+S+G+E+ DDL++D++ AL++
Sbjct: 357 EAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  131 bits (329), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 191/398 (47%), Gaps = 48/398 (12%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  IHA    +    V  PI++STT++            + +   E    YSR  +PN
Sbjct: 9   FATKAIHAGAHIDVHGSVIEPISLSTTFKQSAPS-------QPIGIYE----YSRSQNPN 57

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +  G + + +SSG A   A ++   P+    I +G  Y G       +  
Sbjct: 58  RKNLEEAIATLENGKYGLAFSSGSAT-TAVILQSLPQGSHSISIGDVYGGTHRYFTKVAN 116

Query: 120 NYGVEQ-YTLDDIEKYAQ----EGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLV 172
            +GVE  ++ + IE+          +V +ESP NP     DI+ + +  K  +K  +V+V
Sbjct: 117 AHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLNKDILVVV 176

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN 232
           D+TF  P L    + GAD+V+HSATKY  GHSD++ GV+    +E+ ++L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNAIGAI 236

Query: 233 VGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEA--- 289
               ++++  R L++  LR+ + S +A K+ EFL       D  +  V +  L+      
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQ-----DPNVIAVNYPGLESHPNRD 291

Query: 290 FVKKQLVGGY-GPVFSMSLQ-TIDQCKKFPGKLKYFHHATSLGGVESLV----------- 336
            VKKQ   G  G + S  ++   +   KF  K + F  A SLGG+ESL+           
Sbjct: 292 IVKKQHRDGLGGGMISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 337 --EWRAMTDPYIDQTLIRVSIGVENADDLIKDLETALQ 372
             E R  T  Y D  L+R+S+G+E+ DDL+ D++ AL 
Sbjct: 352 PKEAREATGVYDD--LVRLSVGIEDVDDLLADVKQALN 387

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  127 bits (318), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 108/398 (27%), Positives = 193/398 (48%), Gaps = 48/398 (12%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  +HA +  +    V  PI++STT++                     P+    YSR 
Sbjct: 7   FATLAVHAGEHTDVHGSVIEPISLSTTFKQSS---------------PANPIGVYEYSRS 51

Query: 60  AHPNATRLESLFSEILEG-HAVIYSSGCAAFYAAM--VHYNPKKIFMGQCYHGLRAIANI 116
            +PN   LE+  + + +  + + +SSG AA    M  +      + +G  Y G       
Sbjct: 52  QNPNRDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTK 111

Query: 117 MTRNYGVEQ-YT---LDDIEKYAQEGD-IVEVESPMNPYGTSIDIKSIAE--KAHSKGAI 169
           +   +GVE  +T   L+++    ++   +V +ESP NP     DI++++   K  +K  +
Sbjct: 112 VANTHGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDIL 171

Query: 170 VLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYL 229
           ++VD+TF  P L      GAD+V+HSATKY  GHSD++ GV+    +++ ++L+  +  +
Sbjct: 172 LVVDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAI 231

Query: 230 GTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKE----RFDKVLKEVYHSSL 285
           G      ++++  R L++  LR+ + S  A K+ EFL+ +K      +  +     H+ +
Sbjct: 232 GAIPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSASKHVEAVNYPGLKTHPNHAVV 291

Query: 286 QKEAFVKKQLVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRA-MTDP 344
           Q++    +  +GG G +            KF    + F  A SLGG+ESL+E  A MT  
Sbjct: 292 QRQ---HRDALGG-GMISFRVKGGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHG 347

Query: 345 YIDQ----------TLIRVSIGVENADDLIKDLETALQ 372
            I +           LIR+S+G+E+ +DL++D++ AL+
Sbjct: 348 GIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  126 bits (316), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 192/398 (48%), Gaps = 50/398 (12%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPV----YSRL 59
             T  IHA    +    V  PI++STT++                     PV    YSR 
Sbjct: 9   FATKAIHAGAHTDLHGSVIEPISLSTTFKQSS---------------PGNPVGAYEYSRG 53

Query: 60  AHPNATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIAN 115
            +PN   LE   + +    + + +SSG A   A +V   P+    I +G  Y G      
Sbjct: 54  QNPNRQNLEEAIAALESAKYGLAFSSGSAT-TAVIVQSLPQGSHAISIGDVYGGTHRYFT 112

Query: 116 IMTRNYGVE-QYT---LDDIEKYAQEGD-IVEVESPMNPYGTSIDIKSIAE--KAHSKGA 168
            +   +GVE  +T   L+D+ K  ++   +V +ESP NP     DI+ +A+  KA ++  
Sbjct: 113 KVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDI 172

Query: 169 IVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIY 228
           I++VD+TF  P L    + GAD+V+HSATKY  GHSD++ G +      + ++L   +  
Sbjct: 173 ILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNA 232

Query: 229 LGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHS--SLQ 286
           +G      ++++  R L++  LR+ + +++A K+ E+L    E+ + V+   Y    S +
Sbjct: 233 IGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYL----EQSEHVVSVNYPGLPSHR 288

Query: 287 KEAFVKKQLVGGY-GPVFSMSLQTIDQCKKFPGK-LKYFHHATSLGGVESLVEWRA-MTD 343
                +KQ   G  G + S  ++   Q      +  + F  A SLGG+ESL+E  A MT 
Sbjct: 289 GYQIAQKQHRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTH 348

Query: 344 PYIDQT----------LIRVSIGVENADDLIKDLETAL 371
             I +           L+RVS+G+E+ DDL++D++ AL
Sbjct: 349 AGIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQAL 386

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score =  105 bits (261), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 109/415 (26%), Positives = 176/415 (42%), Gaps = 57/415 (13%)

Query: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60
           +  L T +++   ++++ S   PP+ +STT++ D  +     + +N D       YSR  
Sbjct: 3   IKRLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSG 51

Query: 61  HPNATRLESLFSEIL---EGHAVIYSSGCAAFYAAMV---------HYNPKKIFMGQCYH 108
           +P  + L+    ++    + + +  SSG  A    +          ++ P  I     Y 
Sbjct: 52  NPTRSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYG 111

Query: 109 GLRAIANIMTRNYGVEQYTLD--DIEKYA------QEGDIVEVESPMNPYGTSIDIKSIA 160
           G + + N   +        +D  D EK+        + D V +ESP NP    +DI  I 
Sbjct: 112 GTQRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRIL 171

Query: 161 E--KAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVK 214
              K  S    V+VD+T        PLQ   + G DVV  SATKY  GH DL+ GVI+ K
Sbjct: 172 RFVKCISPDTTVVVDNTMMSGLNCNPLQL--NPGCDVVYESATKYLNGHHDLMGGVIISK 229

Query: 215 DEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFL----NLNK 270
             E+  KL       G  +  ++S++L+R L++  +R+ +Q  NA  +  +L        
Sbjct: 230 TPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKP 289

Query: 271 ERFDKVLKEVYHSSLQKEAF-VKKQLVGGYGPVFSMSLQTIDQCKKF--PGKLKYFHHAT 327
            R +K  K  +        F + K    G G V S    + +  K+     KL  +    
Sbjct: 290 TRTNKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTV 349

Query: 328 SLGGVESLVEW-----RAMTDPYI------DQTLIRVSIGVENADDLIKDLETAL 371
           S G V SL+        A  DP +       + L+R+  G+EN  DL KDL  A+
Sbjct: 350 SFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 108/412 (26%), Positives = 175/412 (42%), Gaps = 57/412 (13%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ S   PP+ +STT++ D ++       ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSN----ETAQDYD-------YSRSGNPT 54

Query: 64  ATRLESLFSEIL---EGHAVIYSSGCAAF---------YAAMVHYNPKKIFMGQCYHGLR 111
            + L++   ++    + + +  SSG  A          +    ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIMTRNYGVEQYTLD--DIEKYA------QEGDIVEVESPMNPYGTSIDIKSIAE-- 161
            + N   +        +D  D EK+        + D V +ESP NP    +DI  I    
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 KAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEE 217
           K  S    V+VD+T        PLQ   D G DVV  SATKY  GH DL+ GVI+ K  E
Sbjct: 175 KCISPETTVVVDNTMMSGLNCNPLQL--DPGCDVVYESATKYLNGHHDLMGGVIISKTAE 232

Query: 218 VCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFL----NLNKERF 273
           +  KL       G  +  ++S++L+R L++  +R+ +Q  NA  +  +L           
Sbjct: 233 IAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTET 292

Query: 274 DKVLKEVYHSSLQKEAF-VKKQLVGGYGPVFSMSLQTIDQCKKF--PGKLKYFHHATSLG 330
           +K  K  +        F + +    G G V S    + +  K+     KL  +    S G
Sbjct: 293 NKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 331 GVESLVEW-----RAMTDPYI------DQTLIRVSIGVENADDLIKDLETAL 371
            V SL+        A  DP +       + LIR+  G+EN  DL KDL  A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDLLAAM 404

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 107/398 (26%), Positives = 172/398 (43%), Gaps = 67/398 (16%)

Query: 24  PINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPNATRLES----LFSEILEGHA 79
           P+ +STT++ D        E EN  +      YSR  +P  T L+     L+ +I     
Sbjct: 11  PLYLSTTFKVD-------LENENNQYD-----YSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 80  VIYSSGCAAFYAAMVHYNPKK-----IFMGQ-CYHGLRAIANIM-------------TRN 120
              SSG  A    +  + P +     I  G   Y G + + N++             T N
Sbjct: 59  FAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTEN 118

Query: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLVDSTFAP 178
           +  + Y L  I+K     DI+ +ESP NP    IDI  + +  + +S   ++++D+T   
Sbjct: 119 FKAKFYDLVTIKKTIV--DIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMS 176

Query: 179 PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYL-----GTNV 233
                    GADVV  SATKY  GH D+++GVI+ K+     KL  ++IY      G+ +
Sbjct: 177 GLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKN-----KLLAEKIYFLINSTGSGL 231

Query: 234 GNLESYMLLRSLRSYELRILKQSENATKVVEFL----NLNKERFDKVLKEVYHSSLQKEA 289
             ++S++L+R L++  +R+ KQ  NA  +  +L           +  LK  Y        
Sbjct: 232 NPMDSWLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRYIGLKSHPD 291

Query: 290 F-VKKQLVGGYGPVFSMSLQTIDQCKKFPGK--LKYFHHATSLGGVESLVEW-----RAM 341
           + + +    G G V S+   +I   KK      LK ++   S G V SL+        A 
Sbjct: 292 YELHRSFNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCLMSHAS 351

Query: 342 TDPYI------DQTLIRVSIGVENADDLIKDLETALQE 373
            DP +       + LIR+  G+E+   L +DL  A  E
Sbjct: 352 IDPELRKERQFPEDLIRLCCGIEDVKALQEDLLGAFVE 389

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 107/412 (25%), Positives = 172/412 (41%), Gaps = 57/412 (13%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ S   PP+ +STT++ D  +       +N D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQNFD-------YSRSGNPT 54

Query: 64  ATRLESLFSE---ILEGHAVIYSSGCAAF---------YAAMVHYNPKKIFMGQCYHGLR 111
            + L++   +   + + + +  SSG  A               ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIMTRNYGVEQYTLD--DIEKY------AQEGDIVEVESPMNPYGTSIDIKSIAE-- 161
            + N            +D  D EK+        + D V +ESP NP    +DI  I    
Sbjct: 115 RLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFV 174

Query: 162 KAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEE 217
           K  S   IV+VD+T        PLQ   +   DVV  SATKY  GH DL+ GVI+ K  E
Sbjct: 175 KRISPETIVIVDNTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 VCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFL----NLNKERF 273
           +  KL       G  +  ++S++L+R L++  +R+ +Q  NA  +  +L           
Sbjct: 233 IASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTET 292

Query: 274 DKVLKEVYHSSLQKEAF-VKKQLVGGYGPVFSMSLQTIDQCKKF--PGKLKYFHHATSLG 330
           +K  K  +        F + +    G G V S    + +  K+     KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFG 352

Query: 331 GVESLVEW-----RAMTDPYI------DQTLIRVSIGVENADDLIKDLETAL 371
            V SL+        A  DP +       + L+R+  G+EN  DL KDL  A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 131/282 (46%), Gaps = 34/282 (12%)

Query: 115 NIMTRNYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLV 172
           N+ T N+   Q     ++K     D V +ESP NP    +D+  I    K+ S    V+V
Sbjct: 124 NVDTSNFDKFQEAFLSVDKV----DCVHIESPTNPMCKVVDVPRIISFVKSVSPQTYVIV 179

Query: 173 DSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYL--- 229
           D+T     L     LGAD V  SATK+  GH D+++GV+V +++++      D IY    
Sbjct: 180 DNTMMSGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVN 234

Query: 230 --GTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLN---KERFDKVLKEVYHSS 284
             G  +  ++S++L+R L++  +R+ +Q  NA  + E+L  +   K+  D  L    +  
Sbjct: 235 ATGCGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVG 294

Query: 285 LQK--EAFVKKQLVGGYGPVFSMSLQTIDQCKKFPGK--LKYFHHATSLGGVESLVEW-- 338
           LQ   +  + +    G G V S    +    ++      LK +    S G V SL+    
Sbjct: 295 LQSHPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLPC 354

Query: 339 ---RAMTDPYI------DQTLIRVSIGVENADDLIKDLETAL 371
               A  DP +       + LIR+ +G+E+  DL KDL  A+
Sbjct: 355 SMSHASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/382 (24%), Positives = 164/382 (42%), Gaps = 33/382 (8%)

Query: 13  DKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPNATRLESLFS 72
           + D +   V PP+   +T  + + D        +++ M+ +  Y     P    LE  ++
Sbjct: 22  NPDEQNGFVNPPLYKGSTIIHKKLD--------DVEHMKGRFFYGTAGSPTIANLEDAWT 73

Query: 73  EILEGHAVIYS-SGCAAFYAAMVHYNPKK---IFMGQCYHGLRAIANIMTRNYGVEQYTL 128
            +  G   + S SG  +   A++         +     Y   R + + +   +G+E    
Sbjct: 74  HLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPTRMLCDGLLAKFGIETEYY 133

Query: 129 D-----DIEKYAQEGD-IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQ 182
           D     DI+K  +    ++ +ESP +      DI ++   A   G   ++D+T+A P   
Sbjct: 134 DPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNTWATPLFF 193

Query: 183 YAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLL 242
            A   G D+ L + TKY GGHSDLL G +   +EE    LR     +    G  +  + L
Sbjct: 194 DAHGHGIDISLEAGTKYLGGHSDLLIG-LTSANEECWPLLRSTYDAMAMLPGADDCLLAL 252

Query: 243 RSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPV 302
           R +R+  LR+ +    A  +  +L  +++  +KVL   +      E +V+     G   +
Sbjct: 253 RGMRTLHLRLKEAERKALDLAAWLE-DRDEVEKVLHPAFKDCPGHEYWVRD--YKGSSGL 309

Query: 303 FSMSLQ---TIDQCKKFPGKLKYFHHATSLGGVESLV-------EWRAMTDPYIDQTLIR 352
           FS+ L+   T    +    K+K FH   S GG ESL+       + +A   P+    L R
Sbjct: 310 FSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLITPVNPARQRKAANWPHRGFAL-R 368

Query: 353 VSIGVENADDLIKDLETALQEL 374
           + +G+E   DL +DLE   + L
Sbjct: 369 IQVGLEELTDLKRDLELGFERL 390

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 173/418 (41%), Gaps = 65/418 (15%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T +++   ++++ S   PP+ +STT++ D  +       ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQDYD-------YSRSGNPT 54

Query: 64  ATRLESLFSEIL---EGHAVIYSSGCAAF---YAAMVHYN------PKKIFMGQCYHGLR 111
            + L++   ++    + + +  SSG  A       +V  N      P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIM------------TRNYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSI 159
            + N              T N+   +     ++K     D V +ESP NP    +DI  I
Sbjct: 115 RLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKV----DCVLLESPTNPLCKVVDIPKI 170

Query: 160 AE--KAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVV 213
               K  S    V+VD+T        PLQ   +   DVV  SATKY  GH DL+ GVI+ 
Sbjct: 171 LRYVKCVSPDTKVIVDNTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIIS 228

Query: 214 KDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFL----NLN 269
           K  E+  KL       G  +  ++S++L+R L++  +R+ +Q  NA  +  +L       
Sbjct: 229 KTAEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFK 288

Query: 270 KERFDKVLKEVYHSSLQKEAF-VKKQLVGGYGPVFSMSLQTIDQCKKF--PGKLKYFHHA 326
               +K  K  +        F + +    G G V S    + +  K+     KL  +   
Sbjct: 289 PTATNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVT 348

Query: 327 TSLGGVESLVEW-----RAMTDPYI------DQTLIRVSIGVENADDLIKDLETALQE 373
            S G V SL+        A  DP +       + L+R+  G+EN  DL KDL  A+ E
Sbjct: 349 VSFGCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDLLAAMVE 406

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 120/255 (47%), Gaps = 28/255 (10%)

Query: 143 VESPMNPYGTSIDIKSIAE--KAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           +ESP NP     D+ ++    KAH+ G  V+VD+T           LGAD V  SATKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENAT 260
            GH D+++GVIV     + ++       +G  +  +++++L+R L++  LR+ KQ  NA 
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 261 KVVEFL----NLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTIDQ---- 312
            +  +L           +  L+  +   L+     K       GP   +S+QT D     
Sbjct: 268 VLAHWLREVCGFRAVGGNHALQTRF-VGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSE 326

Query: 313 ---CKKFPGKLKYFHHATSLGGVESLVEW-----RAMTDPYIDQT------LIRVSIGVE 358
              C K   KL+++    S G V SL+        A  DP + +       LIR+S GVE
Sbjct: 327 RIVCSK---KLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVE 383

Query: 359 NADDLIKDLETALQE 373
           + +DL +DL  AL++
Sbjct: 384 DVEDLQQDLLAALED 398

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 121/469 (25%), Positives = 187/469 (39%), Gaps = 120/469 (25%)

Query: 2   THLGTSLIHA-----DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-- 54
           +H  T  +HA     DD  NR   V  PI  +T+Y +++++        NL F  K P  
Sbjct: 3   SHFDTIQLHAGQENPDDNANRPRAV--PIYATTSYVFNDSE-----HGSNL-FGLKVPGY 54

Query: 55  VYSRLAHPNATRLESLFSEILEG-HAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGL 110
           VYSR  +P    LE   + +  G  AV  +SG AA   A   + H     I     Y G 
Sbjct: 55  VYSRFQNPTQNVLEERMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGT 114

Query: 111 RAIANIMTRNYGVEQYTL-----DDIEKYAQE-GDIVEVESPMNPYGTSIDIKSIAEKAH 164
                +  +  G+E   +     DD EK   +    V +ES  NP     D + I E AH
Sbjct: 115 YNQFKVAFKRLGIEARFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAH 174

Query: 165 SKGAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIV------- 212
             G  V+VD+TF        P++Y    GAD+V HSATK+ GGH   ++G+IV       
Sbjct: 175 KHGVPVVVDNTFGAGGFFCQPIKY----GADIVTHSATKWIGGHGTTIAGMIVDSGKFPW 230

Query: 213 ----VKDEEVCKK--------------------------LRDDRIYLGTNVGNLESYMLL 242
                K  +  K                           LRD    LG  +    +++L+
Sbjct: 231 ADYPEKFPQFSKPAEGYHGTIFNEAYGNLAYIVHVRVELLRD----LGPAISPFAAFLLI 286

Query: 243 RSLRSYELRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGG 298
           + + +  LR  +  +NA K+ ++L     ++   +  +    YH +       KK L  G
Sbjct: 287 QGIETLSLRGERHGQNALKLAQWLEQSPYVSWVSYPGLPSHPYHEN------AKKYLSNG 340

Query: 299 YGPVFSMSLQTID-------QCKKFPG-------KLKYFHHATSLGGVESLVEWRAMTDP 344
           +G V S  ++ I          K F          LK   +  ++G  ++LV       P
Sbjct: 341 FGGVLSFGVKDIPGQTKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLV-----IAP 395

Query: 345 Y----------------IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
           Y                + + LIRVS+G E  DD+I D + + +++  G
Sbjct: 396 YFTTHEQLDDDEKLLSGVTKDLIRVSVGTEFIDDIIADFQQSFEKVFAG 444

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 98/391 (25%), Positives = 169/391 (43%), Gaps = 59/391 (15%)

Query: 24  PINVSTTYRYDETDLIPWRERENLDFMEKKPV-YSRLAHPNATRLESLFSEILE---GHA 79
           P+ +STT++ D            LD  E +   YSR  +P  + L+    ++ E    H 
Sbjct: 29  PLYLSTTFKVD------------LDNPESQVFDYSRSGNPTRSLLQYQIGKLYEVPVEHV 76

Query: 80  VIYSSGCAAFYAAM-------VHYNPKKIFMGQCYHGL-RAIANIMTRNYGVEQYT-LDD 130
           +  +SG  A    +         + P  I     Y G  R +A + ++++    +    D
Sbjct: 77  LAVASGMTALDVILRGLVISSATHVPTIIAGDDLYGGSNRLLAYLESKSHARAVHVDTTD 136

Query: 131 IEKYA------QEGDIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLVDSTFAPP--- 179
           +EK+        + D V +ESP NP    +D+  +    K  S   +V+VD+T       
Sbjct: 137 MEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRISPSTVVIVDNTMMSGLQC 196

Query: 180 -PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLES 238
            PL+Y    G DVV  SATKY  GH D++ G+IV K  E+ +++       G+ +  ++S
Sbjct: 197 NPLEY----GCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDS 252

Query: 239 YMLLRSLRSYELRILKQSENATKVVEFL----NLNKERFDKVLKEVYHSSLQKEAF-VKK 293
           ++L R L++  +R+ +Q  N+  + ++L           +  LK  Y        F + +
Sbjct: 253 WLLNRGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSALKTRYVGLKTNPGFELHR 312

Query: 294 QLVGGYGPVFSMSLQTIDQCKKFPGK--LKYFHHATSLGGVESLVEW-----RAMTDPYI 346
               G G V S    +++  ++       + F    S G V SL+        A  DP +
Sbjct: 313 SFNKGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDPEV 372

Query: 347 DQT------LIRVSIGVENADDLIKDLETAL 371
            +       LIR+ +G+E+  DL KDL  A+
Sbjct: 373 RKQREFPEDLIRLCVGIEDVGDLQKDLLYAM 403

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 96/406 (23%), Positives = 169/406 (41%), Gaps = 48/406 (11%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L T L+      ++     PP+  STT++    +          D  +++  Y+R  +P 
Sbjct: 6   LHTKLVSVTHHKDQHGSSVPPLYQSTTFKQSSLE----------DDADQEYDYTRSGNPT 55

Query: 64  ATRLESLFSEI--LEGHAVI-YSSGCA-------AFYAAMVHYNPKKIFMGQCYHGLRAI 113
            + L+   +++  + G  V   SSG         A      ++ P  I     Y G + +
Sbjct: 56  RSVLQEQIAKLYNVPGFQVFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQRL 115

Query: 114 ANIMTRNYGVEQYTLD--DIEKY--AQEG----DIVEVESPMNPYGTSIDIKSIAE--KA 163
              + R        +D  D +K+  A  G    D V +ESP NP     D+  + +  K 
Sbjct: 116 LTFLERKNHARVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQ 175

Query: 164 HSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLR 223
            +    V+VD+T          +   DVV  S TKY  GH D+++GVI+ + +E+ ++L 
Sbjct: 176 ANPKCHVVVDNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQELY 235

Query: 224 DDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFL----NLNKERFDKVLKE 279
                 G  +  ++ ++L+R L++  +R+ +Q  NA  +  +L           +K+L+ 
Sbjct: 236 FVINSTGCGLSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLLRT 295

Query: 280 VYHSSLQKEAF-VKKQLVGGYGPVFSMSLQTIDQCKKF--PGKLKYFHHATSLGGVESLV 336
            Y        F + +    G G V S    + +  K+     KLK +    S G V SL+
Sbjct: 296 RYVGLKSHPQFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSLI 355

Query: 337 EW-----RAMTDPYI------DQTLIRVSIGVENADDLIKDLETAL 371
                   A  DP +       + L+R+  G+E+  DL KDL  A+
Sbjct: 356 SMPCKMSHASIDPELRKERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 150/352 (42%), Gaps = 29/352 (8%)

Query: 45  ENLDFMEKKPVYSRLAHPNATRLESLFSEILEGHAVIYS-SGCAAFYAAM---VHYNPKK 100
           E+L+ +  +  Y     P    LE  ++E+      + S +G  +   A+   V +    
Sbjct: 46  ESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHI 105

Query: 101 IFMGQCYHGLRAIANIMTRNYGVEQYTLD-----DIEKYAQEG-DIVEVESPMNPYGTSI 154
           +     Y       N + R +GV     D     DIE+  +    ++ +ESP +      
Sbjct: 106 LLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQ 165

Query: 155 DIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVK 214
           D+ +I + A       ++D+T+A P    A D G D+ + + TKY GGHSDLL G +   
Sbjct: 166 DVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLG-LTSA 224

Query: 215 DEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFD 274
           +      LR     +G   G  + ++ LR LR+ +LR+ +    A  + E+L    E  +
Sbjct: 225 NSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWLEARNE-VE 283

Query: 275 KVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTIDQ-----CKKFPGKLKYFHHATSL 329
           ++L   +        +V+     G   VF+  L+  DQ      K    K++ F    S 
Sbjct: 284 RILHPAFEDCPGHSLWVRD--YSGSTGVFTFILK--DQFSRAGLKDMLEKMQIFKLGYSW 339

Query: 330 GGVESLV-------EWRAMTDPYIDQTLIRVSIGVENADDLIKDLETALQEL 374
           GG ESL+         R  T  +    L R+ +G+E+ DD ++DLE   + L
Sbjct: 340 GGYESLLIPVNSTSRDRIRTWSHFGYAL-RIQVGLEDIDDQLRDLEMGFERL 390

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 118/463 (25%), Positives = 189/463 (40%), Gaps = 108/463 (23%)

Query: 2   THLGTSLIHA-----DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-V 55
           +H  T  +HA     DD  NR   V  PI  +T+Y ++++     +    L  +E    V
Sbjct: 3   SHFDTVQLHAGQENPDDNKNRPRAV--PIYATTSYVFNDS-----KHGAQLFGLEVPGYV 55

Query: 56  YSRLAHPNATRLESLFSEILEGHA-VIYSSGCAA---FYAAMVHYNPKKIFMGQCYHGLR 111
           YSR  +P     E   + +  G A V  SSG AA     + + H     +     Y G  
Sbjct: 56  YSRFQNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTY 115

Query: 112 AIANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHS 165
               +  +  GVE   +D     D EK + +    V +ES  NP     D + I   AH 
Sbjct: 116 NQFKVAFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHK 175

Query: 166 KGAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIV------VK 214
            G  V+VD+TF        PL++    GAD+V HSATK+ GGH   ++GV+V       K
Sbjct: 176 HGIPVVVDNTFGAGGFFCQPLKF----GADIVTHSATKWIGGHGTTVAGVVVDSGKFPWK 231

Query: 215 D--EEVCKKLRDDRIYLGT----NVGNL---------------------ESYMLLRSLRS 247
           D  E+  +  +    Y GT      GNL                      +++LL+ + +
Sbjct: 232 DYPEKFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVET 291

Query: 248 YELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF---VKKQLVGGYGPVFS 304
             LR  + + NA  + ++L  +       +  V +  L+  +     KK L  G+G V S
Sbjct: 292 LSLRCERHASNALALAKWLEKS-----PYVSWVSYPGLESHSHHENAKKYLSNGFGGVLS 346

Query: 305 MSL-----QTIDQCKKFP---------GKLKYFHHATSLGGVESLVEWRAMTDPY----- 345
             +     Q+ ++ KK P           L+   +  ++G  ++LV       PY     
Sbjct: 347 FGVKDLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLV-----IAPYFTTHQ 401

Query: 346 -----------IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
                      + + LIRVS+G E  DD+I D + + +++  G
Sbjct: 402 QLDDDEKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKVFAG 444

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 99/411 (24%), Positives = 171/411 (41%), Gaps = 57/411 (13%)

Query: 2   THLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAH 61
           T L + + H D   + V    PPI  STT++    +          D   +   Y+R  +
Sbjct: 8   TKLVSVVQHVDQHGSSV----PPIYQSTTFKIGSLE----------DDASQPYDYTRSGN 53

Query: 62  PNATRLESLFSEILE---GHAVIYSSGCAAF---YAAMVHYN----PKKIFMGQCYHGL- 110
           P  T ++    ++ +      +  SSG  A      A+V  N    P  I     Y G  
Sbjct: 54  PTRTVVQHQIGKLYDVDAAQVLAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQ 113

Query: 111 RAIANIMTRNYG-------VEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAE-- 161
           R + ++ +RN+            T  ++ K  +  D V +ESP NP     D+  +    
Sbjct: 114 RLLTHLESRNHARVLHVDTANYETFVEVFKQQEHVDCVLLESPTNPLLKVADLPRLTHFI 173

Query: 162 KAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK 221
           K+ ++  +V +D+T     L        DVV  SATKY  GH D+++G++V +  ++ ++
Sbjct: 174 KSANEACLVAIDNTMMSGMLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQE 233

Query: 222 LRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVY 281
           +       G+ +   +S++L+R L++  +R+ +Q  NA  +  +L  +     K  K V 
Sbjct: 234 IYFVINSTGSGLSPFDSWLLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGK--KGVK 291

Query: 282 HSSLQKEAFVK--------KQLVGGYGPVFSMSLQTIDQCKKFPG--KLKYFHHATSLGG 331
            S   +   +K        K    G G V S    + +  ++     K+K +    S G 
Sbjct: 292 GSPRTRFVGLKSHPQFELHKSFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGC 351

Query: 332 VESLVEW-----RAMTDPYIDQT------LIRVSIGVENADDLIKDLETAL 371
           V SL+        A  DP + Q       L+R+  G+EN  DL  DL  A+
Sbjct: 352 VNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENISDLQNDLLEAM 402

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 118/256 (46%), Gaps = 22/256 (8%)

Query: 141 VEVESPMNPYGTSIDIKSIAE--KAH--SKGAIVLVDSTFAPPPLQYAWDLGADVVLHSA 196
           V +ESP NP     D+  +    K+H    G  ++VD+T          +LGAD+V  SA
Sbjct: 161 VLLESPTNPLMKVADLPKLISFVKSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESA 220

Query: 197 TKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQS 256
           TK+  GH D+++GVIV    E+ + +      +G  +  ++S++L+R L++  +R+ +Q 
Sbjct: 221 TKFLNGHHDIMAGVIVAASVELAQDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRMYQQQ 280

Query: 257 ENATKVVEFLN-----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTID 311
            NA  +  +L         E+  ++           +  + +    G G V S+    I+
Sbjct: 281 HNAMVLAHWLQDSCGFAPTEQNSQLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIETGDIE 340

Query: 312 QCKKF--PGKLKYFHHATSLGGVESLVEW-----RAMTDPYI------DQTLIRVSIGVE 358
             +K     K KY++   S G V SL+        A  DP +       + LIR+  G+E
Sbjct: 341 LSEKIVCSKKFKYWNVTVSFGCVNSLISMPCKMSHASIDPELRKDRKFPEDLIRICCGIE 400

Query: 359 NADDLIKDLETALQEL 374
           +  DL  DL  A +++
Sbjct: 401 DVSDLQWDLLGAFEDV 416

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/350 (24%), Positives = 150/350 (42%), Gaps = 25/350 (7%)

Query: 45  ENLDFMEKKPVYSRLAHPNATRLESLFSEILEGHA--VIYSSGCAAFYAAMVHYNPKK-- 100
           E+L+  + +  Y     P    LE  ++  L G A  V+  SG  +   A++  +     
Sbjct: 46  EDLEQRKGRFFYGTAGSPTIANLEDAWTH-LTGSAGTVLSPSGLGSISLALLTLSKAGDH 104

Query: 101 -IFMGQCYHGLRAIANIMTRNYGVEQYTLD-----DIEKYAQEGD-IVEVESPMNPYGTS 153
            +     Y   R + + +   +G+E    D     DIEK  +    ++ +ESP +     
Sbjct: 105 ILITDSVYFPTRMLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEI 164

Query: 154 IDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVV 213
            +I ++   A   G   ++D+T+A P    A   G D+ L + TKY GGHSDLL G +V 
Sbjct: 165 QNIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLG-LVS 223

Query: 214 KDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERF 273
            +EE    LR     +    G  +  + LR +R+  LR+ +    A  +  +    ++  
Sbjct: 224 ANEECWPLLRSTYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWFK-KRDEV 282

Query: 274 DKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQ---TIDQCKKFPGKLKYFHHATSLG 330
           +KVL   +      E +V+     G   +FS+ L+   T    +     +K F    S G
Sbjct: 283 EKVLHPAFEDCPGHEYWVRD--YKGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYSWG 340

Query: 331 GVESLVE-----WRAMTDPYIDQTL-IRVSIGVENADDLIKDLETALQEL 374
           G +SL+       +    P+      +R+ +G+E  +DL +DLE   + L
Sbjct: 341 GYDSLITPVNPPTQRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERL 390

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 106/414 (25%), Positives = 170/414 (41%), Gaps = 62/414 (14%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
           L TSL+     D   S V PP+  STT++    D +   +            Y+R  +P 
Sbjct: 6   LNTSLVSVSHNDKYGSSV-PPLYQSTTFKASSFDQLQEYD------------YTRSGNPT 52

Query: 64  ATRLESLFS---EILEGHAVIYSSGCAAFYAAM------VHYNPKKIFMGQCYHGL-RAI 113
            T L+   +   ++        SSG  A    +        + P  I     Y G  R +
Sbjct: 53  RTVLQQQIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQRLL 112

Query: 114 ANIMTRNYGVEQYT-LDDIEKYAQ------EGDIVEVESPMNPYGTSIDIKSIAEKAHSK 166
             + TRN+    +T   D E + +      + DIV +ESP NP     D+  + +    K
Sbjct: 113 TFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVKQK 172

Query: 167 GAI-----VLVDSTFAP----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEE 217
           G       ++VD+T        PLQ+    GADVV  S TKY  GH D+++GVI+ K ++
Sbjct: 173 GGSSSNCKIVVDNTMMSGLNSNPLQF----GADVVYESGTKYLNGHHDIMAGVIIAK-KD 227

Query: 218 VCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLN----LNKERF 273
           V   +       G  +  ++S++L+R L++  +R+ KQ  NA  +  +L           
Sbjct: 228 VAPSVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKPTDN 287

Query: 274 DKVLKEVYHSSLQKEAF-VKKQLVGGYGPVFSMSLQ--TIDQCKKFPGKLKYFHHATSLG 330
           ++ LK  +        F + K    G G V S+      + +      +L  +    S G
Sbjct: 288 NQQLKTRFVGLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTSKRLNIWAVTVSFG 347

Query: 331 GVESLVEW-----RAMTDPYI------DQTLIRVSIGVENADDLIKDLETALQE 373
            V SL+        A  DP +       + LIR+  G+E+  DL  DL  A +E
Sbjct: 348 CVNSLISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFEE 401

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 115/457 (25%), Positives = 193/457 (42%), Gaps = 100/457 (21%)

Query: 2   THLGTSLIHA---DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA   D  DN     A PI  +T++ ++++          L  +EK   +YS
Sbjct: 3   SHFDTVQLHAGQEDPGDNAHRPAAVPIYQTTSFVFEDS-----HHGAQLFGLEKPGYMYS 57

Query: 58  RLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R+ +P    LE  L +      AV  SSG AA   A   + H     +     Y G    
Sbjct: 58  RVGNPTVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQ 117

Query: 114 ANIMTRNYGVE-QYTL----DDIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             +  +  G++ ++ L    +D EK + ++   V +ES  NP     D + I   AH  G
Sbjct: 118 FKVAFKRLGIDVRFVLGDNPEDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK- 221
             V+VD+TF        P+++    G D+V HSATK+ GGH   ++GVIV   +   K  
Sbjct: 178 IPVVVDNTFGAGGFFCQPIKH----GVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDY 233

Query: 222 ------------------------------------LRDDRIYLGTNVGNLESYMLLRSL 245
                                               LRD    LG  +  + +++LL+ +
Sbjct: 234 PEKFPQFSKPSEGYHGMIFNDAMGPLAYIAHVRTELLRD----LGPVMEPIAAFLLLQGV 289

Query: 246 RSYELRILKQSENATKVVEFL----NLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGP 301
            +  LR  +Q +NA K+ ++L    ++N   +  +    YH +       KK L  G+G 
Sbjct: 290 ETLSLRAERQGQNALKLAQWLEKSPHVNWVSYPGLPSHPYHDN------AKKYLDNGFGG 343

Query: 302 VFSMSLQTI------DQCKKFPGK----LKYFHHATSLGGVESLV------EWRAMTD-- 343
           V S+ ++ +      D  KK   +    LK   +  ++G  ++LV        + ++D  
Sbjct: 344 VLSIGVKPLKDVSDSDPFKKSGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDED 403

Query: 344 ---PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
                + + LIR+SIG E  DD+I D E + +++  G
Sbjct: 404 KLKSGVTEDLIRISIGTEFIDDIIADFEQSFEKVFAG 440

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 158/381 (41%), Gaps = 31/381 (8%)

Query: 13  DKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPNATRLESLFS 72
           + D +   V PP+   +T  +        ++  +++ M+ +  Y     P    LE  ++
Sbjct: 22  NPDEQNGFVNPPLYKGSTIIH--------KKLSDVESMKGRFFYGTAGSPTIANLEDAWT 73

Query: 73  EILEGHAVIYS-SGCAAFYAAMVHYNPKK---IFMGQCYHGLRAIANIMTRNYGVEQYTL 128
            +      + S SG  +   A++         +     Y   R + + +   +G++    
Sbjct: 74  HLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTRVLCDGLLAKFGIQTEYY 133

Query: 129 D-----DIEKYAQEG-DIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQ 182
           D     DIEK  +    ++ +ESP +      DI ++   A   G   ++D+T+A P   
Sbjct: 134 DPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKKHGIRTILDNTWATPLFF 193

Query: 183 YAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLL 242
            A   G D+ L + TKY GGHSD L G +   ++E    LR     +    G  +  + L
Sbjct: 194 DAHGHGIDISLEAGTKYLGGHSDFLLG-LTSANQECWPLLRSTYDAMAMLPGADDCQLAL 252

Query: 243 RSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPV 302
           R +R+  LR+ +    A  +  +L   ++  + VL   +      + +++     G   +
Sbjct: 253 RGMRTLHLRLKEAERKALDLAAWLG-KRDEVETVLHPAFEDCPGHKYWLRD--YKGSSGL 309

Query: 303 FSMSLQ---TIDQCKKFPGKLKYFHHATSLGGVESLV------EWRAMTDPYIDQTLIRV 353
           FS+ L+   T    +    K+K FH   S GG ESL+      E R   +       +R+
Sbjct: 310 FSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVKPAEQRKPHNWPHRGFALRI 369

Query: 354 SIGVENADDLIKDLETALQEL 374
            +G+E   DL +DLE   + L
Sbjct: 370 QVGLEELSDLKRDLELGFERL 390

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 116/458 (25%), Positives = 185/458 (40%), Gaps = 101/458 (22%)

Query: 2   THLGTSLIHA---DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA   D  DN     A PI  +T+Y +D++     +    L  +E    VYS
Sbjct: 3   SHFDTIQLHAGQEDAGDNAHRPRAVPIYATTSYVFDDS-----KHGSQLFGLEVPGYVYS 57

Query: 58  RLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R  +P +  LE  + +      A+  +SG AA   A   + H     +     Y G    
Sbjct: 58  RFQNPTSNVLEERIAALEGGAAALAVASGQAAQTLAIQGLAHNGDNIVATSYLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTL-----DDIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             +  + +G+E   +     DD EK + +    V +ES  NP     D + I   AH  G
Sbjct: 118 FKVAFKRFGIEARFVEGDNQDDFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIV------VKD- 215
             V+VD+TF        P++Y    G D+V HSATK+ GGH   L GVI+       KD 
Sbjct: 178 IPVMVDNTFGAGGFFCQPIKY----GVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDY 233

Query: 216 -EEVCKKLRDDRIYLGT---------------------NVGNLES----YMLLRSLRSYE 249
            E+  +  +    Y GT                     ++G+L S    ++LL+ + +  
Sbjct: 234 PEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGSLMSPFAAFLLLQGVETLS 293

Query: 250 LRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF---VKKQLVGGYGPVFSMS 306
           LR  +  ENA K+ ++L  +       +  V +  L   +     KK L  G+G + S  
Sbjct: 294 LRGERHGENALKLAKWLEQS-----PYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFG 348

Query: 307 LQTIDQCK------KFPG-----KLKYFHHATSLGGVESLVEWRAMTDPY---------- 345
           ++ +          K  G      LK   +  ++G  ++LV       PY          
Sbjct: 349 VKDLPNADTETDPFKLSGAQVVDNLKIASNLANVGDSKTLV-----IAPYFTTHQQLNDE 403

Query: 346 ------IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
                 + + LIRVS+G E  DD+I D + + +    G
Sbjct: 404 EKLASGVTKDLIRVSVGTEFIDDIINDFQQSFERTFEG 441

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 110/255 (43%), Gaps = 22/255 (8%)

Query: 139 DIVEVESPMNPYGTSIDIKSIAE--KAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSA 196
           D V +ESP NP     D+  I    K  ++  +V +D+T     L        DVV  SA
Sbjct: 151 DCVLLESPTNPLLKVADLPRITRFVKQSNEKCVVAIDNTMMSGMLCNPLHFHCDVVYESA 210

Query: 197 TKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQS 256
           TKY  GH D+++G++V +  ++  ++       G  +   +S++L+R L++  +RI +Q 
Sbjct: 211 TKYLNGHHDIMAGIVVARSAQLAGEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQ 270

Query: 257 ENATKVVE-------FLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQT 309
            NA  +         F++  K+    +           E  + K    G G V S    +
Sbjct: 271 HNAMVLAHWLENSCGFVSHGKKGKGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGS 330

Query: 310 IDQCKKF--PGKLKYFHHATSLGGVESLVEW-----RAMTDPYIDQT------LIRVSIG 356
            +  ++     K+K +    S G V SL+        A  DP + Q       L+R+  G
Sbjct: 331 FEHSRRLVSSKKIKLWAVTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCG 390

Query: 357 VENADDLIKDLETAL 371
           +EN  DL  DL  A+
Sbjct: 391 IENIVDLQNDLLEAM 405

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 113/458 (24%), Positives = 182/458 (39%), Gaps = 101/458 (22%)

Query: 2   THLGTSLIHA---DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP--VY 56
           +H  T  +HA   D  DN     A PI  +T+Y ++++     +   +L F  K P  VY
Sbjct: 3   SHFDTVQLHAGQEDPNDNNHRPRAVPIYATTSYVFEDS-----KHGADL-FGLKVPGYVY 56

Query: 57  SRLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRA 112
            R  +P    LE  L +      A+  +SG AA   A   + H     +     Y G   
Sbjct: 57  GRFQNPTQAVLEDRLAALEGGAAALATASGQAAQTLAIQGLAHCGDNIVSTSFLYGGTYN 116

Query: 113 IANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSK 166
              +  + +G+E   ++     D EK + +    V +ES  NP     D + I   AH  
Sbjct: 117 QFKVAFKRFGIEARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKH 176

Query: 167 GAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK 221
           G  V+VD+TF        PL+Y    GAD+V HSATK+ GGH   L G+IV   +   K 
Sbjct: 177 GIPVMVDNTFGAGGFFCQPLKY----GADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKD 232

Query: 222 -------------------------------------LRDDRIYLGTNVGNLESYMLLRS 244
                                                LRD    LG+ +    +++L++ 
Sbjct: 233 YPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSMISPFAAFLLIQG 288

Query: 245 LRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF---VKKQLVGGYGP 301
           + +  LR  +  +NA K+ ++L  +       +  V +  L   +     KK L  G+G 
Sbjct: 289 VETLSLRGERHGQNALKLAKWLEAS-----PYVSWVSYPGLPSHSHHENAKKYLSNGFGG 343

Query: 302 VFSMSLQTIDQCK------KFPG-----KLKYFHHATSLGGVESLVEWRAMTD------- 343
           + S  ++ +          K  G      LK   +  ++G  ++LV     T        
Sbjct: 344 MLSFGVKDLPNAATETDPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLADE 403

Query: 344 ----PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
                 + + LIRVS+G E  DD+I+D + A ++   G
Sbjct: 404 EKLASGVTKDLIRVSVGTEYIDDIIEDFKQAFEKTFAG 441

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 107/457 (23%), Positives = 185/457 (40%), Gaps = 99/457 (21%)

Query: 2   THLGTSLIHADDKDNRVSDVAP---PINVSTTYRYDETDLIPWRERENLDFMEKKPVYSR 58
           +H  T  +HA  ++       P   PI  +T+Y +D++        E     +   +YSR
Sbjct: 3   SHFDTIQLHAGQENAFEHASGPRAVPIYATTSYVFDDSKY----GAEIFGLEKPGFIYSR 58

Query: 59  LAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAIA 114
           + +P    LE  L +      A+  +SG AA   A   + H     +     Y G     
Sbjct: 59  IMNPTNDVLERRLAALEGGAAALAVASGQAAQTLAITGLAHSGDNIVSTSFLYGGTYNQF 118

Query: 115 NIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGA 168
            +  +  G+E   ++     D EK + ++   V +E+  NP     D   I   AH  G 
Sbjct: 119 KVAFKRLGIEARFVEGDAPEDFEKLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKHGI 178

Query: 169 IVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK-- 221
            V+VD+TF        P++Y    GAD+V HSATK+ GGH   ++G I+   +   K+  
Sbjct: 179 PVVVDNTFGAGGFFCQPIKY----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYP 234

Query: 222 -----------------------------------LRDDRIYLGTNVGNLESYMLLRSLR 246
                                              LRD    LG  +    S++LL+ + 
Sbjct: 235 EKFPQFSKPSEGYHGMIFNEAMGNLAFIGHVRTELLRD----LGPCMSPFASFLLLQGVE 290

Query: 247 SYELRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPV 302
           +  LR  +Q EN   + ++L     ++   +  ++   +H +       KK L  G+G V
Sbjct: 291 TLSLRAERQGENTLALAKWLEKSAYVSWVSYPGLVSHSHHEN------AKKYLRNGFGGV 344

Query: 303 FSMSLQTIDQC--KKFPGK---------LKYFHHATSLGGVESLV------EWRAMTD-- 343
            S  ++ +     +K P K         LK   +  ++G  ++LV        + ++D  
Sbjct: 345 LSFGVKDLPGAAEEKDPFKAAGAQAVDNLKLASNLANVGDSKTLVIAPYFTTHQQLSDEE 404

Query: 344 ---PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
                + + LIRVS+G E  DD+I D + + +++ NG
Sbjct: 405 KLASGVTKDLIRVSVGTEFIDDIIADFQQSFEKIFNG 441

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 108/454 (23%), Positives = 178/454 (39%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHADDKDNRVSDVAP---PINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA  +D   +   P   PI  +T+Y ++++     +    L  +E    +YS
Sbjct: 3   SHFDTIQLHAGQEDASTNANNPNAVPIYATTSYVFNDS-----KHGAQLFGLETPGYIYS 57

Query: 58  RLAHPNATRLESLFSEILEGHAVI-YSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R+ +P     E   + +  G A +  SSG AA   A   + H     +     Y G    
Sbjct: 58  RIMNPTVDVFEKRIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTYNQ 117

Query: 114 ANIMTRNYG-----VEQYTLDDIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             +  +  G     VE     D EK + ++   V +E+  NP     D + I E AH  G
Sbjct: 118 FKVAFKRLGINVKFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK- 221
             V+VD+TF        P++Y    G D+V HSATK+ GGH   ++G I+   +   K  
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKY----GCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDY 233

Query: 222 ------------------------------------LRDDRIYLGTNVGNLESYMLLRSL 245
                                               LRD    LG  +    +++LL+ +
Sbjct: 234 PERFPQFSKPSEGYHGLVFNDAFGPAAFIGHVRTELLRD----LGPCLDAFSAFLLLQGV 289

Query: 246 RSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
            +  LR  +  EN  K+ ++  L K  +   +      S       KK L  G+G V S 
Sbjct: 290 ETLSLRGERHGENTLKLAKW--LEKSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSF 347

Query: 306 SLQTIDQC--KKFPGK---------LKYFHHATSLGGVESLVEWRAMTD----------- 343
            ++ +     +K P K         LK   +  ++G  ++LV     T            
Sbjct: 348 GVKDLPNASDEKDPFKASGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLNEEEKLA 407

Query: 344 PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIRVS+G E  DD+I D + + +++  G
Sbjct: 408 SGVTKDLIRVSVGTEYIDDIIADFQQSFEKVFAG 441

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 115/460 (25%), Positives = 188/460 (40%), Gaps = 108/460 (23%)

Query: 2   THLGTSLIHADDKD-----NRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-V 55
           +H  T  +HA  +D     NR   V  PI  +T+Y +D++     +    L  +E    +
Sbjct: 3   SHFDTIQLHAGQEDPSEHSNRPRAV--PIYSTTSYVFDDS-----KHGSQLFGLETPGYI 55

Query: 56  YSRLAHPNATRLESLFSEILEG-HAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLR 111
           YSR+ +P A   E   + +  G  A+  SSG AA   A   + H     +     Y G  
Sbjct: 56  YSRIMNPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGTY 115

Query: 112 AIANIMTRNYGVEQYTLDDIEKYAQEGDI------VEVESPMNPYGTSIDIKSIAEKAHS 165
               I  + +G+E   ++  +    E  I      V +E+  NP     D + I   AH 
Sbjct: 116 NQFKIAFKRFGIESRFIEGDDPSGLEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAHK 175

Query: 166 KGAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIV-------- 212
            G  V+VD+TF        P+++    GADVV+HSATK+ GGH   + GVIV        
Sbjct: 176 HGVPVVVDNTFGAGGYYCQPIKH----GADVVVHSATKWIGGHGTTIGGVIVDSGNFPWK 231

Query: 213 -------------------VKDEEVCKK----------LRDDRIYLGTNVGNLESYMLLR 243
                              V +E +  +          LRD    LG ++    +++LL+
Sbjct: 232 EYPKKFPQFSEPSEGYHGLVFNEALGNQAFIGHVRAELLRD----LGPSLSPFAAFLLLQ 287

Query: 244 SLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVF 303
            L +  LR  + + NA K+ ++  L K  +   +      +    A  KK L  G+G V 
Sbjct: 288 GLETLSLRAERHASNALKLAQW--LEKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVL 345

Query: 304 SMSLQTI---DQCKKFPGK---------LKYFHHATSLGGVESLVEWRAMTDPY------ 345
           S   + +    + K+ P K         L+   +  ++G  ++LV       PY      
Sbjct: 346 SFGAKDLPDNPEEKENPFKAAGAQISDNLELASNLANVGDCKTLV-----IAPYFTTHLQ 400

Query: 346 ----------IDQTLIRVSIGVENADDLIKDLETALQELH 375
                     + + LIRVS+G E  DD+I D E + ++++
Sbjct: 401 LNHEEKLAAGVSKDLIRVSVGTEFIDDIIADFEQSFKKVY 440

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 109/462 (23%), Positives = 183/462 (39%), Gaps = 110/462 (23%)

Query: 2   THLGTSLIHADDK--DNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYSR 58
           +H  T  +HA  +  +N  +  A PI  +T+Y ++++     +    L  +E    +YSR
Sbjct: 3   SHFDTLQLHAGQEASENSHNPRAVPIYATTSYVFNDS-----KHGAQLFGLETPGYIYSR 57

Query: 59  LAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAIA 114
           + +P    LE  L +      A+  +SG AA   A   + H     +     Y G     
Sbjct: 58  IMNPTNDVLEQRLAALEGGAAALAVASGQAAQTVAITGLAHAGDNIVSTSFLYGGTYNQF 117

Query: 115 NIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGA 168
            +  +  G+E   +D     D EK + ++   + +ES  NP     D + I   AH  G 
Sbjct: 118 KVAFKRLGIEARFVDGDKPEDFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGI 177

Query: 169 IVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK-- 221
            V+VD+TF        P+++    GAD+V HSATK+ GGH   ++G I+   +   K   
Sbjct: 178 PVVVDNTFGAGGFFCQPIKW----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYP 233

Query: 222 -----------------------------------LRDDRIYLGTNVGNLESYMLLRSLR 246
                                              LRD    LG  +    S++LL+ L 
Sbjct: 234 EKFPQFSKPSEGYHGLVFNDAFGPLAFIGHARTELLRD----LGPALSPFSSFLLLQGLE 289

Query: 247 SYELRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPV 302
           +  LR  + + NA K+ ++L     ++   +  +    +H +       KK L  G+G V
Sbjct: 290 TLSLRGERHAYNALKLAQWLEKSPYVSWVSYPGLESHTHHEN------AKKYLQNGFGGV 343

Query: 303 FSMSLQTIDQCK------KFPG-----KLKYFHHATSLGGVESLVEWRAMTDPY------ 345
            S  ++ +          K  G      LK   +  ++G  ++LV       PY      
Sbjct: 344 LSFGVKPLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLV-----IAPYFTTHQQ 398

Query: 346 ----------IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
                     +   LIRVS+G E  DD+I D E + +++  G
Sbjct: 399 LSHEEKLASGVTDDLIRVSVGTEFIDDIIADFEQSFEKIFKG 440

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 113/454 (24%), Positives = 186/454 (40%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHADDKD---NRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA  +D   N  +  A PI  +++Y ++++     +    L  +EK   +YS
Sbjct: 3   SHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVFNDS-----QHGAQLFGLEKPGYMYS 57

Query: 58  RLAHPNATRLESLFSEILEGHAVI-YSSGCAA---FYAAMVHYNPKKIFMGQCYHGLRAI 113
           R+ +P     E   + +  G A +  +SG AA     + + H     +     Y G    
Sbjct: 58  RIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             +  R  G+E   ++     D EK +  +   V +E+  NP     D + I   AH  G
Sbjct: 118 FKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK- 221
             V+VD+TF        P++Y    GAD+V HSATK+ GGH   + GVIV   +   K+ 
Sbjct: 178 IPVVVDNTFGAGGYFAQPIKY----GADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEY 233

Query: 222 ------------------------------------LRDDRIYLGTNVGNLESYMLLRSL 245
                                               LRD    LG  +    ++ LL+ +
Sbjct: 234 PEKFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRD----LGPALNPFAAFQLLQGV 289

Query: 246 RSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
            +  LR  + + NA K+ ++  L K  +   +     SS       KK L  G+G V S 
Sbjct: 290 ETLSLRCERHATNALKLAQY--LEKSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSF 347

Query: 306 SLQTIDQCKKF--PGK---------LKYFHHATSLGGVESLV------EWRAMTD----- 343
            ++ +    +   P K         LK   +  ++G  ++LV        + +TD     
Sbjct: 348 GVKDLPNAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLA 407

Query: 344 PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIRVS+G E  DD+I D E A +++ NG
Sbjct: 408 SGVTKDLIRVSVGTEFIDDIIGDFEQAFEKVFNG 441

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 133/293 (45%), Gaps = 58/293 (19%)

Query: 127 TLDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----P 179
           +L D+E     G+    V VE+P NP     D+  +   A+  G  +++D T        
Sbjct: 411 SLKDLECTLHSGEQILAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNID 470

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
            L YA     D+V  S TK F G S++++G +V+  +E   KL        + +G  E +
Sbjct: 471 VLPYA-----DIVCSSLTKIFSGSSNVIAGSMVLNPQE---KLYSFAQVFMSQLGEYEDH 522

Query: 240 M-------LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQK-EAFV 291
           +       L R+ R +  R +K ++N   +++ + L +E   K+ K++++ SL   E+ V
Sbjct: 523 LWCEDAIYLERNSRDFIARTIKTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKV 582

Query: 292 KKQLV------------GGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWR 339
               V            GGYG +FS++   I+Q K F  +L       +L    SL    
Sbjct: 583 NYDAVRCKSIDKDSDEEGGYGGLFSLAFNKIEQAKIFFNEL-------NLSKGPSLGTNF 635

Query: 340 AMTDPY----------------IDQTLIRVSIGVENADDLIKDLETALQELHN 376
            ++ PY                ++++L+RVSIG+E+ D+L K  + A+ E  N
Sbjct: 636 TLSCPYTVLMYYDKLDEVAKYEVEESLVRVSIGIESQDELQKAFQHAIDEALN 688

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 108/251 (43%), Gaps = 12/251 (4%)

Query: 52  KKPVYSRLAHPNATRLESLFSEILEGHAVIYS-SGCAAFYAAMVHYNPKK---IFMGQCY 107
           K   Y     P    LE+ ++ +  G   + S SG  +   A++  +      +     Y
Sbjct: 52  KGRFYGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVY 111

Query: 108 HGLRAIANIMTRNYGVEQYTLD-----DIEKYAQEGD-IVEVESPMNPYGTSIDIKSIAE 161
              R + + +   +GVE    D     DIEK  +    ++ +ESP +      DI ++  
Sbjct: 112 VPTRMLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVS 171

Query: 162 KAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK 221
            A   G   ++D+T+A P    A   G D+ + + TKY GGHSDLL G +   +EE    
Sbjct: 172 VAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIG-LASANEECWPL 230

Query: 222 LRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVY 281
           LR     +    G  +  + LR +R+  LR+ +    A  +  +L  N++  +KVL   +
Sbjct: 231 LRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLG-NRDEVEKVLHPAF 289

Query: 282 HSSLQKEAFVK 292
                 E +V+
Sbjct: 290 EDCPGHEYWVR 300

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 106/452 (23%), Positives = 174/452 (38%), Gaps = 90/452 (19%)

Query: 2   THLGTSLIHA--DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP--VYS 57
           +H  T  +HA  D   N  +  A PI  +++Y +  +     +   +L F    P  +YS
Sbjct: 3   SHYDTLQLHAGQDASANSGNPRAVPIYATSSYVFKNS-----QHGADL-FGLNTPGYLYS 56

Query: 58  RLAHPNATRLESLFSEILEGHA-VIYSSGCAA---FYAAMVHYNPKKIFMGQCYHGLRAI 113
           R+ +P    LE   + +  G   V  +SG AA      A+       +     Y G    
Sbjct: 57  RMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGTYNQ 116

Query: 114 ANIMTRNYGVEQYTLD--DIEKYAQEGD----IVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             +  +  GVE    +  + E Y Q  D     + VES  NP  T  D + I E AH  G
Sbjct: 117 LKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAHKHG 176

Query: 168 AIVLVDSTFAPP-----PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKL 222
             V+VD+TF        P+++    GAD++ HSATK+  GH   ++G IV        + 
Sbjct: 177 IPVVVDNTFGAAGFFCKPIEF----GADIITHSATKWINGHGTAIAGAIVDSGNFPWTQY 232

Query: 223 RD-------------DRIY--------------------LGTNVGNLESYMLLRSLRSYE 249
            D               +Y                    LG+ +    +++ L+ L +  
Sbjct: 233 PDKFPQFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLETLS 292

Query: 250 LRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQT 309
           LR  + + N+  +    +L    +   +      S       KK L  G G + S  ++ 
Sbjct: 293 LRCERHARNSIDLAR--HLEDSPYVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFGIKP 350

Query: 310 IDQ---------------CKKFPGKLKYFHHATSLGGVESLV------EWRAMTD----- 343
            D+                 KF   LK   +  ++G  ++LV        + +TD     
Sbjct: 351 FDKTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLK 410

Query: 344 PYIDQTLIRVSIGVENADDLIKDLETALQELH 375
              D+ +IRVS+G E  DD+I D E A + ++
Sbjct: 411 AGADKDVIRVSVGTEYIDDIIADFEQAFKTVY 442

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 106/460 (23%), Positives = 180/460 (39%), Gaps = 109/460 (23%)

Query: 3   HLGTSLIHADDKD---NRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYSR 58
           H  T  +HA  +D   N  S  A PI  +T+Y ++++     +    L  +E    +YSR
Sbjct: 4   HFDTLQLHAGQEDAAENANSPRAVPIYATTSYVFNDS-----KHGAQLFGLEAPGFIYSR 58

Query: 59  LAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAIA 114
           + +P    LE  + +      A+  +SG AA   A   + H     +     Y G     
Sbjct: 59  IMNPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGSYNQF 118

Query: 115 NIMTRNYGVEQYTL--DDIEKYAQEGD----IVEVESPMNPYGTSIDIKSIAEKAHSKGA 168
            +  +  G+E   +  D+ E +    D     V +ES  NP     D + I   AH  G 
Sbjct: 119 KVAFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAHRHGI 178

Query: 169 IVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIV----------- 212
            V+VD+TF        P+++    GAD+V HSATK+ GGH   + G++V           
Sbjct: 179 PVVVDNTFGAGGYFCQPIKF----GADIVTHSATKWIGGHGTAIGGLVVDSGKFPWKDYP 234

Query: 213 ----------------VKDEEV----------CKKLRDDRIYLGTNVGNLESYMLLRSLR 246
                           V +E +           + LRD    LG  +    +++ L+ L 
Sbjct: 235 AKFPQFSEPSEGYHGLVLNEALGPLAFVGHARIELLRD----LGPALSPFAAFLFLQGLE 290

Query: 247 SYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVK---KQLVGGYGPVF 303
           +  LR  +  +NA  + ++L  +       +  V +  L+   ++    + L  GYG V 
Sbjct: 291 TLSLRAERHGQNALALAKYLETS-----AYVSWVSYPGLESHDYLSNATRYLQNGYGGVL 345

Query: 304 SMSLQTIDQC-----------KKFPGKLKYFHHATSLGGVESLVEWRAMTDPY------- 345
           S  ++ +               +F   LK+  +  ++G  ++LV       PY       
Sbjct: 346 SFGVKPLPDTDEEADPFKAAGAQFVDNLKFASNLANVGDSKTLV-----IAPYFTTHQQL 400

Query: 346 ---------IDQTLIRVSIGVENADDLIKDLETALQELHN 376
                    + + LIRVS+G E   D+I D E A   ++ 
Sbjct: 401 SESEKLASGVTRDLIRVSVGTEYLQDIIADFEQAFSTVYG 440

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 121/254 (47%), Gaps = 33/254 (12%)

Query: 143 VESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGG 202
           +E+P NP     D+  + E A+S G  ++VD T A   +       AD+V  S TK F G
Sbjct: 392 MEAPSNPLLKMGDLIELRELANSFGFYIVVDDT-AGGFVNIDVLPFADIVCSSLTKIFSG 450

Query: 203 HSDLLSGVIVVKD--------EEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILK 254
            S++++G IV+          E   ++  +D ++        ++  L R+ R +  R LK
Sbjct: 451 DSNVIAGSIVLNPQSKLYSFAETFMEQQYEDCLWCE------DALYLERNSRDFVARTLK 504

Query: 255 QSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVK-----KQLVGGYGPVFSMSLQT 309
            ++N  +++  + L +E   K+ K++Y+ SL  +   K     +   GGYG +FS++   
Sbjct: 505 VNQNTERLLNKVLLPQE--GKLFKKIYYPSLTSKETKKNYDAVRGHQGGYGGLFSLTFYN 562

Query: 310 IDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRVSIGVEN 359
           +D  K F   L+      SLG   +L    A+   Y          ++  L+RVS+G+E 
Sbjct: 563 LDSAKTFFNTLQ-LCKGPSLGTNFTLACPYAIIAHYQELDRVAKYGVESNLVRVSVGLER 621

Query: 360 ADDLIKDLETALQE 373
            D+L K  +TA+ E
Sbjct: 622 EDELCKVFQTAIDE 635

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 115/254 (45%), Gaps = 25/254 (9%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           V +E+P NP     D+K +   A+  G  ++VD T     L       AD+V  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGG--LNVDVLPYADIVCTSLTKLF 377

Query: 201 GGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYELRILKQS 256
            G S+++ G I++  +         + + G     L    ++ +L  + R +E R  + +
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCAL-QYFRGGEFEELLWLEDAIILEANSRDFEERTTRTN 436

Query: 257 ENATKVVEFLNLNKERFDKVLKEVYHSSLQ-KEAFVKKQLV----GGYGPVFSMSLQTID 311
           EN  K+++ + L +E   K+ K+VY+ ++  KE F   + V    GGYG +FS+S    +
Sbjct: 437 ENTMKLIQEVLLPEE--GKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEE 494

Query: 312 QCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYIDQTLIRVSIGVENAD 361
             KKF   L  F    S G   +L           E   ++      +L+RVS+G+EN  
Sbjct: 495 DAKKFYNSLTVF-KGPSNGTNFTLACPYVHLAHHFELEEVSTFGAHSSLVRVSVGLENTQ 553

Query: 362 DLIKDLETALQELH 375
            L+    + +  L 
Sbjct: 554 WLLNAFSSVINLLR 567

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 107/455 (23%), Positives = 181/455 (39%), Gaps = 96/455 (21%)

Query: 2   THLGTSLIHADDKDNRVSDV----APPINVSTTYRYDETDLIPWRERENLDFMEKKP-VY 56
           +H  T  +HA  +  + +D     A PI  +T+Y ++++     +    L  +E    +Y
Sbjct: 3   SHFDTLQLHAGQE--KTADAHNPRAVPIYATTSYVFNDS-----KHGAQLFGLETPGYIY 55

Query: 57  SRLAHPNATRLESLFSEILEGHAVI-YSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRA 112
           SR+ +P    LE   + +  G A +  SSG AA   A   + H     +     Y G   
Sbjct: 56  SRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGTYN 115

Query: 113 IANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSK 166
              +  +  G+E   +D     D EK + ++   + +ES  NP     D + I   AH  
Sbjct: 116 QFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAHKH 175

Query: 167 GAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKY---------------------- 199
           G  V+VD+TF        P++Y    GAD+V HSATK+                      
Sbjct: 176 GIPVVVDNTFGAGGFFCQPIKY----GADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKD 231

Query: 200 -------FGGHSDLLSGVI---VVKDEEVCKKLRDDRIY-LGTNVGNLESYMLLRSLRSY 248
                  F   S+   G+I             +R + +  LG  +     ++LL+ L + 
Sbjct: 232 YPEKFPQFSQPSEGYHGLIFNDAFGPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETL 291

Query: 249 ELRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFS 304
            LR  +   NA K+ ++L     ++   +  +    +H +       KK L  G+G V S
Sbjct: 292 SLRGERHGSNALKLAQYLESSPYVSWVSYPGLPSHSHHEN------AKKYLENGFGGVLS 345

Query: 305 MSLQTIDQCK------KFPG-----KLKYFHHATSLGGVESLV------EWRAMTD---- 343
             ++ +          K  G      LK   +  ++G  ++LV        + +TD    
Sbjct: 346 FGVKDLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKL 405

Query: 344 -PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
              + + LIRVS+G E  DD+I D E +   + NG
Sbjct: 406 ASGVTKDLIRVSVGTEFIDDIIADFEASFATVFNG 440

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 114/454 (25%), Positives = 186/454 (40%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHADDK---DNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA  +   DN     A PI  +T+Y ++ +     +    L  +E    VYS
Sbjct: 3   SHFDTVQLHAGQENAGDNAHRSRAVPIYATTSYVFENS-----KHGSQLFGLEVPGYVYS 57

Query: 58  RLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R  +P +  LE  + +      A+  SSG AA   A   + H     +     Y G    
Sbjct: 58  RFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             I  + +G+E   ++     D EK + +    V +E+  NP     D + I   AH  G
Sbjct: 118 FKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLL------SGVIVVKD- 215
             V+VD+TF        P++Y    GAD+V HSATK+ GGH   +      SG    KD 
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDY 233

Query: 216 -EEVCKKLRDDRIYLGT----NVGNL---------------------ESYMLLRSLRSYE 249
            E+  +  +    Y GT      GNL                      S++LL+ + +  
Sbjct: 234 PEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLS 293

Query: 250 LRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
           LR  +  ENA K+ ++L     ++   +  +    +H +       KK L  G+G V S 
Sbjct: 294 LRAERHGENALKLAKWLEESPYVSWVSYPGLASHSHHEN------AKKYLSNGFGGVLSF 347

Query: 306 SLQTIDQCKKF--PGK---------LKYFHHATSLGGVESLV------EWRAMTDPY--- 345
            ++ +    K   P K         LK   +  ++G  ++LV        + + D     
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLA 407

Query: 346 --IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIRVS+G+E  DD+I D + + + +  G
Sbjct: 408 SGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAG 441

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 114/454 (25%), Positives = 186/454 (40%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHADDK---DNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA  +   DN     A PI  +T+Y ++ +     +    L  +E    VYS
Sbjct: 3   SHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENS-----KHGSQLFGLEVPGYVYS 57

Query: 58  RLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R  +P +  LE  + +      A+  SSG AA   A   + H     +     Y G    
Sbjct: 58  RFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             I  + +G+E   ++     D EK + +    V +E+  NP     D + I   AH  G
Sbjct: 118 FKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLL------SGVIVVKD- 215
             V+VD+TF        P++Y    GAD+V HSATK+ GGH   +      SG    KD 
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDY 233

Query: 216 -EEVCKKLRDDRIYLGT----NVGNL---------------------ESYMLLRSLRSYE 249
            E+  +  +    Y GT      GNL                      S++LL+ + +  
Sbjct: 234 PEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLS 293

Query: 250 LRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
           LR  +  ENA K+ ++L     ++   +  +    +H +       KK L  G+G V S 
Sbjct: 294 LRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHEN------AKKYLSNGFGGVLSF 347

Query: 306 SLQTIDQCKKF--PGK---------LKYFHHATSLGGVESLV------EWRAMTDPY--- 345
            ++ +    K   P K         LK   +  ++G  ++LV        + + D     
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLA 407

Query: 346 --IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIRVS+G+E  DD+I D + + + +  G
Sbjct: 408 SGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAG 441

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 114/454 (25%), Positives = 186/454 (40%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHA---DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA   +  DN     A PI  +T+Y ++ +     +    L  +E    VYS
Sbjct: 3   SHFDTVQLHAGQENPSDNAHRTRAVPIYATTSYCFENS-----KHGSQLFGLEVPGYVYS 57

Query: 58  RLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R  +P +  LE  + +      A+  SSG AA   A   + H     +     Y G    
Sbjct: 58  RFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             I  + +G+E   ++     D EK + +    V +E+  NP     D + I   AH  G
Sbjct: 118 FKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLL------SGVIVVKD- 215
             V+VD+TF        P++Y    GAD+V HSATK+ GGH   +      SG    KD 
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDY 233

Query: 216 -EEVCKKLRDDRIYLGT----NVGNL---------------------ESYMLLRSLRSYE 249
            E+  +  +    Y GT      GNL                      S++LL+ + +  
Sbjct: 234 PEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLS 293

Query: 250 LRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
           LR  +  ENA K+ ++L     ++   +  +    +H +       KK L  G+G V S 
Sbjct: 294 LRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHEN------AKKYLSNGFGGVLSF 347

Query: 306 SLQTIDQCKKF--PGK---------LKYFHHATSLGGVESLV------EWRAMTDPY--- 345
            ++ +    K   P K         LK   +  ++G  ++LV        + + D     
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDSLKLASNLANVGDAKTLVIAPYFTTHKQLNDTEKLA 407

Query: 346 --IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIRVS+G+E  DD+I D + + + +  G
Sbjct: 408 SGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAG 441

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 114/454 (25%), Positives = 187/454 (41%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHADDK---DNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA  +   DN     A PI  +T+Y ++ +     +    L  +E    VYS
Sbjct: 3   SHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENS-----KHGSQLFGLEVPGYVYS 57

Query: 58  RLAHPNATRLES-LFSEILEGHAVIYSSGCAAFYAA---MVHYNPKKIFMGQCYHGLRAI 113
           R  +P +  LE  + +      A+  SSG AA   A   + H     +     Y G    
Sbjct: 58  RFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTL--DDIEKYAQEGD----IVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             I  + +G+E   +  D+ E++ +  D     V +E+  NP     D + I   AH  G
Sbjct: 118 FKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHG 177

Query: 168 AIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLL------SGVIVVKD- 215
             V+VD+TF        P++Y    GAD+V HSATK+ GGH   +      SG    KD 
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDY 233

Query: 216 -EEVCKKLRDDRIYLGT----NVGNL---------------------ESYMLLRSLRSYE 249
            E+  +  +    Y GT      GNL                      S++LL+ + +  
Sbjct: 234 PEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLS 293

Query: 250 LRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
           LR  +  ENA K+ ++L     ++   +  +    +H +       KK L  G+G V S 
Sbjct: 294 LRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHEN------AKKYLSNGFGGVLSF 347

Query: 306 SLQTIDQCKKF--PGK---------LKYFHHATSLGGVESLV------EWRAMTDPY--- 345
            ++ +    K   P K         LK   +  ++G  ++LV        + + D     
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLA 407

Query: 346 --IDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIRVS+G+E  DD+I D + + + +  G
Sbjct: 408 SGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAG 441

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 133/283 (46%), Gaps = 44/283 (15%)

Query: 127 TLDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----P 179
           ++ ++E+    G+    V +E P NP     D+K +   A+  G  +++D T        
Sbjct: 439 SMKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNID 498

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESY 239
            L +A     D+V  S ++ FGG S++++G +V+  +E  K  +  +++L   +G  E+Y
Sbjct: 499 VLPFA-----DIVCSSLSQSFGGDSNVMAGSMVLNPQE--KLYQFAQLFL-NQLGEYENY 550

Query: 240 -------MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL----QKE 288
                  +L R+ R +  R +  + N+  ++  + L  E  DK+ K++Y+ SL     KE
Sbjct: 551 VWCEDAIILERNSRDFIPRSITINHNSEYLINEVLLPNEGPDKIFKKIYYPSLTSDETKE 610

Query: 289 AFVK---------KQLVGGYGPVFSMSLQTIDQCKKFPGK--------LKYFHHATSLGG 331
            + K         ++  GGYG + S++   +D  K+F  +        L   H       
Sbjct: 611 NYDKLRCKKIPNFEKEEGGYGGIISLTFHNLDTSKRFFDEINITKGPSLSTNHTLACPYT 670

Query: 332 VESLVEWRAMTDPY-IDQTLIRVSIGVENADDLIKDLETALQE 373
           + S  +  A  + + +++ LIR+ IG E+ +DL K    A+++
Sbjct: 671 ILSYFDNLAQVEKFGVEENLIRIKIGCESKEDLAKVFLHAIEK 713

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 112/454 (24%), Positives = 187/454 (41%), Gaps = 97/454 (21%)

Query: 2   THLGTSLIHA-----DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-V 55
           +H  T  +HA     DD ++R   V  PI  +T++ ++++     +    L  +E    +
Sbjct: 3   SHFDTLQLHAGQENPDDNNHRPRAV--PIYSTTSFVFNDS-----QHGAQLFGLEVPGYI 55

Query: 56  YSRLAHPNATRLES-LFSEILEGHAVIYSSGCAA---FYAAMVHYNPKKIFMGQCYHGLR 111
           YSR  +P    LE  + +      A+  SSG AA     A + H     +     Y G  
Sbjct: 56  YSRFQNPTNNVLEERIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTY 115

Query: 112 AIANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHS 165
               +  +  G+E   ++     D EK + +    V +ES  NP     D ++I   AH 
Sbjct: 116 NQFKVAFKRLGIEARFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHK 175

Query: 166 KGAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYFGGHSDLL------SGVIVVK 214
            G  V+VD+TF        P++Y    GAD+V HSATK+ GGH   +      SG    K
Sbjct: 176 HGIPVVVDNTFGAGGFFCQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWK 231

Query: 215 D--EEVCKKLRDDRIYLGT----NVGNL---------------------ESYMLLRSLRS 247
           D  E+  +  +    Y GT      GNL                      +++LL+ + +
Sbjct: 232 DYPEKFPQFSKPAEGYHGTVYNETYGNLAYIVHVRTELLRDLGPGMSPFAAFLLLQGVET 291

Query: 248 YELRILKQSENATKVVEFLNLNKE----RFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVF 303
             LR  +  +NA  + ++L  N       +  +    +H +       KK L  G+G V 
Sbjct: 292 LSLRGERHGQNALALAKWLEKNPHVAWVSYPGLPSHSHHEN------AKKYLSNGFGGVL 345

Query: 304 SMSLQTIDQCKKF--PGK---------LKYFHHATSLGGVESLV------EWRAMTDPY- 345
           S  ++ +    K   P K         LK   +  ++G  ++LV        + ++DP  
Sbjct: 346 SFGVKDLPNADKETDPFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLSDPEK 405

Query: 346 ----IDQTLIRVSIGVENADDLIKDLETALQELH 375
               + + LIRVS+G E  DD+I D E +  +++
Sbjct: 406 LASGVTKDLIRVSVGTEFIDDIIADFEQSFAKVY 439

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 114/255 (44%), Gaps = 35/255 (13%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           V VE+P NP     D+K +   A + G  ++VD T     L       AD+V  S TK F
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIG--GLNVDVLPYADIVCTSLTKLF 375

Query: 201 GGHSDLLSGVIVVKDE-----EVCKKLR----DDRIYLGTNVGNLESYMLLRSLRSYELR 251
            G S+ + G I++  +       C+  +    +D ++    V      +L  + R ++ R
Sbjct: 376 NGSSNAMGGSIILNPKSSLYSSACEYFKSAEFEDLLWCEDAV------VLEANSRDFQDR 429

Query: 252 ILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFVKKQLV----GGYGPVFSMS 306
            L+ + N  K++  + L +E   K+ K++Y+ ++  KE F   + V    GGYG +FSM+
Sbjct: 430 TLRANINTEKLLNEVLLPEE--GKICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSMA 487

Query: 307 LQTIDQCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYIDQTLIRVSIG 356
                  K F   LK F    S G   +L           E   ++    D  LIRVS+G
Sbjct: 488 FYNEGDAKTFYDTLKVF-KGPSNGTNFTLACPYVHLAHHSELEEVSKFGADPNLIRVSVG 546

Query: 357 VENADDLIKDLETAL 371
           +E+   L+    +A+
Sbjct: 547 LEDTQTLLDVFSSAI 561

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 125/274 (45%), Gaps = 35/274 (12%)

Query: 127 TLDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----P 179
           ++D ++K    G+    V +E+P NP     D++ +   +      ++VD T        
Sbjct: 371 SMDALKKILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNID 430

Query: 180 PLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVV----KDEEVCKKLRDDRIYLGTNVGN 235
            L YA     D++  S TK F G S++++G +V+    K  E  KK           +  
Sbjct: 431 VLPYA-----DIICSSLTKIFSGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDCLWC 485

Query: 236 LESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF----- 290
            ++  L R+ R +  R +K + N   ++  + L   +  K+ K++Y+ SL  E       
Sbjct: 486 EDALCLERNSRDFVERTIKVNTNTDILLTKVLL--PQVGKLFKKIYYPSLTSEETKRNYD 543

Query: 291 -VKKQLVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY---- 345
            V     GGYG +FS++   I++ KKF   L+      SLG   +L    A+   Y    
Sbjct: 544 SVMATRDGGYGGLFSLTFFDIEKAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELD 602

Query: 346 ------IDQTLIRVSIGVENADDLIKDLETALQE 373
                 +++ L+RVS+G+EN+D L +  + A+++
Sbjct: 603 EIAQYGVEKNLVRVSVGLENSDVLCRVFQRAIEK 636

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 118/257 (45%), Gaps = 32/257 (12%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSA 196
           V +E+P NP     D++ +   +      ++VD T         L YA     D+V  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVIVVKDE----EVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRI 252
           TK F G S++++G +V+  +    E  +K           +   ++  L R+ R +  R 
Sbjct: 442 TKIFSGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERT 501

Query: 253 LKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF------VKKQLVGGYGPVFSMS 306
           +K + N   ++  + L   +  K+ K++Y+ SL  E        V     GGYG +FS++
Sbjct: 502 IKVNTNTNILLTKVLL--PQVGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLT 559

Query: 307 LQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRVSIG 356
             +I++ KKF   L+      SLG   +L    A+   Y          +++ L+RVS+G
Sbjct: 560 FFSIEEAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVG 618

Query: 357 VENADDLIKDLETALQE 373
           +EN+D L K  + A+++
Sbjct: 619 LENSDVLCKVFQRAIEK 635

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 115/250 (46%), Gaps = 25/250 (10%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           V VE+P NP     D+K +   A   G  +++D T     L       AD+V  S TK F
Sbjct: 321 VFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIG--GLNVDILPYADIVSTSLTKLF 378

Query: 201 GGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYELRILKQS 256
            G S+++ G +V+  +        +  +   N  +L    ++ +L R+ R +E R L+ +
Sbjct: 379 NGASNVMGGSVVLNPKSSLYPYARE-YFRSANFEDLLWCEDAIVLERNSRDFEDRTLRAN 437

Query: 257 ENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFVKKQLV----GGYGPVFSMSLQTID 311
            N   ++  L L +E   K+ K++Y+ ++  KE F   + V    GGYG +FS++     
Sbjct: 438 ANTGILLNDLLLPEE--GKICKKIYYPTVTSKETFENYESVRNERGGYGCLFSVAFFNEG 495

Query: 312 QCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYIDQTLIRVSIGVENAD 361
             K F   LK F   ++ G   +L           E   ++    D  +IRVS+G+E+  
Sbjct: 496 DAKAFYDSLKVFKGPSN-GTNFTLACPYVHLAHHSELEEVSKFGADPNIIRVSVGLEDIQ 554

Query: 362 DLIKDLETAL 371
            L+K   +AL
Sbjct: 555 WLLKVFSSAL 564

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 114/252 (45%), Gaps = 25/252 (9%)

Query: 143 VESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFGG 202
           VE+P NP     D+  + + A+  G  +++D T     L       AD+V  S TK F G
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLFNG 361

Query: 203 HSDLLSGVIVVKDEEVCKKLRDDRIYLGTN-----VGNLESYMLLRSLRSYELRILKQSE 257
            S+++ G +++  +         R ++ ++     +   ++ +L  + R +E R ++ ++
Sbjct: 362 SSNVMGGSLILNPKSSL--YSSARAFVESDGFEDLLWCEDAKVLEINSRDFEDRTVRANK 419

Query: 258 NATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVK-----KQLVGGYGPVFSMSLQTIDQ 312
           N  +++  L L  E   KV K++Y+ ++  E   K     +  +GGYG +FSM+  + + 
Sbjct: 420 NTERLLSELILVNE--GKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMAFYSEED 477

Query: 313 CKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY---------IDQTLIRVSIGVENADDL 363
            K F   LK F   ++         +  +   +          D  LIRVS+G+E++  L
Sbjct: 478 SKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGLEDSQWL 537

Query: 364 IKDLETALQELH 375
           +     A+  L 
Sbjct: 538 LDVFSDAINMLE 549

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 125/271 (46%), Gaps = 25/271 (9%)

Query: 124 EQYTLDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180
           +Q ++D ++     G+    V +E+P NP     D+  + E A++ G  ++VD T A   
Sbjct: 377 DQKSMDQLKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDET-AGGF 435

Query: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL---- 236
           +       AD+V  S TK F G S++++G +V+            + +   +  +L    
Sbjct: 436 VNIDVLPHADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFA-QQFFSSDSFEDLLWCE 494

Query: 237 ESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLV 296
           ++  L R+ R +  R L  ++N  +++E + L +E   K+ K+++  SL  E   +   V
Sbjct: 495 DAIYLERNSRDFATRTLTVNKNTQRLLEDVLLPQE--GKLFKKIFFPSLTSEETKRNYDV 552

Query: 297 -----GGYGPVFSMSLQTIDQCKKF---------PGKLKYFHHATSLGGVESLVEWRAMT 342
                GGYG +FS++    +Q + F         P     F  A     +    E   + 
Sbjct: 553 VLCPQGGYGGLFSLTFYREEQARVFFDVLELCKGPSLGTNFTLACPYAILAHYAELEEVA 612

Query: 343 DPYIDQTLIRVSIGVENADDLIKDLETALQE 373
              ++++L+RVS+G+E+A+ L      A++E
Sbjct: 613 KYGVERSLVRVSVGLESAESLNHVFSHAIKE 643

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 115/255 (45%), Gaps = 32/255 (12%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSA 196
           V +E+P NP     D++ +   +      ++VD T         L YA     D+V  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVIVV----KDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRI 252
           TK F G S++++G +V+    K  E  +K           +   ++  L R+ R +  R 
Sbjct: 442 TKIFSGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLWCEDALCLERNSRDFVERT 501

Query: 253 LKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF------VKKQLVGGYGPVFSMS 306
           +K + N   ++  + L   +  K+ K++Y+ SL  E        V     GGYG +FS++
Sbjct: 502 IKVNTNTDVLLTKVLL--PQVGKLFKKIYYPSLTSEETKKNYDNVMSTKDGGYGGLFSLT 559

Query: 307 LQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRVSIG 356
              I++ KKF   L+      SLG   +L    A+   Y          +++ L+RVS+G
Sbjct: 560 FFNIERAKKFFNSLE-LCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVG 618

Query: 357 VENADDLIKDLETAL 371
           +EN+D L K  + A+
Sbjct: 619 LENSDVLCKVFQQAI 633

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 104/461 (22%), Positives = 178/461 (38%), Gaps = 109/461 (23%)

Query: 2   THLGTSLIHA-----DDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-V 55
           +H  T  +HA     DD  NR   V  PI  +T+Y ++++     +    L  +E    +
Sbjct: 3   SHFDTVQLHAGQENPDDNANRPRAV--PIYATTSYVFNDS-----KHGSQLFGLETPGYI 55

Query: 56  YSRLAHPNATRLES-LFSEILEGHAVIYSSGCAA---FYAAMVHYNPKKIFMGQCYHGLR 111
           YSR+ +P    LE  + +      A+  +SG A+     + + H     +     Y G  
Sbjct: 56  YSRIMNPTVDVLEKRIAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGGTY 115

Query: 112 AIANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHS 165
               +  +  G+E   ++     D EK + +    V +E+  NP     D   I E AH 
Sbjct: 116 NQFKVAFKRLGIETRFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHK 175

Query: 166 KGAIVLVDSTFAP-----PPLQYAWDLGADVVLHSATKYF-------------------- 200
            G  V+VD+TF        P++Y    GAD+V HSATK+                     
Sbjct: 176 HGIPVVVDNTFGAGGFFAQPIKY----GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWK 231

Query: 201 --------------GGHSDLLS---GVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLR 243
                         G H  + +   G +        + LRD    LG  +    ++ LL+
Sbjct: 232 DYPEKFPQFSIPSEGYHGMIFNDAFGPLAFIGHVRTELLRD----LGPALNPFAAFQLLQ 287

Query: 244 SLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF---VKKQLVGGYG 300
            + +  LR  +  ENA K+  +L  +       +  V +  L   +     KK L  G+G
Sbjct: 288 GVETLSLRAERHGENALKLAAWLEQS-----PYVSWVSYPGLPSHSHHENAKKYLTNGFG 342

Query: 301 PVFSMSLQTIDQCKKFPGK-------------LKYFHHATSLGGVESLV----------- 336
            V S   + +    +   K             LK   +  ++G  ++LV           
Sbjct: 343 GVLSFGAKDLPNNAEAEAKNPFAAAGAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQL 402

Query: 337 --EWRAMTDPYIDQTLIRVSIGVENADDLIKDLETALQELH 375
             E +A +   + + LIRVS+G E  DD+I D + + ++++
Sbjct: 403 THEEKASSG--VTKDLIRVSVGTEFIDDIINDFQQSFEQVY 441

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 120/266 (45%), Gaps = 23/266 (8%)

Query: 127 TLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWD 186
           TL +I    ++   V +E+P NP     D+  +   A   G  V+VD T A   +     
Sbjct: 405 TLKEILHSGEQILAVFMETPSNPLLKMGDLLELKRLADIYGFYVVVDET-AGGFVNIDVL 463

Query: 187 LGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL---ESYMLLR 243
             AD+V  S TK F G S++++G +V+       +   +    G     L   ++  L R
Sbjct: 464 PHADLVCSSLTKIFSGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLER 523

Query: 244 SLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF------VKKQLVG 297
           + R +  R LK + NA  ++  + + +E    +  ++Y+  L  E        V+ +  G
Sbjct: 524 NSRDFVTRTLKVNSNAEMLLNDVLIPEE--GHLFSKIYYPRLTSEETKQNYDTVRCKPNG 581

Query: 298 GYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------ID 347
           GYG +FS++   I+Q KKF   L+      SLG   +L    A+   Y          ++
Sbjct: 582 GYGGLFSLTFYEIEQAKKFFNALE-LCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVE 640

Query: 348 QTLIRVSIGVENADDLIKDLETALQE 373
             L+RVS+G+E+A+ L K    A+ E
Sbjct: 641 ANLVRVSVGLEDAEHLRKVFREAISE 666

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 129/278 (46%), Gaps = 45/278 (16%)

Query: 128 LDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYA 184
           ++D++K  Q G+    V +E+P NP     D+  + + A+  G  ++VD T A   +   
Sbjct: 381 MEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDET-AGGFVNID 439

Query: 185 WDLGADVVLHSATKYFGGHSDLLSGVIVVKDEE----------VCKKLRDDRIYLGTNVG 234
               ADVV  S TK F G S+L++G +V+  +           + +K  +D ++      
Sbjct: 440 VLPHADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCE---- 495

Query: 235 NLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERF---DKVLKEVYHSSLQKEAF- 290
             ++  L R+ R +  R ++ + N     E+L LNK       K+ K++Y+ SL      
Sbjct: 496 --DALALERNSRDFVQRTIQVNHN----TEYL-LNKVLIPLEGKLFKKIYYPSLTSPETK 548

Query: 291 -----VKKQLVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY 345
                VK  +  GYG +FS++   + Q + F   L+      SLG   +L    A+   Y
Sbjct: 549 RHYDAVKCSIDAGYGGLFSLTFFNLAQARVFFDSLQ-LCKGPSLGTNFTLACPYAILAHY 607

Query: 346 ----------IDQTLIRVSIGVENADDLIKDLETALQE 373
                     ++++L+RVS+G+EN + L +  + A+ E
Sbjct: 608 QELDEVARYGVEKSLVRVSVGLENRESLCQVFQHAIAE 645

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 116/257 (45%), Gaps = 32/257 (12%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSA 196
           V +E+P NP     D++ +   +      ++VD T         L YA     D+V  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 197 TKYFGGHSDLLSGVIVV----KDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRI 252
           TK F G S++++G +V+    K  E  +K           +   ++  L R+ R +  R 
Sbjct: 442 TKIFSGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERT 501

Query: 253 LKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF------VKKQLVGGYGPVFSMS 306
           +K + N   +++ + L   +  K+ K++Y+ SL  E        V     GGYG +FS++
Sbjct: 502 IKVNTNTDILLKRVLL--PQVGKLFKKIYYPSLTSEDTKRNYDSVMSTKDGGYGGLFSLT 559

Query: 307 LQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRVSIG 356
              I++ KKF   L+      SLG   +L    A+   Y          ++  L+RVS+G
Sbjct: 560 FFNIEEAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEVAQYGVETNLVRVSVG 618

Query: 357 VENADDLIKDLETALQE 373
           +EN+D L    + A+++
Sbjct: 619 LENSDVLCNVFQRAIEK 635

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 116/260 (44%), Gaps = 27/260 (10%)

Query: 127 TLDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQY 183
           +L D++     G+    V +E+P NP     D+  + + +   G  ++VD T     +  
Sbjct: 390 SLQDLQTILHSGEQILAVFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGF-VNL 448

Query: 184 AWDLGADVVLHSATKYFGGHSDLLSGVIVVKDE----EVCKKLRDDRIYLGTNVGNLESY 239
                AD+V  S TK F G S++++G +V+  +    E  ++  +    +  ++   +  
Sbjct: 449 DGLFHADIVCSSLTKVFNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLI 508

Query: 240 MLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAF------VKK 293
            L ++ R +  + L+ +     +++  N+ K    K+ K +Y+ S   E        +K 
Sbjct: 509 YLEKNSRDFVAKTLRINYTTEYLLD--NVFKPHVGKLFKRIYYPSQNSEEIKQNYEAIKC 566

Query: 294 QLVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTD 343
           +  GGYG VFS++   +DQ K F   LK     T LG   + V          E   + +
Sbjct: 567 KKDGGYGGVFSVTFFQLDQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELERVKE 625

Query: 344 PYIDQTLIRVSIGVENADDL 363
             ++  LIRV +G+EN + L
Sbjct: 626 YGLEDNLIRVCVGLENKNTL 645

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 104/454 (22%), Positives = 182/454 (40%), Gaps = 93/454 (20%)

Query: 2   THLGTSLIHADDKD---NRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKP-VYS 57
           +H  T  +HA  +D   N  +  A PI  +++Y ++++     +    L  +EK   +YS
Sbjct: 3   SHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVFNDS-----KHGAQLFGLEKPGYMYS 57

Query: 58  RLAHPNATRLESLFSEILEGHAVIYSSGCAAFYA----AMVHYNPKKIFMGQCYHGLRAI 113
           R+ +P    LE   + +  G A +  +   A        + H     +     Y G    
Sbjct: 58  RIVNPTVDVLEKRIAALEGGAAALALASGQAAQTLAINGLAHAGDNIVSTSFLYGGTYNQ 117

Query: 114 ANIMTRNYGVEQYTLD-----DIEK-YAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKG 167
             +  +  G+E   +D     D EK +  +   V +ES  NP     D + I   AH  G
Sbjct: 118 FKVAFKRLGIETRFIDGDSPEDFEKAFDDKTKAVYLESIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 AIVLVDSTF-APPPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKK----- 221
             V+VD+TF A       +  GAD++ HSATK+ GGH   + GVIV   +   K      
Sbjct: 178 IPVVVDNTFGAGGFFAQPFKFGADIITHSATKWIGGHGTTIGGVIVDSGKFPWKDYPEKF 237

Query: 222 --------------------------------LRDDRIYLGTNVGNLESYMLLRSLRSYE 249
                                           LRD    LG  +    ++ LL+ + +  
Sbjct: 238 PQFSQPSEGYHGLIFNDALGPLAYIAHVRVELLRD----LGPALNPFAAFQLLQGIETLS 293

Query: 250 LRILKQSENATKVVEFLN----LNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
           LR  + + NA K+ ++L     ++   +  +    +H +       KK L  G+G V S+
Sbjct: 294 LRCERHASNALKLAQYLESSPYVSWVSYPGLPSHSHHEN------AKKYLQNGFGGVLSI 347

Query: 306 SLQTI----DQCKKFPG-------KLKYFHHATSLGGVESLV------EWRAMTD----- 343
            ++ +    ++   F          LK   +  ++G  ++LV        + ++D     
Sbjct: 348 GVKDLPNASEETDPFAASGAQVVDSLKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLA 407

Query: 344 PYIDQTLIRVSIGVENADDLIKDLETALQELHNG 377
             + + LIR+S+G E  DD+I D E A +++  G
Sbjct: 408 SGVTKDLIRISVGTEFIDDIIGDFEQAFEKVFQG 441

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 110/247 (44%), Gaps = 41/247 (16%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSA 196
           V +E+P NP     D+  + + A +    V++D T         LQYA     D+V  S 
Sbjct: 427 VFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQYA-----DIVCSSL 481

Query: 197 TKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYELRI 252
           TK F G S++++G +V+       KL   R +   +  +L    +S  L R+ R    R 
Sbjct: 482 TKIFSGDSNVMAGSLVLNPSSRLYKLA-RRFFASDDYEDLLWCEDSIYLERNSRDCVSRS 540

Query: 253 LKQSENATKVVE--FLNLNKERFDKVLKEVYHSSLQKEAF--VKKQLVGGYGPVFSMSLQ 308
           +K +ENA ++++   L L    F K+      SS  K  +  VK Q  GGYG +FS++  
Sbjct: 541 MKINENAERLLKGTLLPLEGTLFKKIYYPSLTSSETKANYDAVKCQPNGGYGGLFSLTFF 600

Query: 309 TIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------------IDQTLIR 352
             D+C       K F ++  L    SL     +  PY                +++ L+R
Sbjct: 601 D-DECA------KAFFNSLDLCKGPSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNLVR 653

Query: 353 VSIGVEN 359
           VSIG+E+
Sbjct: 654 VSIGLED 660

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 110/257 (42%), Gaps = 37/257 (14%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           V VE+P NP     D+  + + A   G  +++D T     L       AD+V  S TK F
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLF 374

Query: 201 GGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYELRILKQS 256
            G S+++ G +++  +        +  +      +L    ++ +L  + R +E R L+ +
Sbjct: 375 SGTSNVMGGSVLLNPDSSLYPYAQE-YFQSCEFEDLLWSEDAVVLEANSRDFEARTLRTN 433

Query: 257 ENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVK-----KQLVGGYGPVFSMSLQTID 311
           EN   ++  + L +E   K++K+VY+ ++  E   K     +   GGYG +FS++    +
Sbjct: 434 ENTVNLLTKVLLPEE--GKLIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFHNEE 491

Query: 312 QCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYI----------------DQTLIRVSI 355
             K F   LK F   ++            +  PY+                D  L+RVS+
Sbjct: 492 DAKCFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHFELVEVAELGADPNLVRVSV 544

Query: 356 GVENADDLIKDLETALQ 372
           G+E    L +    AL+
Sbjct: 545 GLEEFQGLREVFLNALE 561

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 115/257 (44%), Gaps = 32/257 (12%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSA 196
           V +ESP NP     D+  +   +   G  +++D T         L YA     DVV  S 
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPYA-----DVVCSSL 485

Query: 197 TKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTN-----VGNLESYMLLRSLRSYELR 251
           TK F G S++++G IV+       +     ++L        +   ++  L R+ R +  R
Sbjct: 486 TKIFSGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAICLERNSRDFISR 545

Query: 252 ILKQSENATKVVEFLNLNKERFDKVLKEV----YHSSLQKEAF--VKKQLVG-GYGPVFS 304
            +  +EN   ++E + L ++   K+ K+V    Y ++  K+ +  VK +  G GYG +FS
Sbjct: 546 SILVNENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKNYDQVKAKTAGSGYGGLFS 605

Query: 305 MSLQTIDQCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYIDQTLIRVS 354
           ++   I+Q K F   L       SLG   +L           E   +    ++  L+RVS
Sbjct: 606 VTFYNIEQAKMFFNSLN-LCKGPSLGTNFTLACPYTVLAHYQEMEEVAKFGLEDNLVRVS 664

Query: 355 IGVENADDLIKDLETAL 371
           +G+E+   L K  +TA+
Sbjct: 665 VGLESKQHLEKVFQTAI 681

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 125/295 (42%), Gaps = 34/295 (11%)

Query: 107 YHGLRAIANIMTRNYGVEQYTLDDIEKYAQEGD---IVEVESPMNPYGTSIDIKSIAEKA 163
           Y  L+ + N+    Y  E   ++ ++     G+    V +E+P  P     ++  + E +
Sbjct: 373 YKMLKTLNNVYCLPYVSEIDCMNKLKNILHSGEQILAVLIEAPSTPLLKMGNLLELKELS 432

Query: 164 HSKGAIVLVDST----FAPPPLQYAWDLGADVVLHSATKYFGGH-SDLLSGVIVVKDEEV 218
           +  G I++VD T    F    L +A     DVV  S TK F G   ++++G + +     
Sbjct: 433 NLFGFIIIVDETVGGFFNVDALVHA-----DVVCTSLTKIFSGDVGNVMAGAMALNSNST 487

Query: 219 ----CKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFD 274
                K    D      N+   ++ ++ R+ R +  ++LK +     +++ + +      
Sbjct: 488 IYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKINYTTDYLLDKVLIPHIGEH 547

Query: 275 KVLKEVYHSSL------QKEAFVKKQLVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATS 328
            + K++YH  L      Q    +K +  GGYG VFS+    ++Q K F   L       S
Sbjct: 548 NLFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFNNLEQAKLFYNCLN-VAKGPS 606

Query: 329 LGGVESLVEWRAMTDPYID----------QTLIRVSIGVENADDLIKDLETALQE 373
           LG   +L     +   Y D          ++LIRVS+G+EN   L +  + A+ E
Sbjct: 607 LGTTMTLACPYTILYHYADIEKVSKYGLSESLIRVSVGLENRKQLCQLFQAAIDE 661

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 129/301 (42%), Gaps = 37/301 (12%)

Query: 95  HYNPKKIFMGQCYHGLRAIANIMTRNYGVEQYTLDDIEKYAQ---EGD---IVEVESPMN 148
            ++ K + +G   H    +   ++++Y + +   D + K  +    G+    V  E+P N
Sbjct: 342 QHSKKTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLKEILHSGEQILAVITETPTN 401

Query: 149 PYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSATKYFGGHS 204
                 ++  + + +   G  ++VD +         L Y      D+V  S  K F G  
Sbjct: 402 GLLDVTNLVELKQLSELFGFYIVVDESVGGFVNVDALVYC-----DIVCSSLVKMFSGTE 456

Query: 205 DLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRILKQSENATKVVE 264
           D++SG +VV  +    KL D       +     S +    +    +++ + S +     +
Sbjct: 457 DVVSGSMVVNPQ---SKLYDFAQTFMASEHEPSSVLWCEDI----IQLEQNSRDFVSKSK 509

Query: 265 FLNLNKERFDK---------VLKEVYHSSLQKEA---FVKKQLVGGYGPVFSMSLQTIDQ 312
            +N   +R  +         +  EV+H S+   A    +K +  GGYG VF++   T+++
Sbjct: 510 RINTATKRLLRDVILPQRGTIFTEVHHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLER 569

Query: 313 CKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY--IDQTLIRVSIGVENADDLIKDLETA 370
            + F  +L        LGG  ++     + + Y  +D+TLIRVS+G+E+ D L +  E A
Sbjct: 570 ARSFYDRLNVCK-GPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLEDYDVLKRAFEEA 628

Query: 371 L 371
           +
Sbjct: 629 I 629

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 119/270 (44%), Gaps = 44/270 (16%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           V +E+P NP     D+  +   +   G  ++VD T A   +     + AD++  S TK F
Sbjct: 438 VFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIA-GFVNIDAIIHADIICSSLTKVF 496

Query: 201 GGHSDLLSGVIVV----KDEEVCKKLR------------DDRIYLGTNVGNLESYMLLRS 244
            G S++++G +V+    K  +  K+              +D +YL  N          R 
Sbjct: 497 TGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLWCEDILYLEKNS---------RD 547

Query: 245 LRSYELRILKQSENATKVVEFLNLNKERFD-KVLKEVYH-SSLQKEA-----FVKKQLVG 297
             S   RI   +E     V    + K+  + K+ K++Y+ ++  KE       +K +  G
Sbjct: 548 FLSKTTRINNTTEYLVNTVLSPYVGKKEANGKLFKKIYYPTTTSKETKMCYDAIKCKTYG 607

Query: 298 GYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYID 347
           GYG VFS++   I++ K F   LK      SLG   + V          E   +++  +D
Sbjct: 608 GYGGVFSITFHDIEKAKLFFNNLK-LSKTISLGSNYTTVCPYTVLKHGDELEKVSEYGLD 666

Query: 348 QTLIRVSIGVENADDLIKDLETALQELHNG 377
           +TLIRV +G+EN   L ++   A+++  N 
Sbjct: 667 ETLIRVCVGLENKTSLKENFSRAIEKTMNN 696

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 114/250 (45%), Gaps = 25/250 (10%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYF 200
           V VE+P NP     ++K +   A + G  +++D T     L       AD+V  S TK F
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLF 374

Query: 201 GGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYELRILKQS 256
            G S+++ G +V+  +    + R    +      +L    ++ +L R+ R +E R L+ +
Sbjct: 375 NGASNVMGGSVVLNPKSALYQ-RAREYFKSGEFEDLLWGEDAVVLERNSRDFEDRTLRAN 433

Query: 257 ENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVK-----KQLVGGYGPVFSMSLQTID 311
            N  K+++ L L ++   K  K++Y+ ++  +  +      +   GGYG +FS++  +  
Sbjct: 434 TNTEKLLKELLLPEQ--GKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHSEG 491

Query: 312 QCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYIDQTLIRVSIGVENAD 361
             + F   LK F    S G   +L           E   ++    D ++IRVS+G+E   
Sbjct: 492 DAEAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEEVSKFGADSSIIRVSVGLEETQ 550

Query: 362 DLIKDLETAL 371
            L+    +AL
Sbjct: 551 LLLDVFSSAL 560

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 134/309 (43%), Gaps = 32/309 (10%)

Query: 91  AAMVHYNP---KKIFMGQCYHGLRAIANIMTRNYGV------EQYTLDDIEKYAQEGDIV 141
            A+V Y P   K +  G  Y    +I  +    + +          L+DI    +    V
Sbjct: 332 GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSGDHKAMAQLEDILHSGEPILAV 391

Query: 142 EVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSATKYFG 201
            +E+P NP     D++++   A   G  ++VD T     +       AD+V  S TK F 
Sbjct: 392 FIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGF-VNIDVLPHADLVCSSLTKIFS 450

Query: 202 GHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL---ESYMLLRSLRSYELRILKQSEN 258
           G S++++G +VV              + G+    L   ++  L R+ R    R L+ ++N
Sbjct: 451 GDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERNSRDCASRSLRVNKN 510

Query: 259 ATKVVEFLNLNKERFDKVLKEVYHSSLQKEA------FVKKQLVGGYGPVFSMSLQTIDQ 312
              ++E + L  +    + K++++ +L  E        V+ +  GGYG +FS++    ++
Sbjct: 511 TELLLEKVLLPHQ--GSLFKKIFYPTLTSEETKRNYDAVRCKPDGGYGGLFSLTFHEENR 568

Query: 313 CKKFPGKLKYFHHATSLGGVESL----------VEWRAMTDPYIDQTLIRVSIGVENADD 362
            K F   L+      SLG   +L           E   + +  ++++L+RVS+G+E+ D 
Sbjct: 569 AKVFFDTLE-LCKGPSLGTNFTLACPYTVLAHYAEMDVVAEYGLERSLVRVSVGLEDFDH 627

Query: 363 LIKDLETAL 371
           L K  + A+
Sbjct: 628 LRKVFQRAI 636

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 119/260 (45%), Gaps = 36/260 (13%)

Query: 141 VEVESPMNP---YGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVL 193
           V +E+P NP    G  +++K ++E     G  +++D T         L +A     D+V 
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELF---GFFIIIDETVGGIVNIDGLPFA-----DLVC 485

Query: 194 HSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYE 249
            S TK F G S+++ G +V+  +    +     + L     +L    ++  L R+ R + 
Sbjct: 486 SSLTKTFSGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFI 545

Query: 250 LRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFVKKQLV-----GGYGPVF 303
            R ++ + N   +++ +       + + K++Y+ +L  KE      +V     GGYG +F
Sbjct: 546 ARTIRINYNTEYLLDKIIKPHVGENALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLF 605

Query: 304 SMSLQTIDQCKKFPGKLKYFHHATSLGGVESLV---------EWRAMTDPY-IDQTLIRV 353
           S++    D  + F   L+  +   SLG   +LV            AM + + +++ L+R+
Sbjct: 606 SLTFHDEDHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRI 664

Query: 354 SIGVENADDLIKDLETALQE 373
           S+G+EN   L K  + A+ +
Sbjct: 665 SVGLENQLTLGKIFQKAIDQ 684

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 95/202 (47%), Gaps = 23/202 (11%)

Query: 189 ADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRS 244
           AD+V  S TK F G S+++ G IV+  +        +  +   +  +L    ++ +L R+
Sbjct: 358 ADIVCTSLTKLFNGASNVMGGSIVLNPKSSIYPYARE-YFKSADFEDLLWCEDAVVLERN 416

Query: 245 LRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFVKKQLV----GGY 299
            R +E R L  + N  K++  + + ++   K+ K+VY+ ++  +E F   + V    GGY
Sbjct: 417 SRDFENRTLHANANTEKLLNEVLIPEQ--GKLCKKVYYPTVTSEETFRNYESVRNERGGY 474

Query: 300 GPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLV----------EWRAMTDPYIDQT 349
           G +FS++       K F   LK F    S G   +L           E  A++    D  
Sbjct: 475 GCLFSVAFYNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFGADPN 533

Query: 350 LIRVSIGVENADDLIKDLETAL 371
           +IRVS+G+E+   L++    AL
Sbjct: 534 IIRVSVGLEDTQWLLEVFSNAL 555

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 141/316 (44%), Gaps = 35/316 (11%)

Query: 87  AAFYAAMVHYNP---KKIFMGQCYHGLRAIANIMTRNYGV---EQYTLDDIEKYAQEGD- 139
           AA  A +V Y P   K +  G  Y    +I       + +   ++ +++ +++    G+ 
Sbjct: 338 AAGSADVVGYGPPYKKTVMFGFPYTDTLSILRKFNHTHFLGDGDEKSMEQLKEILHSGEQ 397

Query: 140 --IVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQYAWDLGADVVLHSAT 197
              V +E+P NP     ++  + E A + G  V++D T A   +       AD+V  S T
Sbjct: 398 ILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDET-AGGFVNIDVLPHADMVCSSLT 456

Query: 198 KYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL---ESYMLLRSLRSYELRILK 254
           K F G S++++G +V+  +           + G     L   +   L R+ R +  R L 
Sbjct: 457 KIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEFEDLLWCEDVIYLERNSRDFVTRTLT 516

Query: 255 QSENATKVVEFLNLNKERFDKVLKEVYHSSLQK-------EAFVKKQLVGGYGPVFSMSL 307
            ++N  +++E + + +E+  K+ K++++ SL         +A +  +  GGYG +FS++ 
Sbjct: 517 VNKNTAQLLEEVLIPQEK--KLFKKIFYPSLTSPETKRNYDAILCPK--GGYGGLFSLTF 572

Query: 308 QTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRVSIGV 357
               Q + F   L+      SLG   +L    A+   Y          ++++L+RVS+G+
Sbjct: 573 YNEKQARVFFDTLE-LCKGPSLGTNFTLACPYAILAHYTELEEVAKFGVERSLVRVSVGL 631

Query: 358 ENADDLIKDLETALQE 373
           E+   L      A+ E
Sbjct: 632 ESPQVLNAVFSRAIAE 647

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 115/258 (44%), Gaps = 36/258 (13%)

Query: 141 VEVESPMNP---YGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVL 193
           V +E+P NP    G  +++K ++E     G  +++D T         L +A     D+V 
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELF---GFFIIIDETVGGIVNIDGLPFA-----DIVC 446

Query: 194 HSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYE 249
            S TK F G S+++ G +V+  +    +     + L     +L    ++  L R+ R + 
Sbjct: 447 SSLTKTFSGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFI 506

Query: 250 LRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFVKKQLV-----GGYGPVF 303
            R ++ + +   +++ +       +K+ K++Y+ +L  KE      +V     GGYG +F
Sbjct: 507 ARTIRINYSTEYLLDKILKPHVGENKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLF 566

Query: 304 SMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRV 353
           S++    D    F   LK  +   SLG   +L     +   Y          +++ L+R+
Sbjct: 567 SLTFHDEDHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRI 625

Query: 354 SIGVENADDLIKDLETAL 371
           S+G+E+   L K  + A+
Sbjct: 626 SVGLESQSILGKIFQEAI 643

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 115/258 (44%), Gaps = 36/258 (13%)

Query: 141 VEVESPMNP---YGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVL 193
           V +E+P NP    G  +++K ++E     G  +++D T         L +A     D+V 
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELF---GFFIIIDETVGGIVNIDGLPFA-----DIVC 496

Query: 194 HSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL----ESYMLLRSLRSYE 249
            S TK F G S+++ G +V+  +    +     + L     +L    ++  L R+ R + 
Sbjct: 497 GSLTKTFSGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFI 556

Query: 250 LRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFVKKQLV-----GGYGPVF 303
            R ++ + +   +++ +       + + K++Y+ SL  KE  +   +V     GGYG +F
Sbjct: 557 ARTIRINYSTEYLLDKILKAHVGENGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLF 616

Query: 304 SMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPY----------IDQTLIRV 353
           S++    D    F   L+  +   SLG   +L     +   Y          +++ L+R+
Sbjct: 617 SLTFHDEDHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRI 675

Query: 354 SIGVENADDLIKDLETAL 371
           S+G+E+   L K  + A+
Sbjct: 676 SVGLESQSTLGKIFQEAI 693

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 125/275 (45%), Gaps = 39/275 (14%)

Query: 127 TLDDIEKYAQEGD---IVEVESPMNP---YGTSIDIKSIAEKAHSKGAIVLVDSTFAP-- 178
           ++D++ K    G+    V +E+P NP    G  +++K ++E     G  +++D T     
Sbjct: 378 SMDELTKILHSGEQILAVFIETPSNPLLKMGNLLELKRLSELF---GFFIIIDETVGGIV 434

Query: 179 --PPLQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNL 236
               L +A     D+V  S TK F G S+++ G +V+  +    +     + L     +L
Sbjct: 435 NIDGLPFA-----DIVCSSLTKTFSGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDL 489

Query: 237 ----ESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSL-QKEAFV 291
               ++  L R+ R +  R ++ + +   +++ +       +++ K++Y+ +L  KE   
Sbjct: 490 LWCEDAIYLERNSRDFIARTVRINYSTEYLLDKILKPHVGGNELFKKIYYPNLTSKETLT 549

Query: 292 KKQLV-----GGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLV---------E 337
              +V     GGYG +FS++         F   L+  +   SLG   +L          +
Sbjct: 550 NYDMVRCKKEGGYGGLFSLTFHDEHHAAAFYDNLQ-LNKGPSLGTNFTLAFPYTLMTYYQ 608

Query: 338 WRAMTDPY-IDQTLIRVSIGVENADDLIKDLETAL 371
             AM + + +++ L+R+S+G+E+   L K  + A+
Sbjct: 609 ELAMAEKFGVERNLLRISVGLESQSTLGKIFQEAI 643

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 11/67 (16%)

Query: 316 FPGKLKYFHHATSLGGVESLVEWRA-MTDPYI--DQ--------TLIRVSIGVENADDLI 364
           F    + F  A SLGG+ESL+E  A MT   I  DQ         LIR+S+G+E+ DDL+
Sbjct: 16  FTSTTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLL 75

Query: 365 KDLETAL 371
            D++ AL
Sbjct: 76  DDIKNAL 82

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 112/249 (44%), Gaps = 37/249 (14%)

Query: 141 VEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAP----PPLQYAWDLGADVVLHSA 196
           V +E+P NP     D+  + + +   G  ++VD T +       L Y      D+V  S 
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSYC-----DIVCSSL 372

Query: 197 TKYFGGHSDLLSGVIVVKDEEVCKKLRDDRI-YLGTNVGN------LESYMLLRSLRSYE 249
           TK F G S++++G +VV       KL D  I +L     N       +S  L R+ R + 
Sbjct: 373 TKIFSGDSNVIAGSLVVNP---ASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFI 429

Query: 250 LRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQK-EAFVKKQLV----GGYGPVFS 304
            R  K ++ A  +V    +  E   ++L+++Y+ SL   E+ +    V    GGYG + S
Sbjct: 430 DRAQKINKIAEDLVS--TVLLEEEGQLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLIS 487

Query: 305 MSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYID----------QTLIRVS 354
           +  +  DQ K F   L   +   SLG   +LV   A+   Y +          + L+R+S
Sbjct: 488 IVFKREDQAKVFYDNLS-LNKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRIS 546

Query: 355 IGVENADDL 363
           +G+E+ + L
Sbjct: 547 VGLESLETL 555

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 113/252 (44%), Gaps = 48/252 (19%)

Query: 140 IVEVESPMNPYGTSIDIKSIAEKAHS--KGAIVLVDSTF---------APPPLQYAWDLG 188
           I  V SP NP G  IDI SI EK  S  +  IV +D  +         A P +    +L 
Sbjct: 167 IAFVTSPGNPTGALIDIASI-EKILSQWQSGIVAIDEAYIDFCSTGGSAAPLVNKYPNLA 225

Query: 189 ADVVLHSATKYFGGHSDLLSGV---IVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSL 245
              VL + +K FG     L+GV   +    +++ + L  + +    N+ ++ S ++L++L
Sbjct: 226 ---VLQTLSKSFG-----LAGVRLGVTFTSKDLSRVL--NAMKAPYNISSMASNLVLKAL 275

Query: 246 RSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSM 305
            S  ++ +K  +N  ++VE     +ER  K L  + +        V+   VGG    F M
Sbjct: 276 SSESVQTMK--DNVQEIVE----ERERVLKALTSMEN--------VQDTQVGGLDANFIM 321

Query: 306 SLQTIDQCKKFP--GKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGV-ENADD 362
            ++ +D  K      K  Y+  AT  G V   V +R     Y     +R++IG  E    
Sbjct: 322 -VRIVDGGKGNNELSKALYYRLATESGVV---VRFRGTE--YGCTGCLRITIGTHEENSK 375

Query: 363 LIKDLETALQEL 374
           LIK+ E  L+EL
Sbjct: 376 LIKEFEKKLKEL 387

>SAKL0D15422g Chr4 complement(1288743..1289207) [465 bp, 154 aa]
           {ON} some similarities with uniprot|P43623 Saccharomyces
           cerevisiae YFR055W Hypothetical ORF
          Length = 154

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 12/154 (7%)

Query: 234 GNLESYMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKK 293
           G  +  + L+ +R+  LR+      A  +   L   +E  +KVL   +      E +++ 
Sbjct: 4   GADDCLLALKGMRTLSLRLKDVERKALGLATCLK-GREEVEKVLHPAFEDCPGHEYWLRD 62

Query: 294 QLVGGYGPVFSMSLQ---TIDQCKKFPGKLKYFHHATSLGGVESLVE------WRAMTDP 344
               G   +F++ L+   T    +    ++  F    S GG E LV       +R   D 
Sbjct: 63  --YKGSSGLFTVVLKEGFTKTDFENMIEQMDIFKLGFSWGGYERLVTPVNPKTYRTAPDW 120

Query: 345 YIDQTLIRVSIGVENADDLIKDLETALQELHNGA 378
                  R+ +G+E++ DL +DLE  LQ L  G+
Sbjct: 121 SYAGFAFRIQVGLEDSADLQRDLEPGLQRLAAGS 154

>Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 152

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 64/157 (40%), Gaps = 21/157 (13%)

Query: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63
             T  +HA    +    V  PI++STT++   +   P  E E          YSR  +PN
Sbjct: 8   FATKAVHAGTHTDVHGSVIEPISLSTTFK-QHSPAQPVGEYE----------YSRSQNPN 56

Query: 64  ATRLESLFSEILEG-HAVIYSSGCAAFYAAMVHYNPK---KIFMGQCYHGLRAIANIMTR 119
              LE   + +    HA+ +SSG A   A ++   P+    + +G  Y G     + +  
Sbjct: 57  RKNLEDAVAALENAKHALAFSSGSAT-TAVVLQSLPQGSHAVSIGDVYGGTHRYFSKVAA 115

Query: 120 NYGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDI 156
            +GVE    +D+       D   V SP +  G  + +
Sbjct: 116 AHGVETTFTNDLLN-----DTASVGSPQHQTGGGLRL 147

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 65/148 (43%), Gaps = 16/148 (10%)

Query: 143 VESPMNPYGTSI---DIKSIAEKAHSKGAIVLVDSTFAP------PPLQYAWDLGADVVL 193
           + +P NP  + I    ++ IAE A   G +V  D  ++P       P          +V 
Sbjct: 160 LNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVYSPLFHSCEKPKSLCQLSANGIVT 219

Query: 194 HSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLRSLRSYELRIL 253
            S +K +   + L  G IV ++ E  K  R  R +   +V  ++  +    LR  E+ +L
Sbjct: 220 GSMSKAYAA-AGLRVGWIVSRNSEFLKGARSRRSFNTISVSMIDDAVSQYILRHREV-VL 277

Query: 254 KQS-----ENATKVVEFLNLNKERFDKV 276
           K++     +N   V EFL  ++++F  V
Sbjct: 278 KRNIKLCQDNLVTVKEFLKNSQDKFSFV 305

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 10/103 (9%)

Query: 275 KVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTIDQCKK--FPGKLK------YFHHA 326
           KVL++++ S+LQ       + V G  P F   L   +Q  +    G +K       FH  
Sbjct: 343 KVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDVSLFHTE 402

Query: 327 TSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDLIKDLET 369
            +   VE L EW A++D  +D++   ++   E AD+L K LET
Sbjct: 403 NANRLVELLSEWLALSDEPLDES--ELNAANEVADELYKILET 443

>KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {ON}
           
          Length = 1436

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 10/103 (9%)

Query: 275 KVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTIDQCKK--FPGKLK------YFHHA 326
           KVL++++ S+LQ       + V G  P F   L   +Q  +    G +K       FH  
Sbjct: 347 KVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDASLFHTE 406

Query: 327 TSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADDLIKDLET 369
            +   VE L EW A+ D  +D++   ++   E AD+L K LET
Sbjct: 407 NANRLVELLSEWLALNDKPLDES--ELNAANEVADELYKILET 447

>CAGL0H04169g Chr8 (394311..396407) [2097 bp, 698 aa] {ON} similar
           to uniprot|Q04533 Saccharomyces cerevisiae YML082w
          Length = 698

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 66/136 (48%), Gaps = 18/136 (13%)

Query: 239 YMLLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGG 298
           Y++ R LR +E ++ K+       V +LN      D+  +E  + ++ K +    +   G
Sbjct: 581 YLVKRVLRQHEGKVFKR-------VLYLN------DEAWQENNYYNMVKYS----REDCG 623

Query: 299 YGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVE 358
           YG + ++  +  +Q  KF   +++ +  T + G   +    A  + +  + L+RV +G+E
Sbjct: 624 YGGIIAIEFEKENQLAKFYDSIEHIYKGTPVLGGNDITTVAAFRE-HNGRHLLRVCVGLE 682

Query: 359 NADDLIKDLETALQEL 374
           N   L K  ++AL ++
Sbjct: 683 NIKILTKVFQSALSKI 698

>KLLA0A08162g Chr1 complement(727416..728789) [1374 bp, 457 aa] {ON}
           uniprot|Q06433 Kluyveromyces lactis KLLA0A08162g GAL80
           Galactose/lactose metabolism regulatory protein GAL80
          Length = 457

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 16/83 (19%)

Query: 294 QLVGGYGPVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRV 353
           Q+V  Y P    SLQTI+Q +          HAT    +ES  +++       D  +I V
Sbjct: 48  QIVALYNPTLKSSLQTIEQLQ--------LKHATGFDSLESFAQYK-------DIDMIVV 92

Query: 354 SIGVENADDLIKD-LETALQELH 375
           S+ V    +++K+ LE + Q L+
Sbjct: 93  SVKVPEHYEVVKNILEHSSQNLN 115

>Kpol_541.42 s541 (140531..141559) [1029 bp, 342 aa] {ON}
           (140531..141559) [1029 nt, 343 aa]
          Length = 342

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 252 ILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVFSMSLQTID 311
           IL Q EN  K V+  NL  E    V++EV    L+K +++KK++     P FS  L++ D
Sbjct: 78  ILTQIEN--KKVDDRNLKSEN---VIQEVKDPLLEKNSYLKKEVRSSIFPDFSSPLKSYD 132

Query: 312 QCK 314
           + K
Sbjct: 133 EVK 135

>SAKL0B00770g Chr2 complement(67494..70085) [2592 bp, 863 aa] {ON}
           similar to uniprot|P43560 Saccharomyces cerevisiae
           YFL042C Due to a sequence change (deletion of G at
           46151) YFL043C is now part of YFL042C.
          Length = 863

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 247 SYELRILKQSENATKVVEFLNLNKERFDKVLKEV 280
           +++LRI++Q     K  +FLNL+  R DKVL+++
Sbjct: 717 AFQLRIIRQMNVIDKSNDFLNLSNFRIDKVLEDI 750

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,496,292
Number of extensions: 1727604
Number of successful extensions: 5847
Number of sequences better than 10.0: 144
Number of HSP's gapped: 5776
Number of HSP's successfully gapped: 164
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)