Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E038405.434ON31031016500.0
Suva_8.1735.434ON31231210831e-149
Smik_15.2985.434ON31231210741e-147
KAFR0E03850singletonON31131010591e-145
Skud_15.2835.434ON31231210561e-144
YOR120W (GCY1)5.434ON31231210531e-144
KNAG0C049105.434ON31331310271e-140
NCAS0H020605.434ON32231310201e-139
NDAI0C016005.434ON31331310111e-138
CAGL0I01100g5.434ON3103109681e-131
TPHA0E017605.434ON3103099561e-129
Suva_2.5405.434ON3123129471e-128
TBLA0A065105.434ON3123129471e-128
Skud_4.6375.434ON3123129361e-126
TDEL0E019105.434ON3113139331e-126
CAGL0A02816g5.434ON3103099321e-126
ZYRO0F10032g5.434ON3103079301e-125
YDR368W (YPR1)5.434ON3123129261e-125
Kpol_1062.295.434ON3113109211e-124
Smik_4.6345.434ON3123129201e-124
SAKL0G02530g5.434ON3123129041e-121
NDAI0B056705.434ON3183118911e-119
TBLA0A02825singletonON3113118801e-118
TBLA0A02835singletonON3113118761e-117
KLTH0F16060g5.434ON3093098611e-115
TPHA0G00210singletonON3113118601e-115
Kwal_47.18084na 1ON3093048591e-115
KLLA0B14707gsingletonON3103068591e-115
KLTH0E15532gsingletonON3093028571e-114
NCAS0F033805.434ON3133128551e-114
KLTH0E00220gsingletonON3063058401e-112
KLTH0A00528gsingletonON3063058401e-112
Kwal_55.214265.434ON3083088391e-112
KLLA0D10109gsingletonON3093038201e-109
AER401W5.434ON3133118131e-108
KLTH0A03476gna 1ON3083097971e-105
TDEL0D00230singletonON3123097901e-104
NDAI0A070003.108ON3202985437e-67
NCAS0I024203.108ON3203065428e-67
KLLA0F02728g3.108ON3303025324e-65
KNAG0K020703.108ON3233085272e-64
SAKL0C10626gsingletonON3222985237e-64
KLTH0C10010g3.108ON3213075193e-63
Kwal_56.226113.108ON3213055141e-62
SAKL0C09922g3.108ON3223055062e-61
YBR149W (ARA1)3.108ON3443085012e-60
Smik_2.289singletonON3443084986e-60
Suva_4.3983.108ON3443084979e-60
ZYRO0B06138g3.108ON3283064969e-60
Smik_2.2883.108ON3443164961e-59
TDEL0D051603.108ON3252854897e-59
Skud_2.2763.108ON3443084909e-59
KAFR0G013503.108ON3243084732e-56
NCAS0A066605.409ON3263184514e-53
Ecym_55085.409ON3263094507e-53
ACL107C5.409ON3543384492e-52
Suva_15.3005.409ON3273154281e-49
TPHA0E018605.409ON3263264281e-49
KAFR0C05320singletonON3273154272e-49
CAGL0I01122g5.409ON3263254262e-49
KLTH0F16610g5.409ON3293244262e-49
YHR104W (GRE3)5.409ON3273154253e-49
KNAG0B03780singletonON3263104183e-48
Skud_8.1655.409ON3273214166e-48
Smik_8.1825.409ON3273214151e-47
ZYRO0A06336g5.409ON3273204141e-47
NDAI0D016005.409ON3273214132e-47
TDEL0E021505.409ON3293344132e-47
KLLA0F03256g7.468ON2852794058e-47
Kwal_55.215365.409ON3293264071e-46
SAKL0G01914g5.409ON3293194035e-46
KNAG0D013707.468ON2822763989e-46
KLTH0G02420gna 2ON2893153972e-45
Kwal_33.13276na 3ON3022893972e-45
SAKL0F14278g7.468ON2862993944e-45
KLLA0E21627g5.409ON3293193958e-45
TBLA0F01720singletonON3263103932e-44
KLLA0F05775g7.285ON3093203912e-44
Ecym_7160na 4ON2712913822e-43
CAGL0C04543g7.468ON2872773814e-43
KLTH0F01892gna 3ON3023073814e-43
TBLA0A00630singletonON3283163783e-42
ABL209Cna 4ON3102783763e-42
Kpol_1013.827.468ON2852773711e-41
Kwal_47.182197.468ON2932773711e-41
NCAS0H005607.468ON2842793665e-41
YJR096W7.468ON2822833632e-40
Kpol_1020.137.285ON3133253615e-40
TDEL0C033207.468ON2832893588e-40
KLTH0G05786g7.468ON2862773552e-39
Skud_10.3187.468ON2822893543e-39
Suva_12.1847.468ON2822833534e-39
NCAS0A137407.285ON3093123545e-39
KAFR0G009207.468ON2862783492e-38
Kwal_47.18893na 2ON2893183482e-38
Smik_10.3847.468ON2822833474e-38
ZYRO0G17600g7.468ON2832853386e-37
TBLA0F019807.285ON3023093396e-37
KAFR0B012007.285ON3153233391e-36
Kpol_381.8singletonON3093133372e-36
CAGL0J09394g7.285ON3113053372e-36
NDAI0A023007.285ON3133143363e-36
Skud_4.1317.285ON3123063338e-36
Smik_4.1137.285ON3123063311e-35
SAKL0F02574gna 2ON2893103292e-35
Kwal_47.19278na 5ON3143213241e-34
YDL124W7.285ON3123103223e-34
KNAG0C041107.285ON3113043153e-33
TDEL0D02790singletonON3293013121e-32
ZYRO0C09196g7.285ON3123023074e-32
ZYRO0E09614gna 5ON3083043057e-32
KLTH0G00638gna 5ON3133032988e-31
SAKL0F00704gna 5ON3153202989e-31
SAKL0F09746g7.285ON3123132934e-30
Ecym_32647.285ON3113132499e-24
Kwal_33.13274singletonON1081031851e-16
KAFR0F03890singletonON3193081281e-07
Suva_4.1227.285ON2061771224e-07
TBLA0E05040singletonON3423201236e-07
TBLA0G01120singletonON3433241157e-06
NCAS0C02450singletonON3433131131e-05
Kpol_400.9singletonON3413031131e-05
Kpol_449.4singletonON341591112e-05
Ecym_22962.604ON3401681085e-05
TBLA0B10110singletonON3452951051e-04
Kpol_2000.109singletonON3422271014e-04
ABR094W2.604ON359276996e-04
TBLA0G00960singletonON321245940.002
KNAG0L01560singletonON340324940.002
KAFR0C03670singletonON343316920.005
Suva_14.10na 6ON376109920.005
NCAS0C019908.565ON343311910.006
NDAI0J00730singletonON34362910.006
Suva_12.272singletonON265262900.007
NCAS0A129502.604ON32384900.007
YDL243C (AAD4)singletonON329105900.009
SAKL0H09438g8.565ON342302900.009
ZYRO0D02816gsingletonON34376890.011
NCAS0F04070singletonON344243890.012
ZYRO0F04840gsingletonON379236890.013
KAFR0C04240singletonON34383880.016
NDAI0H02960singletonON34458870.019
NCAS0A03110singletonON34476870.019
NDAI0B013002.604ON333204870.021
NCAS0J01740singletonON345248850.031
CAGL0E05192gsingletonON345320850.033
KLTH0A08052gsingletonON33859850.036
NDAI0I01760na 7ON33961850.040
TPHA0H00110singletonON34560840.042
NDAI0G01600singletonON34460840.043
KLLA0F19360gsingletonON34462840.044
ZYRO0F00858g2.604ON34687840.048
YNL331C (AAD14)na 6ON376118840.055
SAKL0E00286gsingletonON338304830.058
TDEL0C06010singletonON34460830.060
KNAG0L01270singletonON343290830.061
Skud_10.383na 8ON376109830.063
NDAI0C01480singletonON34360820.080
Kwal_26.83772.604ON338107820.094
Smik_14.1na 6ON376105820.096
ZYRO0A00286gsingletonON34192810.098
KLTH0E16852gsingletonON375135800.15
NCAS0I02160singletonON34460790.19
CAGL0E05236gsingletonON344321790.21
Smik_3.208singletonON34460780.23
Skud_3.179singletonON34460780.28
KNAG0M023402.604ON309174770.33
NDAI0G04890singletonON34359770.34
Suva_9.17singletonON308197760.37
YFL056C (AAD6)singletonON21299750.41
KAFR0J00220singletonON34385760.50
TDEL0A08000singletonON319320750.55
AGR227W8.602ON38560750.65
KLTH0E01474gsingletonON313278750.65
Skud_16.1958.565ON342337731.2
NCAS0D03150na 7ON33863711.6
YPL088W8.565ON34260711.8
Smik_3.210singletonON362120712.1
CAGL0E05214gsingletonON34660702.3
KAFR0D04230singletonON34276702.5
SAKL0B11462g2.604ON33985702.6
Kpol_1043.312.314ON28280692.9
Smik_79.1singletonON253120693.0
Suva_16.2248.565ON34260684.4
NDAI0G012103.441ON164870685.1
Skud_3.183singletonON21795657.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03840
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   640   0.0  
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   421   e-149
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   418   e-147
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     412   e-145
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   411   e-144
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   410   e-144
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   400   e-140
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     397   e-139
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   394   e-138
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   377   e-131
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   372   e-129
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   369   e-128
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   369   e-128
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   365   e-126
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   363   e-126
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   363   e-126
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   362   e-125
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   361   e-125
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   359   e-124
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   358   e-124
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   352   e-121
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   347   e-119
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     343   e-118
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     342   e-117
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   336   e-115
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 335   e-115
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   335   e-115
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   335   e-115
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   334   e-114
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     333   e-114
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   328   e-112
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   328   e-112
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   327   e-112
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   320   e-109
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   317   e-108
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   311   e-105
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   308   e-104
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   213   7e-67
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   213   8e-67
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   209   4e-65
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   207   2e-64
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   206   7e-64
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   204   3e-63
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   202   1e-62
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   199   2e-61
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   197   2e-60
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   196   6e-60
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   196   9e-60
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   195   9e-60
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   195   1e-59
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   192   7e-59
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   193   9e-59
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   186   2e-56
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             178   4e-53
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   177   7e-53
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   177   2e-52
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   169   1e-49
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   169   1e-49
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   169   2e-49
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   168   2e-49
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   168   2e-49
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   168   3e-49
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               165   3e-48
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   164   6e-48
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   164   1e-47
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   164   1e-47
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               163   2e-47
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   163   2e-47
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   160   8e-47
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   161   1e-46
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   159   5e-46
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   157   9e-46
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   157   2e-45
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   157   2e-45
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   156   4e-45
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   156   8e-45
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     155   2e-44
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   155   2e-44
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   151   2e-43
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   151   4e-43
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   151   4e-43
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     150   3e-42
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   149   3e-42
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   147   1e-41
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   147   1e-41
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   145   5e-41
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   144   2e-40
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   143   5e-40
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   142   8e-40
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   141   2e-39
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   140   3e-39
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   140   4e-39
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   140   5e-39
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   139   2e-38
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   138   2e-38
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   138   4e-38
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   134   6e-37
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   135   6e-37
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   135   1e-36
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   134   2e-36
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   134   2e-36
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     134   3e-36
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   132   8e-36
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   132   1e-35
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   131   2e-35
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   129   1e-34
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   128   3e-34
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   125   3e-33
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     124   1e-32
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   122   4e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   122   7e-32
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   119   8e-31
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   119   9e-31
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   117   4e-30
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   100   9e-24
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    76   1e-16
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      54   1e-07
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    52   4e-07
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             52   6e-07
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    49   7e-06
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    48   1e-05
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    48   1e-05
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    47   2e-05
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    46   5e-05
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    45   1e-04
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    44   4e-04
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    43   6e-04
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      41   0.002
KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON}              41   0.002
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    40   0.005
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    40   0.005
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     40   0.006
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    40   0.006
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    39   0.007
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    39   0.007
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    39   0.009
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    39   0.009
ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} simila...    39   0.011
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    39   0.012
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    39   0.013
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               39   0.016
NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON}               38   0.019
NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {O...    38   0.019
NDAI0B01300 Chr2 (303531..304532) [1002 bp, 333 aa] {ON} Anc_2.6...    38   0.021
NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {...    37   0.031
CAGL0E05192g Chr5 complement(506831..507868) [1038 bp, 345 aa] {...    37   0.033
KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {...    37   0.036
NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON}               37   0.040
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 37   0.042
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               37   0.043
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    37   0.044
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    37   0.048
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    37   0.055
SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON...    37   0.058
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    37   0.060
KNAG0L01270 Chr12 (230125..231156) [1032 bp, 343 aa] {ON}              37   0.061
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    37   0.063
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               36   0.080
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    36   0.094
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    36   0.096
ZYRO0A00286g Chr1 (15089..16114) [1026 bp, 341 aa] {ON} highly s...    36   0.098
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    35   0.15 
NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON}               35   0.19 
CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {...    35   0.21 
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    35   0.23 
Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W ...    35   0.28 
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    34   0.33 
NDAI0G04890 Chr7 (1178096..1179127) [1032 bp, 343 aa] {ON}             34   0.34 
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     34   0.37 
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    33   0.41 
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      34   0.50 
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              33   0.55 
AGR227W Chr7 (1175673..1176830) [1158 bp, 385 aa] {ON} Syntenic ...    33   0.65 
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    33   0.65 
Skud_16.195 Chr16 (353315..354343) [1029 bp, 342 aa] {ON} YPL088...    33   1.2  
NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {O...    32   1.6  
YPL088W Chr16 (381965..382993) [1029 bp, 342 aa] {ON} Putative a...    32   1.8  
Smik_3.210 Chr3 (309527..310615) [1089 bp, 362 aa] {ON} YNL331C ...    32   2.1  
CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {...    32   2.3  
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    32   2.5  
SAKL0B11462g Chr2 (995743..996762) [1020 bp, 339 aa] {ON} simila...    32   2.6  
Kpol_1043.31 s1043 (66691..67539) [849 bp, 282 aa] {ON} (66691.....    31   2.9  
Smik_79.1 Chr79 complement(3..761) [759 bp, 253 aa] {ON} YNL331C...    31   3.0  
Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088...    31   4.4  
NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3....    31   5.1  
Skud_3.183 Chr3 (296810..296845,296849..297115,297116..297466) [...    30   7.4  

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKA 180
           SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKA
Sbjct: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKA 180

Query: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN 240
           PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN
Sbjct: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN 240

Query: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN 300
           GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN
Sbjct: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN 300

Query: 301 PNFEPFKTFV 310
           PNFEPFKTFV
Sbjct: 301 PNFEPFKTFV 310

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  421 bits (1083), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 249/312 (79%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSA L+ STKTL LN G++IP VGLGTWQ+ D  DAY +V AAL  GYRHIDTAAIY NE
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKD-NDAYKSVVAALKDGYRHIDTAAIYGNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AI+DSGVPREEIFVTTKLW  QHHEP  ALD+SL+RLGLDYVDLYLMHWPV LD 
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDP 119

Query: 121 SYMKESP-LELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
           +Y+K+   L +  + DG+RPV+ T+W FI TWELMQ+LPK NK R++GVSNFS+NNLKDL
Sbjct: 120 NYIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   + P  NQVELHPLLPQ EL+D+C+   I VEAYSPLGST APLL EP+V+++A
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KKN VQP HVV+SW  QR  +VLPKSV+ +R+  N K FTL +EDF+AI  IS+++GE+R
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKR 299

Query: 298 INNPNFEPFKTF 309
           + NP++ PF+ F
Sbjct: 300 VVNPDWSPFEAF 311

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  418 bits (1074), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 246/312 (78%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MS  L +STKTL LN G+QIP VGLGTWQ+ D  DAY +V AAL AGY+HIDTAAIY+NE
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKD-NDAYKSVLAALKAGYKHIDTAAIYRNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AI+DSGVPREEIFVTTKLW+ QHHEP  ALDESLQRLGLDYVDLYL+HWP  LD 
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119

Query: 121 SYMKESP-LELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
           +Y+K+   L +  + DG+R V+ T+W FI TWELMQ+LPK  K ++IGVSNFS+NNLKDL
Sbjct: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   + P  NQVE+HPLLPQ EL+++C+  KI +EAYSPLGST APLL EP ++ +A
Sbjct: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KKN VQP HVV+SW  QR  +VLPKSV+ +R+  N K FTL  EDF+AI  IS+++GE+R
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299

Query: 298 INNPNFEPFKTF 309
           + NPN+ PF+ F
Sbjct: 300 VVNPNWSPFEAF 311

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/310 (63%), Positives = 248/310 (80%), Gaps = 1/310 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M++ L+N+T TLKLN G+ +PI+GLGTW+ATD+++ YNAV++AL+AGYRHIDTAAIY+NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
             VG AIR+SG+PR+EIFVTTKLW  QH +P  ALD+SL+RLGLDYVDLYLMHWPV ++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 121 SYMKESPL-ELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLK 179
            Y K S L E   RPDG+  VE+DW FI TWELMQ+LPK K R+IGVSNFS+NN+ DLLK
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVESDWDFIKTWELMQELPKTKTRAIGVSNFSINNINDLLK 180

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
           +P   +VP  NQVELHPLLPQ ELV +CQ+  I VEAYSP GS SAPLLSE  +I+VAKK
Sbjct: 181 SPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKK 240

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRIN 299
           + V  A V+LSW ++R I VLPKSVH ERV +N KTF+LPE+DF  I  +S+++GE+R+ 
Sbjct: 241 HDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVV 300

Query: 300 NPNFEPFKTF 309
           N ++ PFK F
Sbjct: 301 NFDWSPFKIF 310

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 246/312 (78%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A L++ST+TL LN G+QIP VGLGTWQ+ D  DAY +V AAL  GYRHIDTAAIY+NE
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDN-DAYKSVLAALKDGYRHIDTAAIYRNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AIRDSGVPRE+IFVTTKLW  QHHEP  ALD+SL+RLGLDYVDLYLMHWPV LD 
Sbjct: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119

Query: 121 SYMKESP-LELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
            Y+K+   L +  + DG+R V+ T+W FI TWELMQ+LPK  K +++GVSNFS+NNLKDL
Sbjct: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +    + P  NQVE+HPLLPQ EL+D+C+   I +E YSPLGST APLL EP+++++A
Sbjct: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KKN VQPAHVV+SW  QR  +VLPKSV+ +RV AN K FTL +EDF+AI  IS+ +GE+R
Sbjct: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299

Query: 298 INNPNFEPFKTF 309
           + +PN+ PF+ F
Sbjct: 300 VVHPNWSPFEAF 311

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  410 bits (1053), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 245/312 (78%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A L +STK L LN G+QIP +GLGTWQ + E DAY AV  AL  GYRHIDTAAIY+NE
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQ-SKENDAYKAVLTALKDGYRHIDTAAIYRNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AI+DSGVPREEIFVTTKLW  QHHEPEVALD+SL+RLGLDYVDLYLMHWP  LD 
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119

Query: 121 SYMK-ESPLELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
           +Y+K E  L +  + DG+R V+ T+W FI TWELMQ+LPK  K +++GVSNFS+NNLKDL
Sbjct: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +    + P  NQVE+HPLLPQ EL+++C+   I VEAYSPLGST APLL EP+++++A
Sbjct: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KKN VQP HVV+SW VQR  +VLPKSV+ +R+  N K FTL  EDF+AI  IS+++GE+R
Sbjct: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299

Query: 298 INNPNFEPFKTF 309
           + +PN+ PF+ F
Sbjct: 300 VVHPNWSPFEVF 311

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 237/313 (75%), Gaps = 3/313 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSA L  +T  LKLN G+ I  +GLGTW++    DAY++V AAL AGYRHIDTAAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG AIR+SGVPR EIFVTTKLW  QH EPE+ALD+SL+RLGLDYVDLYLMHWPV +  
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 121 SYMKES-PLELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             M E   +     P+G R ++ TDW F+ TWELMQKLP+  K R+IGVSNFS+NNLKDL
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   +VP  NQVE+HPLLPQ ELVD+C    I +EAYSPLGS  AP+L EP++I++A
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KKNGV  A VV+SW VQR  IVLPKSV+ ER+ ANL TFTL  EDF+A+  IS+ +G +R
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 298 INNPNFEPFKTFV 310
           I +P++EPFK FV
Sbjct: 301 IIDPDWEPFKPFV 313

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  397 bits (1020), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 243/313 (77%), Gaps = 5/313 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSA+  NST T KLN G+ I  VGLGTWQ+T+E + Y AV AAL AGYRHIDTAAIY NE
Sbjct: 12  MSAS--NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNE 69

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AI DSGVPREEIFVTTKLW+ QHH+P   L++SL+RLGLDYVDLYLMHWPV+L+ 
Sbjct: 70  GQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNP 129

Query: 121 SYMKESP-LELMKRPDGTRPVETD-WTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             +K+   L +   PDG R VE D W ++ TWELMQ+LPK  K R++GVSNFS+NNLK +
Sbjct: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   VVP +NQVE+HPLLPQ EL+++C    I +EAYSPLGST+AP+L+EP++I++A
Sbjct: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK+GVQ A +V+SW VQR  IVLPKSVHAER+ AN KT  L +E+   I  IS+++GERR
Sbjct: 250 KKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERR 309

Query: 298 INNPNFEPFKTFV 310
           I  P++EPF  FV
Sbjct: 310 IVQPHWEPFVPFV 322

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  394 bits (1011), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 239/313 (76%), Gaps = 3/313 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M + LKNST T KLN G+ IP VGLGTWQ+T+E + Y AV  AL AGYRHIDTAAIYKNE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AI DSG+PREEIFVTTKLW  QH +PE AL++SL+RLGLDYVDLYLMHWPV+   
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 121 SYMKESPLELMKR-PDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             +K+     M   P+G R ++ T W F+ TWELMQ+LPK  K R++GVSNFS+NNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   +VP  NQVE HPLLPQ EL  +C++  I +EAYSPLGST+AP+L+EP +I++A
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK+ VQPA VV+SW VQ+  +VLPKSVH ER+ AN +TF L +++ D++  +S+++GERR
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 298 INNPNFEPFKTFV 310
           I  PN+ PF  FV
Sbjct: 301 IVQPNWAPFVPFV 313

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 231/310 (74%), Gaps = 3/310 (0%)

Query: 3   ANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ 62
           A L  +T TLKLN G+ IP++GLGTWQ++ E + YNA   AL AGYRHIDTAAIYKNE +
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSS-ENEGYNATLEALKAGYRHIDTAAIYKNEEE 60

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
           +G AIRDS +PR E+FVTTKLW  QH  P  ALD+SL+RLGLDYVDLYLMHWPV+L    
Sbjct: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120

Query: 123 MKESPL-ELMKRPDGTRPVE-TDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKA 180
           +K+  L ++ +R DG+R V+  DW F+ TWELMQ+LPK K R+IGVSNFS+NNLK+LL +
Sbjct: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNS 180

Query: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN 240
               VVP  NQ+E+HPLLPQ EL+++C++  I +EAYSPLGST AP+L E  + ++AKKN
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN 300
           GV    +V+SW  QR  +VLPKSV  ER+  N +TF L +EDF  +   +++ GERR+ +
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 301 PNFEPFKTFV 310
           PN+ PFK FV
Sbjct: 301 PNWGPFKPFV 310

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 230/309 (74%), Gaps = 4/309 (1%)

Query: 5   LKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           L NST  + LNDG+Q+P VGLGTWQ + E DAY AV AAL AGYRHIDTAAIY NE +VG
Sbjct: 3   LSNSTAKVTLNDGNQLPYVGLGTWQ-SKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124
            AI+DSGV R EIFVTTKLW  QH  P+ AL++SL+RLGLDYVDLYLMHWPV ++ +  K
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 125 E--SPLELMKRPDGTRPVE-TDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKAP 181
           +  + L++    DGTR ++   W FI TWELMQ LPK+KV+SIGVSNFS+NN+KDLL +P
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASP 181

Query: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNG 241
               VP +NQVELHPLLPQ+ELV++C+   I VEAYSPLGST AP+L    + +V+KK  
Sbjct: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241

Query: 242 VQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNP 301
           + PA+VV SW++QR I+VLPKSV   R+ +NL+T  LP E+F  +  IS + GE+R   P
Sbjct: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301

Query: 302 NFEPFKTFV 310
           N+ PF  FV
Sbjct: 302 NWTPFIPFV 310

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 177/312 (56%), Positives = 233/312 (74%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A LKNS+ TLKLN G+ IP++G GTW++ D    Y++V AAL AGYRHID AAIY NE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NSGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG+AI+DSGVPREEIF+TTKLW  +  +PE ALD+SL+RLGLDYVDLYLMHWPV L  
Sbjct: 60  EEVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             + +   L +    DGT  V+T +W F+ TW+LMQKLPK  K +++GVSNFS+NN+K+L
Sbjct: 120 DTITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKEL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           LK+P+  +VP  NQ+E+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 180 LKSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK+GV+PA +++SW +QR  +VL KSV+ ERV +N K FTLPE+DF  I  +S+  GE+R
Sbjct: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKR 299

Query: 298 INNPNFEPFKTF 309
           + N  +  F  F
Sbjct: 300 VVNMQWNSFPIF 311

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 232/312 (74%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A LKNS   + LN+G +IP VGLGTW+ + E D YN+V  AL AGYRHIDTAAIY+NE
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWK-SQENDGYNSVIYALKAGYRHIDTAAIYRNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG AI+DSGVPR++IF+TTKLW  +   P+ AL+ SL+RLGLDYVDLYLMHWPV L+ 
Sbjct: 60  GEVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNP 119

Query: 121 SYMKESPLELMKR-PDGTRPVETD-WTFINTWELMQKLPKNKV-RSIGVSNFSVNNLKDL 177
            Y+K+    ++ R PDGTR V+ + W +I TWEL+Q+LP   + RS+GVSNFS+NNL+ +
Sbjct: 120 RYIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKV 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   + P +NQVELHPLLPQ+EL  YC   KI++EAYSP GS +AP L +  ++D+A
Sbjct: 180 LSSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
            KNGV PA V+ SWIVQR+I+VLPKSVH ERV +N K F L +ED   I  +++  GE+R
Sbjct: 240 AKNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKR 299

Query: 298 INNPNFEPFKTF 309
           IN P+++PF  F
Sbjct: 300 INKPDWDPFPVF 311

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  365 bits (936), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 232/312 (74%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A L+NS+ TLKLN G+ IP +G GTW++ D  + Y++V AAL  GYRHID AAIY NE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG AI+DSG+ REEIF+TTKLW  +  +PE AL+ESL+RLGLDYVDLYLMHWPV L  
Sbjct: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             + +   L +    DGT  V+T +W FI TW+LMQ+LPK  K R++GVSNFS+NN+K+L
Sbjct: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           LK+P+  +VP  NQVE+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK+GV+P+ +++SW +QR  +VL KSV+ ERV +N K FTLPE+DF AIG +S+  GE+R
Sbjct: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299

Query: 298 INNPNFEPFKTF 309
           + N  +  F  F
Sbjct: 300 VVNMKWASFPIF 311

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  363 bits (933), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 175/313 (55%), Positives = 227/313 (72%), Gaps = 7/313 (2%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSA L N+T T+KLN G  IP VGLGTW+ + E D Y AV AAL AGYRHID AAIY NE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWR-SKEGDGYKAVTAALKAGYRHIDGAAIYLNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG+AIRDSG+PREE+F+TTKLWN Q   P+ AL++SL+RLGL+YVDLYLMHWPV L  
Sbjct: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKLPKNK-VRSIGVSNFSVNNLKD 176
             + +    L+  P   DG   V+T+W F+ TWELMQ+LPK K  RS+GVSNFS+NNLK+
Sbjct: 120 KRITDG--NLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKE 177

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDV 236
           LL +P   +VP + QVE+HPLLPQY L D+C+++ I+VEAYSPLG   AP+L +PI+  +
Sbjct: 178 LLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQI 237

Query: 237 AKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGER 296
           A ++     +VV+SW VQR I+ LPKS   ERV +NL+TF L +E+  +I  +S+ RG++
Sbjct: 238 ADRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQK 297

Query: 297 RINNPNFEPFKTF 309
           R N P+  PF  F
Sbjct: 298 RTNAPDMSPFPLF 310

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 225/309 (72%), Gaps = 4/309 (1%)

Query: 4   NLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQV 63
           +LKNST TLKLN G++IP+VGLGTW++    D Y++V AAL  GYRHID AAIY NE QV
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSA-ANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 64  GEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYM 123
           G AI+DSGVPR+EIF+TTKLW  +H  P  ALD SL+RLGLDYVDLYLMHWPV+L     
Sbjct: 61  GRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGS 120

Query: 124 KESPL-ELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLKA 180
           +E  L  + K+PDG   ++  DW FI TWELMQ+LPK  K ++IGVSNFS+NNLK L  +
Sbjct: 121 EEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNS 180

Query: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN 240
           P  N VP  NQVE+HPL PQ EL++YC+   I +EAYSP GS  AP+L EP +  +A+K 
Sbjct: 181 PKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKY 240

Query: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN 300
            +  A +++SW VQR  +VLPKSVHAER+ ANLK  TL +ED + I  +S+ +GE+R+  
Sbjct: 241 NISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQ 300

Query: 301 PNFEPFKTF 309
            ++ PF TF
Sbjct: 301 LDWSPFPTF 309

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 223/307 (72%), Gaps = 3/307 (0%)

Query: 5   LKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           L+NST TLKLN G  IP VGLGTW+ + E + Y AV  AL AGYRHID AA+Y NE +VG
Sbjct: 4   LQNSTSTLKLNTGQTIPQVGLGTWR-SKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62

Query: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124
           +AI+DSGVPR EIF+TTKLW  Q   P+ ALD+SLQRLGLDYVDLYL+HWPV L    +K
Sbjct: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122

Query: 125 ESPL-ELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDLLKAPT 182
           +  L +  ++PDG++ V+ +W FI TWELMQKL    K ++IGVSNFSVNNLKDLL APT
Sbjct: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182

Query: 183 TNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGV 242
           T V P +NQVELHPLLPQ +L+ + ++N I +EAYSPLG  +AP+LS+P V ++AK NGV
Sbjct: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242

Query: 243 QPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPN 302
           +  HVV+SW VQ+ ++ LPKSV   R+  NLK  TL + D   +  + + +GERR    +
Sbjct: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQD 302

Query: 303 FEPFKTF 309
           F PF  F
Sbjct: 303 FSPFPIF 309

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  361 bits (926), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 231/312 (74%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A LKNS+ TLKLN G+ IP++G GTW++ D  + Y++V AAL AGYRHID AAIY NE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG AI+DSGVPREEIF+TTKLW  +  +PE AL++SL+RLGLDYVDLYLMHWPV L  
Sbjct: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             + +   L +    DGT  ++T +W FI TWELMQ+LPK  K +++GVSNFS+NN+K+L
Sbjct: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L++P   VVP  NQ+E+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK+GV+PA +++SW +QR  +VL KSV+ ER+ +N K FTLPE+DF  I  +S+  G +R
Sbjct: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299

Query: 298 INNPNFEPFKTF 309
           + +  +  F  F
Sbjct: 300 VVDMKWGSFPIF 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 173/310 (55%), Positives = 229/310 (73%), Gaps = 5/310 (1%)

Query: 4   NLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQV 63
           +LKN    +KLN G+++P VGLGTWQ+  E DAY AV  AL  GYRHID AAIY NE +V
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSL-ENDAYKAVLTALKTGYRHIDGAAIYCNEGEV 60

Query: 64  GEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYM 123
           G+AIRDSGVPR EIFVTTKLW  Q   P++AL++SL+RLGLDYVDLYL+HWP+ L+ +  
Sbjct: 61  GKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQC 120

Query: 124 KESP--LELMKRPDGTRPVETD-WTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLK 179
           +ES   L     P+G R V+ D W F+ TWELMQ+LP   K +++GVSNFS+NN+K+LL 
Sbjct: 121 EESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLS 180

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
           +P   +VP +NQ+ELHPLLPQ ELV++C++  I VEAYSPLG T A +L EP+V ++AKK
Sbjct: 181 SPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKK 240

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRIN 299
             +  A++V+SW VQR ++VLPKSV   R+ +NL+T TL  ED + I  +S+++GE+R  
Sbjct: 241 YNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTC 300

Query: 300 NPNFEPFKTF 309
            P+F PF TF
Sbjct: 301 APDFSPFNTF 310

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 231/312 (74%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M A LKNS+ +LKLN G+ IP++G GTW++  E + Y++V AAL AGYRHID AAIY NE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG AI+DSGVPRE+IF+TTKLW  +  +PE AL+ESL+RLGLDYVDLYLMHWPV L  
Sbjct: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             + +   L +    DGT  V+T +W FI TW+LMQ+LPK  K +++GVSNFS+NN+K L
Sbjct: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L++P+  +VP  NQ+E+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK+GV PA +++SW +QR  +VL KSV+ ER+ +N K FTLPE+DF  I  +S+  GE+R
Sbjct: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299

Query: 298 INNPNFEPFKTF 309
           + +  +  F  F
Sbjct: 300 VVDMKWSSFPIF 311

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  352 bits (904), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 231/312 (74%), Gaps = 4/312 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MS  LKNS+ T+KLN G+ IP +GLGTW+++DE +AYN+V +A+  GYRHID+AAIY NE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDE-EAYNSVLSAIKLGYRHIDSAAIYGNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
             VG+AIRDSGVPR E+FVTTKLW  Q   PE ALD SL+RLGLDYVDLYL+HWP++   
Sbjct: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119

Query: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
             +K+   L +    DG   V+  DW F+ TWEL+Q+LP   K +++GVSNFSVNNLK+L
Sbjct: 120 DNIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   +VP  NQVELHPLLPQ EL+++ +   I +EAYSPLGS  +PLL EP++I+VA
Sbjct: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK GV+PA V+++W +QR  ++LPKSV+ +RV +N K F L +ED D I KIS+++G +R
Sbjct: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299

Query: 298 INNPNFEPFKTF 309
             +P++  F  F
Sbjct: 300 FVHPDWPSFPIF 311

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 174/311 (55%), Positives = 225/311 (72%), Gaps = 9/311 (2%)

Query: 8   STKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI 67
           S   LKL+ G+ IP +GLGTW++    DAY++V AAL  GYRHIDTAAIY NE QVG+AI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 68  RDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKE-- 125
           RDSGVPR EIFVT+KLW AQ H+P++AL+++L+RLGLDY+DLYLMHWPV+ +   +K+  
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 126 -SPLELMKRP---DGTRPVETD-WTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLK 179
            S    M  P   +G   VE D W FI TWELMQ LP++ K +++GVSNFS+NNL DLL 
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
           A TT VVP  NQ+ELHPLL Q EL+ YC++  I VEAYSP GS +AP+L +  +  +AKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 240 NGVQPAHVVLSWIVQR-NIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
             +Q   VV+SW +QR   +VLPKSVH ER+ AN K  TLP+EDF AI  + +++GE R+
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 299 NNPNFEPFKTF 309
            +P++ PF  F
Sbjct: 307 VDPDWSPFPLF 317

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  343 bits (880), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 218/311 (70%), Gaps = 3/311 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSA LKN T T+KLN G+ IP +GLGTW++ +  D Y++V AA   GYRHIDTAAIY NE
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRS-ENNDGYDSVIAAAKVGYRHIDTAAIYGNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AI + GV R E+FVTTKLW  Q  +PE AL++SL+RLGLDYVDLYL+HWPV+   
Sbjct: 60  DQVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKT 119

Query: 121 SYMKESPLELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLL 178
             +K+  L  + + DG   ++  +W FI TWELMQ L K  K ++IG+SNFS+NN+K+LL
Sbjct: 120 DTIKDGNLLTIPKKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
            APTT V P  NQVE+HPLLPQ EL+ +C++  I +EAYSPLG  +AP+L +  +I++AK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
           +N V    VV SW VQR  +VLPKSV   R+ +NLKTFTL ++D   I  + + +GE R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 299 NNPNFEPFKTF 309
            +   + F  F
Sbjct: 300 CDLGIKGFPMF 310

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 167/311 (53%), Positives = 226/311 (72%), Gaps = 3/311 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M+  LKN T+T+ LN+G++IP++GLGT+  + + + Y AV  A  AGYRH+DTAA YKNE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTY-LSKQNEVYEAVVTAAKAGYRHVDTAAFYKNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+A++D GVPR E++VTTK+W  +  +PE ALD+SL+RLGL+Y+DLYLMHWPV+L  
Sbjct: 60  EQVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKT 119

Query: 121 SYMKESPLELMKR-PDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLL 178
             +K+  L  + R PDG   V+ DWTF+  WE MQKL K+ KV+SIGVSNFS+NN+K+LL
Sbjct: 120 DTIKDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
            APTT VVP +NQVE+ PLLP  EL+++C+   I  +AY P G + APL+ +  V+++AK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
            NGV    V+ SW VQR  +VLPKSV   R+ +NLKTFTL + D   +  IS+ +GE+R+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 299 NNPNFEPFKTF 309
           NN NF PF  F
Sbjct: 300 NNVNFSPFPIF 310

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  336 bits (861), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 220/309 (71%), Gaps = 3/309 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M+  LK  T T KLN G+QIP++GLGTW++T E + YNA  AA+ AGYRHID AA+  NE
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKE-NGYNATLAAIKAGYRHIDIAAVCMNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
             VG AIRDSGVPREE+FVTTKLW  QH +P+ AL +SL+RLGLDYVDLY+MHWPV+   
Sbjct: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119

Query: 121 SYMKESPLELM-KRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLL 178
             +K +   L+ KR DG   V+  W ++ TWELMQ+LP   K  ++GV+NFSV+ LK L+
Sbjct: 120 EQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
            +P   +VP  +Q+E HP LPQ +++ +C++N I +EAYSPLGS  APLL EP+V +++K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
           K  V+PA +++SW +QR   VL KS    R+ ANL TF +PE D   I +++Q+RG +RI
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 299 NNPNFEPFK 307
           +NP +  F+
Sbjct: 300 HNPTWFSFE 308

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  335 bits (860), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 160/311 (51%), Positives = 215/311 (69%), Gaps = 3/311 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MS   KN   T  +   ++IP V LGTW+A    + Y AV  AL AGYRHID AAIY NE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAA-PNEVYTAVLEALKAGYRHIDGAAIYCNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            +VG+AIRDSG+PR++IFVTTKLW  +   P  ALD SL+RLGLDYVDLYLMHWPV+L  
Sbjct: 60  EEVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKA 119

Query: 121 SYMKESPL-ELMKRPDGTRPVETD-WTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLL 178
             + ++ L  + K P G   ++ + W FI TWELMQ+LP +K ++IGVSNFS+NNL +LL
Sbjct: 120 DSITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELPTSKAKAIGVSNFSINNLNELL 179

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
            APTT  +P  NQ E+HPLLPQ EL+ YCQ  KI VEAY PLG ++ PL++ P++ ++A 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
           K GV    +++SW +QR  +VLPKSV  ER+  N +T T+P E+F+ +  ++++ G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 299 NNPNFEPFKTF 309
            N +F PF T+
Sbjct: 300 VNIDFSPFPTY 310

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  335 bits (859), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 220/304 (72%), Gaps = 3/304 (0%)

Query: 5   LKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           LKN+T   KLN G+ IP++G GTW++T+E + YNAV +A+  GYRHID+AA+Y NE  VG
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEE-EGYNAVLSAIKDGYRHIDSAAVYGNEAAVG 62

Query: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124
            AIRDSGVPREE+FVTTKLWN Q  EP  ALD+SLQRLGLDYVDLYL+HWP+ +    + 
Sbjct: 63  RAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRIT 122

Query: 125 ESPL-ELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLKAPT 182
           +  L  +  + DG   V+T+W +I TW+LMQ+LP   K R++GVSN SV+ L+ LL    
Sbjct: 123 DGNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKG 182

Query: 183 TNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGV 242
             VVP + QVE HPLLPQ +L+D+C ++ I +EAYSPLGS  +PL+ EP++ ++AKK   
Sbjct: 183 NKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNA 242

Query: 243 QPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPN 302
            PA +++SW ++R  +VLPKSV   R+ +NL+T  L +EDF+ I K+  ++GE+R+N+P 
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPE 302

Query: 303 FEPF 306
           +  F
Sbjct: 303 WFTF 306

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  335 bits (859), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/306 (53%), Positives = 216/306 (70%), Gaps = 4/306 (1%)

Query: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66
           N + +LKLN G+ IP+VGLGTW++ +E DAYNAV +AL  GYRHIDTAAIY NE  VG+ 
Sbjct: 5   NESPSLKLNTGASIPVVGLGTWKSPEE-DAYNAVVSALQNGYRHIDTAAIYGNEEAVGKG 63

Query: 67  IRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES 126
           IRDSGVPREEIFVTTKLW  Q  +PE ALD SLQRLGLDYVDLYL+HWPV L+ S + + 
Sbjct: 64  IRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDG 123

Query: 127 P-LELMKRPDGTRPVETD-WTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLKAPTT 183
             L   +  DG   ++ + W FI TWE MQ LPK+ K ++IGVSNFS+ N++ LL A   
Sbjct: 124 NYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPD 183

Query: 184 NVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGVQ 243
            +VP  NQ+E+HP LPQ EL+DYC+   I +EAYSPLGS+S+ +L++P +  +A K   +
Sbjct: 184 FIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAE 243

Query: 244 PAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPNF 303
           PA++++SW   R  +VLPKSV+ +R+  NLK   L  ED + I K+++  G +R   P+F
Sbjct: 244 PANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDF 303

Query: 304 EPFKTF 309
            PF  F
Sbjct: 304 SPFAIF 309

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  334 bits (857), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/302 (52%), Positives = 216/302 (71%), Gaps = 3/302 (0%)

Query: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66
           NS+   KL  G+ IP++G GTW++T+E D YNAV  AL  GYRHIDTAA+Y NE  VG A
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEE-DGYNAVLTALKVGYRHIDTAAVYGNEAAVGRA 64

Query: 67  IRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES 126
           IRDSGVPR+++FVTTKLWN QH +P +ALD+SLQRLGLDYVDLYL+HWP+ L    + + 
Sbjct: 65  IRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDG 124

Query: 127 PL-ELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLKAPTTN 184
            L  +  + DG   V+  W+++ TWE+MQ LP  +K R++GVSNFSV  L++LL A  T 
Sbjct: 125 NLFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 185 VVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGVQP 244
           V+P +NQVE HPLLPQ +L  +C +N I +EAYSPLGS  +PL+ EP V ++A K+   P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 245 AHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPNFE 304
           A V++SW ++R  ++LPKSV   R+ +N K   L ++DF  I  I +++GE+RIN+P++ 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 305 PF 306
            F
Sbjct: 305 HF 306

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  333 bits (855), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 231/312 (74%), Gaps = 3/312 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M+  LK ST TLKLN G+ IP + LGTW++    D Y++V AAL AGYRHIDTAAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
            QVG+AIRDSG+PREEIFVT+KLWN Q H P  AL ++L RLGLDY+DLYLMHWPV+ + 
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 121 SYMKESPLELMKRPDGTRP-VETD-WTFINTWELMQKLPKNKV-RSIGVSNFSVNNLKDL 177
             +K +   ++ + +  +P +E D W F+ TWELMQ+LP   + +++GVSNFS+NNLK+L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
           L +P   + P  NQ+E+HPLLP+++L+ +C++  I +EAYSPLGS +AP+L EP +I+++
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
           KK  V PA +++SW VQR  +VL KS H ER+ AN K FTL +EDF+AI  +++++G  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 298 INNPNFEPFKTF 309
           + +P++ PF  F
Sbjct: 301 VVDPDWSPFPLF 312

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  328 bits (840), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 221/305 (72%), Gaps = 4/305 (1%)

Query: 8   STKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI 67
           +T  L++N G  IP++GLGTW+A D  D Y AV AAL++GYRHIDTAAIY+NE  VG AI
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADG-DTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI 60

Query: 68  RDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES- 126
           RDSGVPRE+IFVTTKLW  Q  +P+ AL+ SL+RLGLDYVDLYLMH+PV+L    +K+  
Sbjct: 61  RDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN 120

Query: 127 PLELMKRPDGTRPVETD-WTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLKAPTTN 184
            L +  R DG R V+ D W+F+ TW+LMQ LPK+ K ++IGVSNFS+ N++++LK     
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 185 VVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGVQP 244
            VP  NQ+E+HP LPQ EL++YC+   I VEAYSPLGS+ + +L++P +I +A+K+ V+P
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 245 AHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPNFE 304
           A +++SW V R   +LPKSV+++RV +NLK   L   D   I KI ++ G +R  +P++ 
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 305 PFKTF 309
           PF  +
Sbjct: 301 PFPMY 305

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  328 bits (840), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 221/305 (72%), Gaps = 4/305 (1%)

Query: 8   STKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI 67
           +T  L++N G  IP++GLGTW+A D  D Y AV AAL++GYRHIDTAAIY+NE  VG AI
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADG-DTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI 60

Query: 68  RDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES- 126
           RDSGVPRE+IFVTTKLW  Q  +P+ AL+ SL+RLGLDYVDLYLMH+PV+L    +K+  
Sbjct: 61  RDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN 120

Query: 127 PLELMKRPDGTRPVETD-WTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLKAPTTN 184
            L +  R DG R V+ D W+F+ TW+LMQ LPK+ K ++IGVSNFS+ N++++LK     
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 185 VVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGVQP 244
            VP  NQ+E+HP LPQ EL++YC+   I VEAYSPLGS+ + +L++P +I +A+K+ V+P
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 245 AHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPNFE 304
           A +++SW V R   +LPKSV+++RV +NLK   L   D   I KI ++ G +R  +P++ 
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 305 PFKTF 309
           PF  +
Sbjct: 301 PFPMY 305

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  327 bits (839), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 217/308 (70%), Gaps = 2/308 (0%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           M+  LK  T T  LN G++IP++GLGTW+ T E   Y A+ AAL AGYRHID+AA+  NE
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKE-GGYKAILAALKAGYRHIDSAAVCMNE 59

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
             +G+AIRDSGV R+E+FVTTKLW+ QH +P  ALD+SL+RLGL+YVDLY+MHWP++   
Sbjct: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119

Query: 121 SYMKESPLELMKRPDGTRP-VETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLK 179
             +K     L+ R    +P V+TDW ++ TWELMQKLP  K R+IGV+NFSV  L  LLK
Sbjct: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLK 179

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
           +P   ++P  +Q+E HP LP  E++ +C++  I +EAYSPLG    PL+ EP++ +++KK
Sbjct: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRIN 299
             V+PA +++SW ++R   VLPKS    R+ +NL+ F L +ED++ I +I+Q+RG +R +
Sbjct: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299

Query: 300 NPNFEPFK 307
           NP +  F+
Sbjct: 300 NPPWFSFE 307

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  320 bits (820), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 211/303 (69%), Gaps = 8/303 (2%)

Query: 11  TLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRDS 70
           +LKLN G+ IP +G GTW ++   DAY AV  AL  GYRHID AA+Y NE  VG+ IRDS
Sbjct: 10  SLKLNTGASIPQLGFGTWPSS-HADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDS 68

Query: 71  GVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESPLEL 130
           G+PREEIFVTTKLWN Q  +P  ALDESL+RLGLDYVDL+L+HWPV L        P  L
Sbjct: 69  GIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPV---GGPENL 125

Query: 131 MKRPD-GTRP-VET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLKAPTTNVV 186
           +K P  G +P ++T DW+FI TWELMQ LPK  K R++GVSNFS+ NL+DLL +    +V
Sbjct: 126 LKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLV 185

Query: 187 PTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGVQPAH 246
           P +NQ E+HP LPQ EL++YC+   I VEAY PLGS+S+ +LS+P + ++A K  V+PA+
Sbjct: 186 PAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPAN 245

Query: 247 VVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPNFEPF 306
           V+++W + R   VLPKS    R+A+N     L  ED + I K+S+  G +R  +P+FEP+
Sbjct: 246 VLINWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPY 305

Query: 307 KTF 309
             F
Sbjct: 306 PLF 308

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  317 bits (813), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 220/311 (70%), Gaps = 7/311 (2%)

Query: 3   ANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ 62
           A LK ST T+ LN G++IP+ GLGTWQ+TD+  + +AV AAL  GY+HIDTA+ YKNE  
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDAS-SAVAAALKHGYKHIDTASFYKNEEL 63

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
           VG+A+++SG+PREE+F+TTK+WN Q  +P  ALD SL++LG +YVDL LMHWPV   +  
Sbjct: 64  VGKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEP- 122

Query: 123 MKESPLELMK---RPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDLL 178
            + S L+  K    PDG    + +W F+ TW LMQKL    KV++IGVSNFS+NNL++LL
Sbjct: 123 -ENSTLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELL 181

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
            A  T VVP +NQVELH  LPQ ELV+YCQ+  I VEAYSPLGS+SAPLL +  V  VA+
Sbjct: 182 NAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAE 241

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
           K GV PAHV+L+++  R I+VLPKSV   R+ +N + F + EED   +  I ++ G +R 
Sbjct: 242 KYGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRF 301

Query: 299 NNPNFEPFKTF 309
            +P+F PF  F
Sbjct: 302 VDPDFSPFPLF 312

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  311 bits (797), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/309 (50%), Positives = 211/309 (68%), Gaps = 5/309 (1%)

Query: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60
           MSA  K ST   KLN G+ IP+VGLGT+ + DE   Y AV  A+  GYRHID AA+YKNE
Sbjct: 1   MSAP-KPSTSVGKLNTGASIPLVGLGTYLSEDET-GYKAVLHAIKVGYRHIDCAALYKNE 58

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
             VG AIRDSGVPREE+FVTTK+WN QH EP  AL+ESL RLGLDYVDL+LMHWP +L  
Sbjct: 59  DFVGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRT 118

Query: 121 SYMKESPL-ELMKRPDGTRPVETDWTFINTWELMQKLP-KNKVRSIGVSNFSVNNLKDLL 178
             + +  +  + KR D    V+T+W +I TW LMQ LP   K +++GVSNFSV  L+ LL
Sbjct: 119 ERITDGNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLL 178

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
             P + VVP  NQVE+HPLLPQ  L D+C++  I + AYSPLGS  APLL +P+++++A 
Sbjct: 179 ADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAA 238

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
           K+   PA +++ W V+R  + LPKSV   R+ +NL+   L + + + I +I  ++GE+R+
Sbjct: 239 KHKADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEI-HKKGEKRV 297

Query: 299 NNPNFEPFK 307
            +P +  F+
Sbjct: 298 VDPEWFDFE 306

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  308 bits (790), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 216/309 (69%), Gaps = 7/309 (2%)

Query: 7   NSTKT--LKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
            STKT   KLN G+ +P +GLGTW++++E DAY AV +AL AGY+HIDTAAIY+NE  VG
Sbjct: 4   TSTKTPSFKLNTGALLPAIGLGTWKSSEE-DAYTAVLSALKAGYKHIDTAAIYRNERAVG 62

Query: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124
           +AIRDSG+PR+E+F+TTKLW+ QH +P+ ALD SL+RLGLDYVDLYL+H+PV+     ++
Sbjct: 63  KAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIE 122

Query: 125 ES-PLELMKRPDGTRPVE-TDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLKAP 181
           +  P      P+G R V+  DW F+ TW L+Q LP++ K +++GVSNFS+NNLK LL++ 
Sbjct: 123 DGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESD 182

Query: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK-N 240
               VP +NQVE+HP LPQ EL+D+C+   I VEAYSPLGST + +L++  +  +A+K  
Sbjct: 183 EKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXX 242

Query: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN 300
             QPA ++++W + R   VLPKSV  +R+ AN +   + +ED   +  +    G +R   
Sbjct: 243 DAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLE 302

Query: 301 PNFEPFKTF 309
           P++ PF  F
Sbjct: 303 PDWSPFPIF 311

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  213 bits (543), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 120/298 (40%), Positives = 182/298 (61%), Gaps = 12/298 (4%)

Query: 12  LKLNDGSQIPIVGLGTWQATDER-DAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD- 69
             LN+G++IP +GLGT    D   +   AV+AA+ AGYRHIDTA  YK E  +G+A+++ 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 70  ---SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES 126
              + + REE+F+TTK+W    + P  ++D+SL+ LG+DYVDL L HWPV   K    + 
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 127 PL-ELMKRPDGTRPVETDWTFINTWELMQKL---PK-NKVRSIGVSNFSVNNLKDLLKAP 181
            +  L +  DG    E D  ++ T++ ++K+   PK N+VR+IGVSN+ +  L+ L K  
Sbjct: 131 NIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFKE- 189

Query: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNG 241
              V P INQVE+HP LPQ EL  +C  + I + AYSPLGS  AP L    V D+AKK  
Sbjct: 190 -CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKKYK 248

Query: 242 VQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRIN 299
           V+PA ++ S+ + +  +VLP+S++ +R+AAN+    L ++D   + ++      R I+
Sbjct: 249 VEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVGIDEPNRFID 306

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  213 bits (542), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 121/306 (39%), Positives = 184/306 (60%), Gaps = 16/306 (5%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDER-DAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           +N+     LN+G +IP +GLGT        +   AV+AA+ AGYR IDTA  YK E  +G
Sbjct: 5   RNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIG 64

Query: 65  EAI----RDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EA+    RD  + RE++F+TTK+W     +P  +++ESL+ LG+DYVD+ L HWP+   K
Sbjct: 65  EALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKK 124

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL---PKN-KVRSIGVSNFSVNN 173
           +Y +     ++ +P   DG         +I T++LM+K+   PK+ +VR+IGVSN+ +  
Sbjct: 125 TYDENG--TIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEY 182

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+ ++K     V P INQVELHP LPQ EL D+C +N I + AYSPLGS  AP    P+V
Sbjct: 183 LERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLV 240

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
            + AKK+ V PA ++ S+ V++  +V+P+S++ ERVA+N+    L + +  ++       
Sbjct: 241 QEYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFGVNT 300

Query: 294 GERRIN 299
             R I 
Sbjct: 301 PHRYIG 306

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  209 bits (532), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 187/302 (61%), Gaps = 20/302 (6%)

Query: 14  LNDGSQIPIVGLGTWQATDER--DAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD-- 69
            N+G+++P  GLGT  A  ER  +   AV+AA+ AGYRHIDTA  Y  E  VGEA+++  
Sbjct: 13  FNNGNKVPAFGLGT-AAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELF 71

Query: 70  --SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESP 127
               V RE++ +T+K+W+   ++ + +L+ESL RL +DYVDL+L HWP+   K       
Sbjct: 72  EERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHGV 131

Query: 128 LELMKRP--DGTRPV---ETDWTFINTWELMQK--LPKN--KVRSIGVSNFSVNNLKDLL 178
            ++ K P  D   P+   + DW  I T++ ++K  L KN  +VR+IGVSNF +  LK +L
Sbjct: 132 DKIAKEPVDDQGNPLYDEKGDW--IETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVL 189

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
           K   T  VP  NQVELHP LPQ EL ++C ++KI V AYSPLG   APLL  PI+  + +
Sbjct: 190 KECRT--VPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCE 247

Query: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298
           K    P  ++ S+ +++  IV+P+S+++ R+A+NL+   L EED + + +  Q+  +R I
Sbjct: 248 KYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKRYI 307

Query: 299 NN 300
           N 
Sbjct: 308 NG 309

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  207 bits (527), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/308 (38%), Positives = 190/308 (61%), Gaps = 15/308 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDER-DAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K++    KLN+G  +P +GLGT    +   +   AV+AA+ AGYRHIDTA  Y  E  +G
Sbjct: 5   KSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIG 64

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           +A+++      V R ++F+T+K+W     + +++L+ESL+ LGLDYVDLYL HWP+   K
Sbjct: 65  DALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQK 124

Query: 121 -SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL---PK-NKVRSIGVSNFSVN 172
               K+    L  +P   DG   +     +++T++ M+K+   PK N+VR+IGVSN+ V 
Sbjct: 125 IEDSKDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVE 184

Query: 173 NLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPI 232
            L  LLK  T  V P +NQVE+HP LPQ+EL ++C+ + I++ AYSPLGS+ APLL  P+
Sbjct: 185 YLDRLLKVCT--VKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPL 242

Query: 233 VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQ 292
           V ++++K  V    V++S+ +++   V+P+S++  R+A  +   TL E + D +  I ++
Sbjct: 243 VKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRK 302

Query: 293 RGERRINN 300
              R I+ 
Sbjct: 303 DSIRYIDG 310

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  206 bits (523), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 185/298 (62%), Gaps = 12/298 (4%)

Query: 12  LKLNDGSQIPIVGLGTWQATDER-DAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD- 69
             LN G++IP +GLGT    ++     +AV+ A+  GYR IDTA +Y +E  +GEA+++ 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 70  ---SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES 126
                V RE++F+TTK+W   ++  E +L ESL++L LDYVDL L HWP+   K Y +  
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 127 PLEL--MKRPDGTRPVETDWTFINTWELMQKLPKN---KVRSIGVSNFSVNNLKDLLKAP 181
            L+   +    G   ++    ++ TW+ ++K+ K+   +VR+IGVSN+ V  L+ LLK  
Sbjct: 131 KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE- 189

Query: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNG 241
            T VVP +NQVELHPLLPQ EL +YC  + I +E++SPLGS+  P L  P+V +++KK  
Sbjct: 190 -TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 242 VQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRIN 299
            +P  V+L++ V++  +V+P+S++  R+  N     L EED D +  + +++  R ++
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREKPVRVMD 306

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  204 bits (519), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 185/307 (60%), Gaps = 13/307 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           KN+     LN+G ++P +GLGT    ++      AV+AA+ +GYRHIDTA  Y+ E +VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EA+++      V RE+IFVTTK+W       + ++  SL+ LGLD+VDL L HWP+  ++
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKLPKNK---VRSIGVSNFSVNNL 174
               +    + + P   DG+        ++ T++ ++KL   K    R+IGVSN+ V  L
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYL 184

Query: 175 KDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVI 234
           + LLK     VVP INQVE HP LPQ EL D+C ++ I +EAYSPLG+T+APL+   +V 
Sbjct: 185 ERLLK--ECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVK 242

Query: 235 DVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRG 294
            +A K      +V++++ +++ ++ +P+SV+ + +A+N++   L +ED D + K   +  
Sbjct: 243 KIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVENT 302

Query: 295 ERRINNP 301
           +R ++ P
Sbjct: 303 KRIVDEP 309

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  202 bits (514), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 108/305 (35%), Positives = 185/305 (60%), Gaps = 13/305 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           KN+     LN+G ++P +GLGT    ++      AV+AA+ +GYRHIDTA  Y+ E ++G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EA+++      + RE+IF+TTK+W       + ++  SL+ LG+DYVDL L HWP+  ++
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNR 124

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKLPKNK---VRSIGVSNFSVNNL 174
               E    + + P   DG+        ++ T++ ++K+  +K    RSIGVSN+ V  L
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYL 184

Query: 175 KDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVI 234
           + LLK     VVP +NQVE+HP LPQ EL D+C ++ I +EA+SP G+T +P++   +V 
Sbjct: 185 ERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQ 242

Query: 235 DVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRG 294
            VA+K    P  V++++ +++ ++ +P+SV+ + +A+N++   L +ED D + K   +  
Sbjct: 243 KVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVENP 302

Query: 295 ERRIN 299
           +R ++
Sbjct: 303 KRLVD 307

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  199 bits (506), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 180/305 (59%), Gaps = 24/305 (7%)

Query: 12  LKLNDGSQIPIVGLGT------WQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGE 65
             LN+G++IP VGLGT      W  T E     AV+AA+ AG+R IDTA  Y  E  +GE
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKE-----AVKAAVKAGFRQIDTAWAYGTEEYIGE 65

Query: 66  AIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKS 121
           A+++      V RE++F+TTK+W     + E +L+ESL+RL LDYVDL L HWP    K 
Sbjct: 66  ALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKK 125

Query: 122 YMKESPLELMKRP---DGTRPVETDWTFINTWELMQK--LPKN--KVRSIGVSNFSVNNL 174
              E   +L+  P   DG+   +T   ++ T++ ++   L +N  +VR+IGVSN+ +  L
Sbjct: 126 QDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYL 185

Query: 175 KDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVI 234
           + L K   T  VP INQVELHP LPQ EL DYC ++ I + +YSPLGS  AP L  P+V 
Sbjct: 186 ERLFKECKT--VPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQ 243

Query: 235 DVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRG 294
           ++A K       V++S+ +++  IV+P+S++ ER++  L    L +E+ D + +   +  
Sbjct: 244 ELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEHE 303

Query: 295 ERRIN 299
            R I+
Sbjct: 304 YRYID 308

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  197 bits (501), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 185/308 (60%), Gaps = 14/308 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K +     LN+G +IP +GLGT    ++  +   AV+AA+ AGYRHIDTA  Y+ E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 65  EAIR----DSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI+    D  + RE++F+TTK+W     E + +L+ESL+ LGL+YVDL L HWP+  +K
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEK 138

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL----PKNKVRSIGVSNFSVNN 173
               +    L+K P    G      D  ++ T++ ++K+      ++VR+IGVSNFS+  
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+ L+K     V PT+NQVE HP LPQ EL  +C  + I + AYSPLGS  AP L  P+V
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
             +A+K  V    +++S+ +++  IV+P+S++  R++++++  +L +++   +    ++ 
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGEKY 316

Query: 294 GERRINNP 301
             R I+ P
Sbjct: 317 PVRFIDEP 324

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  196 bits (498), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 185/308 (60%), Gaps = 14/308 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K +     LN+G +IP +GLGT    ++  +   AV+AA+ AGYRHIDTA  Y+ E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVG 78

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI++      + RE++F+TTK+W     E + +L+ESL+ LGLDYVDL L HWP+  +K
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEK 138

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL----PKNKVRSIGVSNFSVNN 173
               +    L+K P    G     ++  ++ T++ ++K+      ++VR+IGVSNFS+  
Sbjct: 139 VKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEY 198

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+ L+K     V PT+NQVE HP LPQ EL  +C  + I + AYSPLGS  AP L  P+V
Sbjct: 199 LERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLV 256

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
             + +K  V    +++S+ +++  IV+P+S++  R+++N++   L +++   + +  ++ 
Sbjct: 257 KKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKY 316

Query: 294 GERRINNP 301
             R I+ P
Sbjct: 317 PVRFIDEP 324

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  196 bits (497), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 185/308 (60%), Gaps = 14/308 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K +     LN+G ++P +GLGT    ++  +   AV+AA+ AGYRHIDTA  Y+ E  VG
Sbjct: 19  KTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI++      + RE++F+TTK+W     E E +L ESL+ +GLDYVDL+L HWP+  +K
Sbjct: 79  EAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEK 138

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL----PKNKVRSIGVSNFSVNN 173
               +    L+K P    G   + ++  ++ T++ ++K+      ++VR+IGVSNFS+  
Sbjct: 139 VKDPKGISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+ L+K     V PT+NQVE HP LPQ EL  +C  + I + AYSPLGS  AP L  P+V
Sbjct: 199 LERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
             + +K  V    V++S+ +++  IV+P+S++  R++++++   L +++   +    ++ 
Sbjct: 257 KKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGEKY 316

Query: 294 GERRINNP 301
             R I+ P
Sbjct: 317 PVRFIDEP 324

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  195 bits (496), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 184/306 (60%), Gaps = 14/306 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K +  +  LN+G ++P +GLGT     E      AV+AA+ AGYRHIDTA  Y +E  VG
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI++      + RE+IF+T+K+W     + E +L+ESL+ LG+DY+DL+L HWP+   K
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVK 127

Query: 121 SYMKESPLELMKRPD---GTRPVETDWTFINTWELMQKL----PKNKVRSIGVSNFSVNN 173
                    L + P+   G    E D  ++ T+  M+K+      N+VRSIGVSNF V  
Sbjct: 128 QEDTHGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQY 187

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+  L      V P +NQVE+HP LPQ+EL  +C+ + I +EAYSPLGS +AP +   +V
Sbjct: 188 LERTLF--ECAVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLV 245

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
            D+A+K  + P+ ++ S+ +++   V+ +SV+  R+A+N++   L EE+ D + ++   +
Sbjct: 246 QDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK 305

Query: 294 GERRIN 299
            +R +N
Sbjct: 306 PKRFVN 311

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  195 bits (496), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 185/316 (58%), Gaps = 14/316 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K +     LN+G +IP +GLGT    ++  +   AV+AA+ AGYRHIDTA  Y+ E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI++      + RE++F+TTK+W     E + +L+ESL+ LGLDYVDL L HWP+   K
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGK 138

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL----PKNKVRSIGVSNFSVNN 173
               E     MK P    G     ++  ++ T++ ++K+      ++VR+IGVSNFS+  
Sbjct: 139 VKDPEGISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEY 198

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+ L+K     V PT+NQVE HP LPQ EL  +C  + I + AYSPLGS  AP L  P+V
Sbjct: 199 LERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLV 256

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
             + +K  V    +++S+ +++  IV+P+S++  R+++N++   L +++   + +  ++ 
Sbjct: 257 KKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKY 316

Query: 294 GERRINNPNFEPFKTF 309
             R ++ P+      F
Sbjct: 317 PVRFMDVPSVAILPGF 332

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  192 bits (489), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 180/285 (63%), Gaps = 14/285 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K++  +  LN+G ++P +GLGT    ++  +   AV+AA+ AGYR+IDTA  Y +E  VG
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVG 64

Query: 65  EAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI++      + RE++F+T+K+W     + E +L ESL+ LG+DY+DL+L HWP+  ++
Sbjct: 65  EAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNR 124

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL---PK-NKVRSIGVSNFSVNN 173
                    L + P   DG+        +++T++ M+++   PK N+VR+IGVSNF V  
Sbjct: 125 REDPHGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEY 184

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           LK +LK     V P +NQVE+HP LPQ+EL ++C  N I++ AYSPLGS  AP++  P++
Sbjct: 185 LKRVLK--ECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLI 242

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTL 278
            ++++K       ++ S+ +++   V+P+S+++ R+A+N++   L
Sbjct: 243 KEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPL 287

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  193 bits (490), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 184/308 (59%), Gaps = 14/308 (4%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDE-RDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64
           K +     LN+G +IP +GLGT    ++  +   AV+AA+ AGYRHIDTA  Y+ E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 65  EAIR----DSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           EAI+    D  + RE++F+TTK+W     E + +L+ESL+ LGLDYVDL+L HWP+  +K
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK 138

Query: 121 SYMKESPLELMKRP---DGTRPVETDWTFINTWELMQKL----PKNKVRSIGVSNFSVNN 173
               +    L+K P    G     ++  ++ T++ ++K+      +++R+IGVSNFS+  
Sbjct: 139 VKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEY 198

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L+ L+K     V PT+NQVE HP LPQ  +  +C  + I + AYSPLGS  AP L  P+V
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQR 293
             + +K  +    V++S+ +++  IV+P+S++  R++++++   L +++   +    ++ 
Sbjct: 257 KKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFGEKY 316

Query: 294 GERRINNP 301
             R I+ P
Sbjct: 317 PVRFIDEP 324

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  186 bits (473), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 185/308 (60%), Gaps = 17/308 (5%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDER--DAYNAVRAALDAGYRHIDTAAIYKNEVQV 63
           K++    KLN+G+ IP +G GT+ A  ER  +   AV+AA+ AGYRHIDTA +Y++E  V
Sbjct: 5   KSTEIYFKLNNGTTIPALGFGTY-APRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYV 63

Query: 64  GEAIRD----SGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLD 119
           GEAI++      V R ++FVTTK+W       E +L+ESL+ LGLDYVDL L HWP+   
Sbjct: 64  GEAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFP 123

Query: 120 KSYMKESPLE-LMKRP--DGTRPVETD-WTFINTWELMQKLPKN----KVRSIGVSNFSV 171
           +   +++ +  L+  P  D  +P+  +   F+ T+  ++K+  N    +VR+IGVSN+++
Sbjct: 124 RVEDEKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAI 183

Query: 172 NNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEP 231
             L+ L K     V P +NQVE+HP LPQ EL  +C  + I + AYSPLGS  AP L  P
Sbjct: 184 EYLEALFK--ECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIP 241

Query: 232 IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQ 291
           +V  +A+K  +    +++S+ +++   V+P+S++  R+A+ ++     +E+   +  +  
Sbjct: 242 LVHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGI 301

Query: 292 QRGERRIN 299
           +   R ++
Sbjct: 302 EEPARFVD 309

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  178 bits (451), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 177/318 (55%), Gaps = 32/318 (10%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR- 68
           K L LN+G ++P VGLG W+  ++  A + V  A+ AGYR  D A  Y NEV+VG+ ++ 
Sbjct: 3   KLLTLNNGMKMPQVGLGCWKIPNDICA-DQVYEAIKAGYRLFDGATDYANEVEVGKGLKR 61

Query: 69  ---DSGVPREEIFVTTKLWNAQHHEPEVALD--ESLQRLGLDYVDLYLMHWPVSLDKSYM 123
              D  V R+++FV +KLWN  HH   V L+   +L+ LGLDY+DLY +H+P++     M
Sbjct: 62  AMDDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPM 121

Query: 124 KES--PLELMKRPDGTRPV--ETDWTFINTWELMQKLPKNK-VRSIGVSNFSVNNLKDLL 178
           +E   P     + D  + +  E +   ++T+  +++  +   ++SIG+SNF+   + D+L
Sbjct: 122 EERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL 181

Query: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS------------AP 226
           +    ++ P   Q+E HP L Q +L++YC+ + ++V  YS  G  S             P
Sbjct: 182 RG--CSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPP 239

Query: 227 LLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLK---TFTLPEEDF 283
           L   P++  +A+K+ V  A V+L W  QR + ++PKS H +R+ +NL      TL EED 
Sbjct: 240 LFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 284 DAIGKISQQRGERRINNP 301
            +I  ++Q     R N+P
Sbjct: 300 KSISGLNQN---LRFNDP 314

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  177 bits (450), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 167/309 (54%), Gaps = 29/309 (9%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG---- 64
           T+T  LN+G ++P+VGLG W+ + +  A   V  A+  GYR  D A  Y NE ++G    
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAA-TQVYEAIKLGYRLFDGALCYGNEKEIGVGIK 62

Query: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
           +AI +  V RE++F+ +KLW   HH   V  AL  +L  LGLDYVDLY +H+P+ +    
Sbjct: 63  QAINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVP 122

Query: 123 MKES-PLELMKRPDGTR---PVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDL 177
           ++E  P E+    +  R     E     ++T+  M+KL  +  V+S+G+SNF    ++DL
Sbjct: 123 LEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDL 182

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS------------A 225
           L+     + P   QVELHP L Q  LV Y Q   I+V AYS  G  S             
Sbjct: 183 LRG--ARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVT 240

Query: 226 PLLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPEED 282
           PLL   IV+++AKK+ V P+ V+L W  QR I V+PKS   ER+  NL   K  TL + +
Sbjct: 241 PLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSE 300

Query: 283 FDAIGKISQ 291
              I  +++
Sbjct: 301 MSDIFSLNK 309

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  177 bits (449), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/338 (35%), Positives = 180/338 (53%), Gaps = 47/338 (13%)

Query: 8   STKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI 67
           + +T+KLN+G+ +P+VGLG W+  +E  A   V  A+  GYR +D A  Y NE +VG+ I
Sbjct: 29  NVRTIKLNNGADMPLVGLGCWKIPNEVAA-EQVYEAIKLGYRLLDGAEDYANEREVGQGI 87

Query: 68  R---DSG-VPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKS 121
           R   D G V REE+FV +KLWN  H   +V  AL  +L  LGLDY+DL+ +H+P++    
Sbjct: 88  RRAIDEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAF--- 144

Query: 122 YMKESPLELMKRPDG----------TRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFS 170
             K  PLE  + P G           R  +     I T+  +++L  + ++R+IG+SNF 
Sbjct: 145 --KFVPLE-ERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQ 201

Query: 171 VNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS------ 224
              ++DLL+     + P   Q+E HP L Q  LV Y +   + V  YS LG  S      
Sbjct: 202 GCLVQDLLRG--CRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGN 259

Query: 225 ------APLLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLK---T 275
                 APLL   +V  +A+++   PA V+L W  QR+I V+PKS   ER+A NL+    
Sbjct: 260 TAAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEA 319

Query: 276 FTLPEEDFDAIGKISQQRGERRINNP---NFEPFKTFV 310
            TL +   D + ++S      R N+P   + +P  TF+
Sbjct: 320 LTLAD---DELRELSSLNCGLRFNDPWDWSAQPLPTFI 354

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  169 bits (428), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 166/315 (52%), Gaps = 33/315 (10%)

Query: 14  LNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR----D 69
           LN+G ++P+VGLG W+  D +   N +  A+  GYR  D A  Y NE +VGE IR    +
Sbjct: 7   LNNGCKMPLVGLGCWK-IDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISE 65

Query: 70  SGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES- 126
             V R++IFVT+KLWN  HH   V  AL ++L  +GLDY+DLY +H+P++      +E  
Sbjct: 66  GLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPFEEKY 125

Query: 127 -PLELMKRPDGTRP--VETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLKAPT 182
            P       D  R    E     I+T+  ++  + +  ++SIG+SNF  + ++DLL+   
Sbjct: 126 PPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLLRG-- 183

Query: 183 TNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG-----------STSAPLLSEP 231
             + P   Q+E HP L Q  LVDYC+ + I+V AYS  G           + S P L E 
Sbjct: 184 CRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPTLFEN 243

Query: 232 IVIDVAKKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPEEDFDAI 286
            V+    +N  G   + V+L W  QR I V+PKS   ER+  NL   K  TL +++   +
Sbjct: 244 DVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE---L 300

Query: 287 GKISQQRGERRINNP 301
            +IS      R N+P
Sbjct: 301 KEISSLNANIRFNDP 315

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  169 bits (428), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 177/326 (54%), Gaps = 46/326 (14%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGE--- 65
           +K + LN+G ++PIVGLG W+  ++  A   V  A+  GYR  D A  Y NE +VGE   
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQ-VYEAIKLGYRAFDGAQDYGNEKEVGEGIN 60

Query: 66  -AIRDSGVPREEIFVTTKLWNAQHHEPE---VALDESLQRLGLDYVDLYLMHWPVSLDKS 121
            AI +  V REE+FV +KLWN+ +H+P+   +AL  +L  + LDY+DLY +H+P++    
Sbjct: 61  QAISEGIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAF--- 116

Query: 122 YMKESPLELMKRPDGTRPVETDWT----------FINTWELMQKLPKNK-VRSIGVSNFS 170
             K  P E  K P G    + D             I+T+  M++L  +  ++SIG+SNF+
Sbjct: 117 --KFVPFE-EKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFN 173

Query: 171 VNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS------ 224
              ++DLL+  +  + PT  Q+E HP L Q  L++YC+ N I+V AYS  G  S      
Sbjct: 174 GALIQDLLR--SCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNV 231

Query: 225 -----APLLSEPIVI-DVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KT 275
                A +L E  VI  +A  + V+P+ V+L W  QR I ++PKS   ER+  NL   + 
Sbjct: 232 QKALDAKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEK 291

Query: 276 FTLPEEDFDAIGKISQQRGERRINNP 301
            TL E++   I  ++      R N+P
Sbjct: 292 LTLSEQELSTISDLNIG---LRFNDP 314

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  169 bits (427), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 170/315 (53%), Gaps = 33/315 (10%)

Query: 14  LNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR---DS 70
           LN+G ++P+VGLG W+ +++  A   V  A+  GYR  D A  Y NEV+VG+ I+   D 
Sbjct: 7   LNNGQKMPLVGLGCWKISNDICA-EQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDE 65

Query: 71  G-VPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES- 126
           G V R ++FV +KLWN+ HH   V  AL  +LQ LGLDY+DLY +H+P++      +E  
Sbjct: 66  GLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEKY 125

Query: 127 PLELMKRPDGTRP---VETDWTFINTWELMQKLPKNK-VRSIGVSNFSVNNLKDLLKAPT 182
           P       D  R     E     ++T+  +++   N  ++SIG+SNF+   ++DLL    
Sbjct: 126 PPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLNG-- 183

Query: 183 TNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG-----------STSAP-LLSE 230
             + P   Q+E HP L Q +LV+YC+   I+V AYS  G           + S P LL  
Sbjct: 184 CRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLLEH 243

Query: 231 PIVIDVAKKN-GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLK---TFTLPEEDFDAI 286
           PI+  +A  +    P+ V+L W  QR I V+PKS   ER+  NL    + TL EE+ + I
Sbjct: 244 PIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELNEI 303

Query: 287 GKISQQRGERRINNP 301
             +++     R N+P
Sbjct: 304 SSLNKN---IRFNDP 315

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 173/325 (53%), Gaps = 44/325 (13%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR 68
           +  + LN+G ++P+VGLG W+  ++  A   V  A+  GYR  D A  Y NE +VG+ IR
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCA-QQVYDAIKIGYRLFDGAEDYGNEKEVGQGIR 60

Query: 69  ---DSGV-PREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
              D GV  RE++FV +KLWN+ HH   V  AL  +L  +GLDY+DL+ +H+P++     
Sbjct: 61  KAIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAF---- 116

Query: 123 MKESPLELMKRPDG----------TRPVETDWTFINTWE-LMQKLPKNKVRSIGVSNFSV 171
            K  P E  K P G              E     I+T+  L Q + +  ++SIG+SNFS 
Sbjct: 117 -KYVPFE-EKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSG 174

Query: 172 NNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEP 231
           + ++DLL+     + P   QVE HP L Q  LV+YC+ N I+V AYS  G  S   L+ P
Sbjct: 175 SLVQDLLR--QCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHP 232

Query: 232 I------------VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTF 276
           +            +  +A  + V  + V+L W  QR I ++PKS   ER+  NL   +  
Sbjct: 233 LAKNTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKL 292

Query: 277 TLPEEDFDAIGKISQQRGERRINNP 301
           TL  ++ +AI K+++     R+N+P
Sbjct: 293 TLTHKELEAISKLNKN---LRLNDP 314

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 174/324 (53%), Gaps = 42/324 (12%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR 68
           ++T+KLN+G ++P+VGLG W+  +E  A + V  A+  GYR  D A  Y NE +VG+ IR
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCA-SQVYEAIKLGYRLFDGAQDYGNEKEVGQGIR 63

Query: 69  ---DSG-VPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
              D G V RE++FV +KLWN+ H    V  AL  +LQ LGL+Y+DL+ +H+P++     
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAF---- 119

Query: 123 MKESPLELMKRPDGTRPVETD---------WTFINTWE-LMQKLPKNKVRSIGVSNFSVN 172
            K  P E    P      E +          T ++T+  L Q + +  +++IGVSNF   
Sbjct: 120 -KFVPFEERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGI 178

Query: 173 NLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG----------- 221
            L DLL      + P   Q+E HP L Q +LV+YC+Q  I+V AYS  G           
Sbjct: 179 LLHDLLAG--AKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQL 236

Query: 222 STSAPLLSE-PIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT---FT 277
           + S P L E  +V  VA  +GV  + V+L W  QR + ++PKS   ER+  NL+     T
Sbjct: 237 AKSTPTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLT 296

Query: 278 LPEEDFDAIGKISQQRGERRINNP 301
           L +E+   I  +++   + R N+P
Sbjct: 297 LSDEELQEISSLNK---DIRFNDP 317

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  168 bits (425), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 112/315 (35%), Positives = 167/315 (53%), Gaps = 33/315 (10%)

Query: 14  LNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR----D 69
           LN+G ++P+VGLG W+  D++   N +  A+  GYR  D A  Y NE +VGE IR    +
Sbjct: 7   LNNGLKMPLVGLGCWK-IDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISE 65

Query: 70  SGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES- 126
             V R++IFV +KLWN  HH   V  AL ++L  +GLDY+DLY +H+P++      +E  
Sbjct: 66  GLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEKY 125

Query: 127 PLELMKRPDGTRP---VETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLKAPT 182
           P       D  +     E     I+T+  +++ + +  ++SIGVSNF  + ++DLL+   
Sbjct: 126 PPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLRG-- 183

Query: 183 TNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG-----------STSAPLLSEP 231
             + P   Q+E HP L Q  LV++C+ + I+V AYS  G           + + P L E 
Sbjct: 184 CRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFEN 243

Query: 232 IVIDVAKKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPEEDFDAI 286
            VI    +N  G   + V+L W  QR I V+PKS   ER+  NL   K FTL E++   +
Sbjct: 244 DVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE---L 300

Query: 287 GKISQQRGERRINNP 301
             IS      R N+P
Sbjct: 301 KDISALNANIRFNDP 315

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 170/310 (54%), Gaps = 31/310 (10%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR 68
           ++T+ LN+G  +P+VGLG W+ + +  A   V  A+  GYR  D A  Y NE QVG+ IR
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICA-EQVYEAIKLGYRLFDGACDYGNEKQVGDGIR 60

Query: 69  ---DSG-VPREEIFVTTKLWNAQHHEPE---VALDESLQRLGLDYVDLYLMHWPVSLDKS 121
              D G V RE++FV +KLWN  +H+P+   +AL  +L  + L+Y+DLY +H+P++    
Sbjct: 61  RAIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFV 119

Query: 122 YMKES--PLELMKRPDGTRPVETD--WTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKD 176
             +E   P       D  + + T+     I+T+  M++L  +   +SIG+SN++   ++D
Sbjct: 120 PFEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQD 179

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSA----------- 225
            L+     + P   Q+E HP L Q +LV+YC+ N I+V AYS  G  S            
Sbjct: 180 TLRG--CRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHT 237

Query: 226 -PLLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPEE 281
            PL   P++  +A+++ V  + V+L W  QR I V+PKS H  R+  NL   +  TL  +
Sbjct: 238 PPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPK 297

Query: 282 DFDAIGKISQ 291
           D + I  +++
Sbjct: 298 DLEEISSLNK 307

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  164 bits (416), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 167/321 (52%), Gaps = 45/321 (14%)

Query: 14  LNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR----D 69
           LN+G ++P+VGLG W+  D+    N +  A+  GYR  D A  Y NE +VGE IR    +
Sbjct: 7   LNNGLKMPLVGLGCWK-IDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIYE 65

Query: 70  SGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESP 127
             V R+++FV +KLWN  HH   V  AL ++L  +GLDY+DLY +H+P++      K  P
Sbjct: 66  GLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAF-----KYIP 120

Query: 128 LELMKRPDG----------TRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKD 176
            E  K P G              E     I+T+  ++K + +  ++SIG+SNF  + ++D
Sbjct: 121 FE-EKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQD 179

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG-----------STSA 225
           LL+     + P   Q+E HP L Q  LV++C+ + I+V AYS  G           + + 
Sbjct: 180 LLRG--CRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKAT 237

Query: 226 PLLSEPIVIDVAKKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPE 280
             L E  VI    +N  G   + V+L W  QR I V+PKS   ER+  NL   K F+L E
Sbjct: 238 QTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTE 297

Query: 281 EDFDAIGKISQQRGERRINNP 301
           ++   + KIS      R N+P
Sbjct: 298 QE---LKKISALNANIRFNDP 315

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  164 bits (415), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/321 (34%), Positives = 168/321 (52%), Gaps = 45/321 (14%)

Query: 14  LNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR----D 69
           LN+G ++P+VGLG W+  D++   N +  A+  GYR  D A  Y NE +VGE IR    +
Sbjct: 7   LNNGLKMPLVGLGCWK-IDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRRAISE 65

Query: 70  SGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESP 127
             V R+++FV +KLWN  HH   V  AL ++L  +GLDY+DLY +H+P++      K  P
Sbjct: 66  GLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAF-----KYVP 120

Query: 128 LELMKRPDG----------TRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKD 176
            E  K P G              E     ++T+  +++ + +  ++SIG+SNF  + ++D
Sbjct: 121 FE-EKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQD 179

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG-----------STSA 225
           LL+     + P   Q+E HP L Q  LV++C+ + I+V AYS  G           + + 
Sbjct: 180 LLRG--CRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTT 237

Query: 226 PLLSEPIVIDVAKKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPE 280
           P L E  VI     N  G   + V+L W  QR I V+PKS   ER+  NL   K FTL E
Sbjct: 238 PTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTE 297

Query: 281 EDFDAIGKISQQRGERRINNP 301
           ++   + +IS      R N+P
Sbjct: 298 QE---LKEISALNANIRFNDP 315

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  164 bits (414), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 162/320 (50%), Gaps = 38/320 (11%)

Query: 11  TLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGE----A 66
            + LN+G+++P+VGLG W+  +E      +  A+  GYR  D A  Y NE +VGE    A
Sbjct: 4   VVALNNGNKMPLVGLGCWKIPNE-TCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRRA 62

Query: 67  IRDSGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124
           I+D  V REE+FV +KLWN+ HH   V  AL  +L  +GLDY+DL+ +H+P++L     +
Sbjct: 63  IKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSFE 122

Query: 125 ESPLELMKRPDGTRPVETDWT----------FINTWELMQK-LPKNKVRSIGVSNFSVNN 173
           E      K P G    E D             ++T+  +++ + +  ++SIGVSNFS + 
Sbjct: 123 E------KYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSI 176

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS--------- 224
           + DLL+     + P   Q+ELHP L Q   V + Q   I+V AYS  G  S         
Sbjct: 177 MLDLLRG--ARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVA 234

Query: 225 ---APLLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEE 281
               PL    +V  +A K+ V  + V+L W  Q+ + V+PKS   ER+  NL        
Sbjct: 235 KATPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTL 294

Query: 282 DFDAIGKISQQRGERRINNP 301
             D I +IS      R N+P
Sbjct: 295 TGDEIKEISGLNKNLRFNDP 314

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  163 bits (413), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 171/321 (53%), Gaps = 45/321 (14%)

Query: 14  LNDGSQIPIVGLGTWQ---ATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR-- 68
           LN+G ++P+VGLG W+   +T  +  Y+A++     GYR  D A  Y NE +VG+ I+  
Sbjct: 7   LNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKV----GYRLFDGATDYGNEKEVGQGIKRA 62

Query: 69  -DSG-VPREEIFVTTKLWNAQHHEPEVALD--ESLQRLGLDYVDLYLMHWPVSL-----D 119
            D G V RE++F+ +KLWN  HH   V L+   +L+ LGLDYVDLY +H+P++      D
Sbjct: 63  IDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSPD 122

Query: 120 KSYMKESPLELMKRPDGTRPV--ETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKD 176
           + Y    P     + D  + +  E +   I+T+  M+KL  +  ++SIG+SN++   + D
Sbjct: 123 ERY---PPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVAD 179

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS------------ 224
            L+     + P   Q+E HP L Q +L++YC+ + ++V AYS  G  S            
Sbjct: 180 TLRG--CRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNT 237

Query: 225 APLLSEPIVIDVAKK-NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPE 280
            PL   P +  +A K   V  + V+L W  QR + ++PKS   ER+  NL   +  TL E
Sbjct: 238 PPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAE 297

Query: 281 EDFDAIGKISQQRGERRINNP 301
           ED   I  ++Q     R N+P
Sbjct: 298 EDLREISALNQN---LRFNDP 315

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  163 bits (413), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/334 (34%), Positives = 177/334 (52%), Gaps = 40/334 (11%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR 68
           ++ + LN+G ++P+VGLG W+  +E  A + V  A+  GYR  D A  Y NE +VG+ IR
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCA-SQVYEAIKIGYRLFDGAQDYGNEKEVGQGIR 60

Query: 69  ---DSG-VPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
              D G V REE+FV +KLWN+ H    V  AL  +L  + LDY+DL+ +H+P++L    
Sbjct: 61  KAIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVP 120

Query: 123 MKES-PLEL----MKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKD 176
            KE  P  L         GT   E +   I+T+  +++L  +  ++SIG+SNFS + + D
Sbjct: 121 FKEKYPPGLYTGSQDEKQGTMS-EENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMD 179

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG------------STS 224
           LL+     + P   Q+E HP L Q  LV Y +   ++V AYS  G             T+
Sbjct: 180 LLRG--CRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTT 237

Query: 225 APLLSEPIVIDVAKKNG--VQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT---FTLP 279
            PL   P +I++AK +G  + P+ V+L W  Q N+ V+PKS   ER+  NL      TL 
Sbjct: 238 PPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLT 297

Query: 280 EEDFDAIGKISQQRGERRINNP----NFEPFKTF 309
           +++   I  +++     R N+P    +  PF  F
Sbjct: 298 DQELKEISALNKN---IRFNDPYTWNDKNPFPIF 328

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  160 bits (405), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 149/279 (53%), Gaps = 37/279 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K+ KL+ G  IP VGLGT++    + AY  V  AL+ GYRH DTA +Y NE +VG+ I+ 
Sbjct: 7   KSYKLSSGYTIPSVGLGTYELPPNKTAY-LVHQALEVGYRHFDTAVLYGNEYEVGQGIKK 65

Query: 70  ------SGVPREEIFVTTKLWNAQH--HEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                 +   R ++F TTKLW++QH   + + A+D  LQ +  L Y+DL L+H P+   K
Sbjct: 66  WLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGGKK 125

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                                     + T+E MQ+ +   KVRSIGVSN+   ++++LL 
Sbjct: 126 ------------------------LRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P   + EL D+C++  I VEAY+PL  T    L +P ++ VA +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANE 219

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTL 278
            G      ++ W +Q+  I LPK+    R+A+NL  F+ 
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/326 (34%), Positives = 172/326 (52%), Gaps = 44/326 (13%)

Query: 8   STKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI 67
           +++T+KLN+G Q+P+VGLG W+  +E  A + V  A+  GYR  D A  Y NE +VG+ I
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCA-SQVYEAIKLGYRLFDGAQDYGNEKEVGQGI 62

Query: 68  R---DSG-VPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKS 121
               D G V RE++FV +KLWN+ H    V  AL  +L+ + L+Y+DL+ +H+P++    
Sbjct: 63  HKAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAF--- 119

Query: 122 YMKESPLELMKRPDGTRPVETDWT----------FINTWELMQKLPKNK-VRSIGVSNFS 170
             K  P E  K P G      D             I+T+  +++  K   ++SIG+SNF 
Sbjct: 120 --KYVPFE-EKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFR 176

Query: 171 VNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG--------- 221
              + DLL   T  + P   Q+E HP L Q +L++YC Q +I+V AYS  G         
Sbjct: 177 GILIHDLLAGAT--IKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDS 234

Query: 222 --STSAPLLSEPIVID-VAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--- 275
             + S P L E   I  +A  +GV  + V+L W  QR I ++PKS   ER+  NL+    
Sbjct: 235 ELAKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEK 294

Query: 276 FTLPEEDFDAIGKISQQRGERRINNP 301
            TL E +   I  +++   + R N+P
Sbjct: 295 LTLTEAELQEISALNK---DIRFNDP 317

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  159 bits (403), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 172/319 (53%), Gaps = 32/319 (10%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR 68
           +KT+ LN+G ++P++GLG W+  ++  A + V  A+  GYR  D A  Y NE +VG+ I+
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCA-SQVYEAIKLGYRLFDGAQDYGNEKEVGQGIK 63

Query: 69  ----DSGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
               +  V RE++FV +KLWN+ HH   V  AL ++L  +GLDY+DL+ +H+P++     
Sbjct: 64  KAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVP 123

Query: 123 MKES--PLELMKRPDGTRPV--ETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDL 177
            +E   P       D    V  + D   I+T+  ++K + +  ++SIG+SNF+ + ++DL
Sbjct: 124 FEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDL 183

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLG------------STSA 225
           L+     + P   Q+E HP L Q  LV YC+   I+V AYS  G             T+ 
Sbjct: 184 LRG--ARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTP 241

Query: 226 PLLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPEED 282
            L     V  +A  + V  + V+L W  QR + V+PKS   ER+  NL    + TL +++
Sbjct: 242 TLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDKE 301

Query: 283 FDAIGKISQQRGERRINNP 301
             AI  +++   + R N+P
Sbjct: 302 LKAISALNK---DIRFNDP 317

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  157 bits (398), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 146/276 (52%), Gaps = 36/276 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI-- 67
           K+ KL  G  IP +GLGT+      +    V AAL+ GYRH+DTA +Y NE +V +    
Sbjct: 5   KSYKLASGFNIPTIGLGTYDLPPS-NTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMN 63

Query: 68  ---RDSGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDKS 121
              R   V RE+IF TTKLWN+Q  + + + A+ E ++ +G L Y+DL LMH P+     
Sbjct: 64  FLGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPI----- 118

Query: 122 YMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLKA 180
                         G + V        TW+ MQ+ +    VRSIGVS++   +L+DL + 
Sbjct: 119 --------------GGKQVRR-----GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEW 159

Query: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN 240
                 P +NQ+E+ P + + +L DYC+   I VEAYSPL  T    L +P ++ VA++ 
Sbjct: 160 SELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEET 217

Query: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF 276
           G  P  V+L W +Q   + LPK+    R+  NL  F
Sbjct: 218 GKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  157 bits (397), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 172/315 (54%), Gaps = 46/315 (14%)

Query: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66
           ++TKTL   +G +IP++G GT++   E+ A + V AA   GYRH+DTA +Y+NE +   A
Sbjct: 6   STTKTL--TNGVKIPVLGFGTYETPKEK-AESIVHAAFKQGYRHVDTAQLYENERECATA 62

Query: 67  I-----RDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLG-LDYVDLYLMHWPVSL 118
           +         V R+++F TTK+    H   + + ++ ESL+    L+YVDL+L+H P + 
Sbjct: 63  VAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA- 121

Query: 119 DKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177
                     E  KR             + T++ +Q+  K  K+++IGVS++S+ +L++L
Sbjct: 122 ----------ETEKR-------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237
                  V P +NQ EL+P L + +LV YC++  + +EA+SP+  T +   S+P+V  + 
Sbjct: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLL 216

Query: 238 KKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKISQQR 293
           K++  G  PA +++ W +Q   + LPKSVH +R  +NL    F +  ED   +       
Sbjct: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL----THD 272

Query: 294 GERRINNPNFEPFKT 308
           GE  +  P F+P +T
Sbjct: 273 GEHFLAQPGFDPIET 287

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  157 bits (397), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 156/289 (53%), Gaps = 43/289 (14%)

Query: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66
           N     KLN+G QIP++G G ++   E D  + V +AL  GYRHIDTA +YKN+ +  + 
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKE-DTADLVYSALKDGYRHIDTAVLYKNQKEAAQG 66

Query: 67  IR----DSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLD------YVDLYLMHWPV 116
           +R    ++G  RE I+ TTKLW++Q    E   +++LQ +  D      YVDL L+H P 
Sbjct: 67  VRKYLDETGEARENIWFTTKLWDSQFGREET--EKALQEVAADVKEYIGYVDLLLLHSP- 123

Query: 117 SLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNK---VRSIGVSNFSVNN 173
                           R    R +ET W  +   E   + P +K   ++SIGVSNF V++
Sbjct: 124 ----------------RGGAKRRLET-WAIL---EQAVQEPGSKALEIKSIGVSNFGVDH 163

Query: 174 LKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIV 233
           L++LLK     V P ++Q+ELHP LP+ EL  Y ++  I  EAYSPL  T    L +P +
Sbjct: 164 LEELLK--VAKVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPEL 219

Query: 234 IDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEED 282
           + +  K G+  A ++L W   +  +VL KS + ER+  NL    LP E+
Sbjct: 220 LALEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLA--VLPSEN 266

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  156 bits (394), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 158/299 (52%), Gaps = 47/299 (15%)

Query: 4   NLKNSTKTLKLNDGSQIPIVGLGTW----QATDERDAYNAVRAALDAGYRHIDTAAIYKN 59
           N K   K  KL+ G  +P +GLGT+     AT E      V  AL  GYRH+DTA +Y N
Sbjct: 2   NTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSE-----IVYEALKCGYRHLDTAVLYGN 56

Query: 60  EVQVGEAI------RDSGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLY 110
           E +VGE I        S   RE++F  TKLWN+Q  ++  + A+ E  +++ GL Y+DL 
Sbjct: 57  EREVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLL 116

Query: 111 LMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNF 169
           L+H P+S                  G+R        + T++ MQ+ + K  VRSIGVSN+
Sbjct: 117 LIHSPLS------------------GSR------KRLETYKAMQEAVDKGIVRSIGVSNY 152

Query: 170 SVNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLS 229
            V+++ +LL        P +NQ+E+ P L + EL DYC+   + VEAY+PL  T    ++
Sbjct: 153 GVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKIN 210

Query: 230 EPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFT--LPEEDFDAI 286
            P V+ VAK+ G     V++ W +Q   + LPK+   +R+ +NL  +   L +E  D +
Sbjct: 211 HPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFL 269

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  156 bits (395), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 167/319 (52%), Gaps = 32/319 (10%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGE--- 65
            +T+ LN+G ++P+VGLG W+  ++  A + +  A+  GYR  D A  Y NE +VG+   
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCA-DQIYEAIKIGYRLFDGAQDYANEKEVGQGVN 63

Query: 66  -AIRDSGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
            AI++  V RE++ V +KLWN+ HH   V  AL+ +L  L LDYVD++ +H+P++     
Sbjct: 64  RAIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVP 123

Query: 123 MKES---PLELMKRPDGTRPVETDWT-FINTWELMQKL-PKNKVRSIGVSNFSVNNLKDL 177
             E         K  +    +E +    ++TW  ++KL  + K++S+G+SNFS   ++DL
Sbjct: 124 FDEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDL 183

Query: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTS-----------AP 226
           L+     + P   Q+E HP L Q  L+ Y +   I+V AYS  G  S            P
Sbjct: 184 LRG--ARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTP 241

Query: 227 LLSEPIVI-DVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLK---TFTLPEED 282
            L E   I  +A K+ V P  V+L W  Q  I ++PKS   ER+  NL+     TL +++
Sbjct: 242 TLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDE 301

Query: 283 FDAIGKISQQRGERRINNP 301
              I  ++Q     R N+P
Sbjct: 302 LKQISGLNQN---IRFNDP 317

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 157/310 (50%), Gaps = 41/310 (13%)

Query: 14  LNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIR----D 69
           LN+G ++P+VGLG W+  +   A   V  A+  GYR  D A  Y NE +VG+ IR    +
Sbjct: 7   LNNGLKMPMVGLGCWKIPNTVCA-EQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 70  SGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESP 127
             V R ++F+ +KLWN  HH   V  A+ ++L  LGLDY+DLY +H+P++      K  P
Sbjct: 66  KIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAF-----KFVP 120

Query: 128 LELMKRPDGTRPVETDWT----------FINTWELMQKL-PKNKVRSIGVSNFSVNNLKD 176
           +E  K P G    + D            +++T+  M+ L  +  ++SIGVSN     L+D
Sbjct: 121 IE-EKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQD 179

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSA----------- 225
           +L      + P   Q+E HP L Q  LVDYC++ +I V AYS  G  S            
Sbjct: 180 VLMG--CKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDT 237

Query: 226 -PLLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KTFTLPEE 281
             L   P++  +A K  V  + V+L W  Q  + V+PKS   ER+  NL    T TL  E
Sbjct: 238 PNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNE 297

Query: 282 DFDAIGKISQ 291
           +   I  I++
Sbjct: 298 ELVEISNINR 307

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  155 bits (391), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 172/320 (53%), Gaps = 55/320 (17%)

Query: 7   NSTKTLKLNDGSQIP---IVGLGT-WQATDERDA------YNAVRAALDA--GYRHIDTA 54
            + K   L++G++IP   IVG GT W  ++E DA       + V+  LD   G  HID A
Sbjct: 2   TTQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAA 61

Query: 55  AIYKNEVQVGEAIRDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLGLDYVDLYLM 112
            IY+   ++G A++D+  PR+EIF+T K    +     P+VAL+ SL++LG+DYVDLYL+
Sbjct: 62  EIYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLL 121

Query: 113 HWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVN 172
           H P+      +KES L+          VE +W ++   EL +     K ++IGVSNF+V 
Sbjct: 122 HSPI------IKESKLD----------VEANWKYLE--ELYK---SGKAKNIGVSNFAVK 160

Query: 173 NLKDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLSE 230
           +L+ LL      V P +NQ+E  P L      +V++ Q+N I +EAYSPLG    PL   
Sbjct: 161 DLEKLL--AVAEVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PLQRR 214

Query: 231 P----------IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTL 278
           P           + +++KK     A ++LSW+ +R I+ +  S   ER+  A ++ +F+L
Sbjct: 215 PEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSL 274

Query: 279 PEEDFDAIGKISQQRGERRI 298
             E+   I ++  Q    R+
Sbjct: 275 ANEEVQKITQLGLQHPALRL 294

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  151 bits (382), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 152/291 (52%), Gaps = 39/291 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           KT  L +G  +P +GLG +       A   V  AL  GYRH DTA  Y NE +VGE I  
Sbjct: 4   KTYTLTNGCLMPSLGLGCYSIPKNTTA-QVVHQALKCGYRHFDTAVFYGNETEVGEGIAA 62

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDK 120
                 S   R+++F  TKLWN+Q  + E + A+ + LQ++  L Y+DL L+H P     
Sbjct: 63  WLAEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSA 122

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                      KR             + T+E MQ+ +    V+SIGVSN+  ++L++L  
Sbjct: 123 -----------KR-------------LATYEAMQESVDAGIVKSIGVSNYERHHLQELYA 158

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
            P     P +NQ+E+ P LP+ +LVDYC+   + ++AYSPLG      +++P +  +A +
Sbjct: 159 MPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQ 216

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF--TLPEEDFDAIGK 288
               PA ++++W + +    LPK+ + +R+ +NL ++  +L  E+   I K
Sbjct: 217 KNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTAEELTNIEK 267

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  151 bits (381), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 154/277 (55%), Gaps = 37/277 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K  +L DG +IP + LGT+   +   A   V  AL  GYRH DTA +Y NE +VG+ I +
Sbjct: 9   KYYELQDGRKIPSLALGTYDIPNSVTA-KVVTEALKCGYRHFDTAVLYGNEREVGQGIVN 67

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                 +   RE++F TTKLWN+Q  ++E + A+ E +Q++ GL Y+D+ L+H       
Sbjct: 68  WINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIH------- 120

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                SPL   +R             + TW+ MQ+ + +  V+SIGVSN+  +++++LL 
Sbjct: 121 -----SPLSGQRRR------------LETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLG 163

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P + + EL DYC+   + VEAY+P+       +++P + +++K+
Sbjct: 164 WDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAHGYK--MNDPGLREISKE 221

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF 276
            G+ P  +++ W +Q   + LPK+    R+A+NL  +
Sbjct: 222 TGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  151 bits (381), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 159/307 (51%), Gaps = 56/307 (18%)

Query: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66
           N     KLN+G+++P++G G +    E  A   V  AL  GYRHIDTA +Y+N+ Q  + 
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETA-QRVYTALQEGYRHIDTAVVYENQKQAAQG 66

Query: 67  IR----DSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLD------YVDLYLMHWPV 116
           +     ++G PREE++ TTKLWN Q      A   +L+ +  D      YVDL L+H P+
Sbjct: 67  VHRFLEETGTPREEVWFTTKLWNTQQGRD--ATPRALEEIAADVKEFIGYVDLLLLHSPL 124

Query: 117 SLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN------KVRSIGVSNFS 170
           +                 D  R +ET       W ++++  +       ++R+IGVSNF 
Sbjct: 125 T-----------------DAQRRLET-------WAVLERAVQEPASSALEIRAIGVSNFG 160

Query: 171 VNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSE 230
           V +L++LL+  T  V P ++Q+ELHP LP+ EL  + ++N I  EAYSPL  T    L +
Sbjct: 161 VRHLQELLEVAT--VKPVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQD 216

Query: 231 PIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF---------TLPEE 281
           P ++ +  K+G+    ++L W   +   VL KS + +R+  NL            +L +E
Sbjct: 217 PELLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWKVSLDQE 276

Query: 282 DFDAIGK 288
            +DA+ K
Sbjct: 277 LWDALDK 283

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  150 bits (378), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 104/316 (32%), Positives = 159/316 (50%), Gaps = 41/316 (12%)

Query: 9   TKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGE--- 65
           T  + LN+G ++P+VGLG W+  ++  A + V  A+  GYR  D AA Y NE +VG+   
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCA-SQVYEAIKLGYRLFDGAADYGNEKEVGQGIN 60

Query: 66  -AIRDSGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDKSY 122
            A+ +  V R ++F+ +KLWN  HH   V  AL  +L  LGLDY+DLY +H+P++     
Sbjct: 61  KALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAF---- 116

Query: 123 MKESPLELMKRPDGTRPVE---------TDWTFINTWELMQKL-PKNKVRSIGVSNFSVN 172
            K  P E    P      E          +  +++T+  M+KL  +   +SIGVSN   +
Sbjct: 117 -KYVPFEEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGS 175

Query: 173 NLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSA------- 225
            L+D+L      + P   Q+E HP L Q  LV +C+   I V +YS  G  S        
Sbjct: 176 ILQDVLMG--CRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKR 233

Query: 226 -----PLLSEPIVIDVAKKNG--VQPAHVVLSWIVQRNIIVLPKSVHAERVAANL---KT 275
                 L   P++  +A  +G  V  + V+L W  QR+I ++PKS   ER+  NL   + 
Sbjct: 234 AEDTPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEK 293

Query: 276 FTLPEEDFDAIGKISQ 291
            TL E +   I  +++
Sbjct: 294 LTLTEAELLEISALNK 309

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  149 bits (376), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 149/278 (53%), Gaps = 38/278 (13%)

Query: 6   KNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGE 65
           K      +L+DG+QIP VGLG +Q + E+   + V  AL+ GYR  D+A  Y NE  V  
Sbjct: 7   KEDCHFRRLSDGTQIPSVGLGVYQVS-EQTVQDLVYEALEVGYRLFDSAQAYHNEDGVAR 65

Query: 66  AI-----RDSGVPREEIFVTTKLWNAQHHEPEV---ALDESLQRLG-LDYVDLYLMHWPV 116
            I        G  RE+++ TTK+ N Q+H  E    +L++SL   G L Y+DL L+H P+
Sbjct: 66  GIAAWLKHAPGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPM 124

Query: 117 SLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLK 175
           S                 D TR        + TW+ +++ + + +VRSIGVSN+   +L 
Sbjct: 125 S-----------------DRTRR-------LGTWQALEEAVVEGQVRSIGVSNYGQQHLS 160

Query: 176 DLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVID 235
           +LL      + P +NQVE++P L + ELV YC++N I V+A+SPL       L +PI+  
Sbjct: 161 ELLGWEGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQK 218

Query: 236 VAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANL 273
           VA +     A +++ W +Q   IVLPK+   ER+A N 
Sbjct: 219 VAHQYDKGVAQILVRWSIQMGFIVLPKAAKKERLAPNF 256

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 143/277 (51%), Gaps = 37/277 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K  KL++G  IP VGLGT+   +   A N V  AL AGYRH DTA +Y NE +VG+ I  
Sbjct: 7   KFYKLSNGYSIPSVGLGTYDIPNNVTA-NVVYEALKAGYRHFDTAVLYGNEEEVGQGIHR 65

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                     RE +F TTKLWN+Q  + +   A+   L ++  L+Y+DL L+H P+    
Sbjct: 66  WLLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLG--- 122

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                          GT+        + TW+ MQ+ +    V+SIGVSN+ ++++ +LL 
Sbjct: 123 ---------------GTK------LRLETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLT 161

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P L + EL DYC+ N I VE YSPL  T    L++  +  VA +
Sbjct: 162 WQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANE 219

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF 276
            G     V++ W +Q   I LPK+    R+  NL  +
Sbjct: 220 TGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVY 256

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 148/277 (53%), Gaps = 37/277 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K  KL+ G  +P +GLGT+      +    V  AL +GYRH+DTA +Y NE +VG+ I+ 
Sbjct: 15  KAYKLSSGYILPSIGLGTYD-IPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQK 73

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDK 120
                     R+++F TTKLWN+Q  +   + A+ E ++++  L Y+DL L+H P+S   
Sbjct: 74  WLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS--- 130

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                          GTR        + T++ MQ+ + +  VRSIGVSN+  +++ +LL 
Sbjct: 131 ---------------GTR------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLT 169

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P + + +L DYC+   + VEA+SPL  T    L  P V+ VAK+
Sbjct: 170 WKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKE 227

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF 276
            G     V++ W +Q   + LPKS   ER+  N+K +
Sbjct: 228 TGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY 264

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  145 bits (366), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 148/279 (53%), Gaps = 37/279 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K    N+G+QIP + LGT+       A   V  AL AGYRH DTA +Y NE QVGE I  
Sbjct: 6   KYYTFNNGNQIPSIALGTYDIPQSITA-KIVYEALKAGYRHFDTAVLYGNEHQVGEGILQ 64

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                     R ++F TTKLWN+Q  +H+ + A+ E L ++ GL Y+D+ L+H       
Sbjct: 65  WIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIH------- 117

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                SPLE       T+ +ET       W  MQ+ +    V++IGVSN+   ++++LL+
Sbjct: 118 -----SPLE-----GRTKRLET-------WRAMQEAVESGLVKNIGVSNYGRQHVEELLQ 160

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                + P +NQ+E+ P + + EL DYC+   + VEA++PL  T    L +  ++ V+K+
Sbjct: 161 WERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKE 218

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTL 278
            G     V++ W +Q   + LPK+   +R+  NL+ +  
Sbjct: 219 VGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 144/283 (50%), Gaps = 37/283 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI-- 67
           K  KL++G +IP + LGT+     + A   V   +  GYRH DTA +Y NE +VG+ I  
Sbjct: 4   KFYKLSNGFKIPSIALGTYDIPRSQTA-EIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIK 62

Query: 68  ---RDSG-VPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
               D G   REEIF TTKLWN+Q  +   + A+ + L  + GL Y+DL L+H       
Sbjct: 63  WLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIH------- 115

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                SPLE  K              + TW  MQ+ + +  V+SIGVSN+   ++ +LL 
Sbjct: 116 -----SPLEGSK------------LRLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLN 158

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
            P     P +NQ+E+ P + + EL DYC+   + VEA++PL       ++ P ++ V K+
Sbjct: 159 WPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKE 216

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEED 282
               P  V++ W +Q   + LPK+   +R+  NL  +     D
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  143 bits (361), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 106/325 (32%), Positives = 166/325 (51%), Gaps = 55/325 (16%)

Query: 8   STKTLKLNDGSQIP---IVGLGT-W------QATDERDAYNAVRAALDA-GYRHIDTAAI 56
           + K   LN+G+QIP   I+G GT W      + T   +    ++ AL   G  HID A  
Sbjct: 4   TQKFFDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAEC 63

Query: 57  YKNEVQVGEAIRDSGVPREEIFVTTKLWNAQH---HEPEVALDESLQRLGLDYVDLYLMH 113
           Y    ++ +A+++S  PR EIF+T K ++ Q    ++P   L+  L+ LGLDYVDLYL+H
Sbjct: 64  YGTYPELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIH 122

Query: 114 WPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVN 172
            P   D  +     LE                    W+ M+ L K  K +SIGVSNFSV 
Sbjct: 123 SPF-FDPEFKGSLTLE------------------KVWKDMETLYKEGKAKSIGVSNFSVK 163

Query: 173 NLKDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLSE 230
           N++++LK     + P +NQ+E +  L      +V+YCQ+N I++EAYSPLG    PL   
Sbjct: 164 NIEEILK--IAGIKPQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKR 217

Query: 231 P----------IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTL 278
           P           + ++A K G   + ++L+W+  R I+ +  S   +R+  A N+ +F L
Sbjct: 218 PENSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNL 277

Query: 279 PEEDFDAIGKISQQRGERRINNPNF 303
            +++ D + K+  ++   RI   NF
Sbjct: 278 TKDEVDTLTKLGLEQPALRIYWTNF 302

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  142 bits (358), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 151/289 (52%), Gaps = 39/289 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K   L++G +IP + LGT+       A N V  AL  GYRH DTA +Y NE +VGE I  
Sbjct: 5   KFYTLSNGVKIPSLALGTYDLPKSTTA-NIVYEALKCGYRHFDTAVLYNNERKVGEGIYQ 63

Query: 70  ------SGVPREEIFVTTKLWNAQH-HEP-EVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                     RE++F TTKLWN+Q+ ++P + A+ E LQ++  L Y+DL L+H P+S   
Sbjct: 64  WLQEDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLS--- 120

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                          G+R        + T++ MQ+ + +  V+SIGVSN+  ++L++LL 
Sbjct: 121 ---------------GSR------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLS 159

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P   + EL  +CQ   I VE Y+PL  T    L +P ++ VA++
Sbjct: 160 WEGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEE 217

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAI 286
            G     V++ W +Q   + LPK+ + +R+  NL    F L E    A 
Sbjct: 218 VGKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAF 266

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  141 bits (355), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 144/277 (51%), Gaps = 37/277 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           +  KL+ G  +P +GLGT+       A   V  AL AGYRH+DTA +Y NE +VGE +  
Sbjct: 8   RAYKLSSGYVLPSLGLGTYDIPRAETA-EVVYQALKAGYRHLDTAVLYGNEREVGEGVEK 66

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDK 120
                     R ++F TTKLWN+Q  +   + A+ E L ++  L Y+D+ L+H P+S   
Sbjct: 67  WLKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLS--- 123

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                          GTR        + T++ MQ+ +    VRSIGVSN+  +++ +LL 
Sbjct: 124 ---------------GTR------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLA 162

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P + + +L DYC+   + VEA+SPL  T    +  P V+ VA++
Sbjct: 163 WEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEE 220

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF 276
            G     V++ W +Q   + LPKS   ER+  NL+ +
Sbjct: 221 VGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY 257

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  140 bits (354), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/289 (32%), Positives = 146/289 (50%), Gaps = 42/289 (14%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI-- 67
           K   L++G +IP + LGT+     + A   V   +  GYRH DTA +Y NE +VG+ I  
Sbjct: 4   KFYNLSNGYRIPSIALGTYDIPRSQTA-EIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIK 62

Query: 68  ----RDSGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                     RE+IF TTKLWN+Q  +   + A+ + L  + GL Y+DL L+H       
Sbjct: 63  WLNENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIH------- 115

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                SPLE  K              + TW+ MQ+ + +  V+SIGVSN+   ++ +LL 
Sbjct: 116 -----SPLEGSK------------LRLETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLT 158

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
            P     P +NQ+E+ P + + EL DYC+   + VEA++PL       ++ P ++ V K+
Sbjct: 159 WPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCKE 216

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGK 288
               P  V++ W +Q   + LPK+   +R+  NL  +     DF+ + K
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAY-----DFELLDK 260

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  140 bits (353), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 144/283 (50%), Gaps = 37/283 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K  K ++G ++P + LGT+     + A   V   +  GYRH DTA +Y NE +VG+ I  
Sbjct: 4   KFYKFSNGYKVPSIALGTYDIPRSQTA-EIVYEGIKCGYRHFDTAVLYGNEKEVGDGITK 62

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                     RE++F TTKLWN+Q  +   +VA+ + L  + GL Y+DL L+H       
Sbjct: 63  WLHEDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIH------- 115

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                SPLE  K              + TW+ MQ+ + +  V+SIGVSN+   ++ +LL 
Sbjct: 116 -----SPLEGSK------------LRLETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLN 158

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P + + EL DYC+   + VEA++PL       +++P ++ V K+
Sbjct: 159 WSQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKE 216

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEED 282
               P  V++ W +Q   + LPK+   +R+ +NL  +     D
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSD 259

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  140 bits (354), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 164/312 (52%), Gaps = 55/312 (17%)

Query: 14  LNDGSQIP---IVGLGT-WQATDERDA------YNAVRAALDA-GYRHIDTAAIYKNEVQ 62
           LN+G++IP   ++G GT W  T+E DA       + ++ AL   G  HID A IY+   +
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQ---HHEPEVALDESLQRLGLDYVDLYLMHWPVSLD 119
           V  A+R+S  PR+EIF+T K ++ Q     +P   L+ SL+ LGLDYVDLYL+H P   +
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPFIKN 128

Query: 120 KSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLL 178
            S ++E                        W+ M+KL K+ K ++IGVSNF V +L+ +L
Sbjct: 129 GSTLEEC-----------------------WKQMEKLYKSGKAKNIGVSNFRVEDLEKIL 165

Query: 179 KAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG--------STSAPLL 228
           K  T  + P INQ+E +  L      +V +C++N I++EAY+PLG          + P  
Sbjct: 166 KIAT--IKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFY 223

Query: 229 SEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAI 286
               + +++KK     A ++L W+ +R I+ +  S   +R+  A NL +F L   + D I
Sbjct: 224 D--YIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKI 281

Query: 287 GKISQQRGERRI 298
            ++  +    R+
Sbjct: 282 TELGLKLKATRL 293

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  139 bits (349), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 141/278 (50%), Gaps = 38/278 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI-- 67
           KT KL+    IP V LGT+      +    V  ALD GYRH DTA +Y NE +V + I  
Sbjct: 7   KTYKLSSNYYIPTVALGTYDLPSS-ETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISN 65

Query: 68  ---RDSGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDKS 121
              R     R+EIF TTKLWN+Q  +   + A+ E + ++  L Y+DL LMH P+     
Sbjct: 66  WLIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPIG---- 121

Query: 122 YMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLKA 180
                         G +  E       TW  MQ+ + +  V+SIGVSNF + +LK+L + 
Sbjct: 122 --------------GPQIRE------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQW 161

Query: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK- 239
                 P +NQ+E+ P L + EL D+C+   + VEAY+PL  T    ++ P +I ++ + 
Sbjct: 162 DGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNEL 219

Query: 240 -NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTF 276
            N      +++ W +Q   + LPK+    R+ +NL  +
Sbjct: 220 NNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVY 257

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 167/318 (52%), Gaps = 45/318 (14%)

Query: 4   NLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQV 63
           NL  ST T  L +G +IP++ LG ++A  E +  + V  AL +GYRH+D A +Y NE +V
Sbjct: 2   NLTPST-TKTLTNGVKIPVLALGVYEAPKE-ETEHTVFTALKSGYRHVDCAQLYGNEREV 59

Query: 64  GEAI-----RDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLG-LDYVDLYLMHWP 115
           G  I         V R EIF TTK+    H   + + ++ +SL+ +  ++Y+DL L+H P
Sbjct: 60  GLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP 119

Query: 116 VSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNL 174
           ++  +  +                         TW+ +Q+   + KVR+IGVSN+S+ +L
Sbjct: 120 IAATEERL------------------------GTWKALQEAYAEGKVRAIGVSNYSIKHL 155

Query: 175 KDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVI 234
           ++L       V P +NQ EL+P L + EL +YC++  + +EA+SPL  T     S+P + 
Sbjct: 156 EELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQ 213

Query: 235 DVAKKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKIS 290
           ++ K +     PA +++ W +Q   I LPKS +++R  +NL+   F + ++D  A+    
Sbjct: 214 ELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL---- 269

Query: 291 QQRGERRINNPNFEPFKT 308
                  +   +F+P KT
Sbjct: 270 THDDTYFLATEDFDPIKT 287

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  138 bits (347), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 143/283 (50%), Gaps = 37/283 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K  KL++G +IP + LGT++    + A   V   +  GYRH DTA +Y NE +VG+ I  
Sbjct: 4   KFYKLSNGIKIPSIALGTYEIPRSQTA-EIVYEGIKCGYRHFDTAVLYGNEKEVGDGITR 62

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRL-GLDYVDLYLMHWPVSLDK 120
                     R +IF TTKLWN+Q  + + + A+ + L  + GL+Y+DL L+H       
Sbjct: 63  WLNEDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIH------- 115

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                SPLE  K              + TW  MQ+ +    V+SIGVSN+   ++ +LL 
Sbjct: 116 -----SPLEGSK------------LRLETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLN 158

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P +NQ+E+ P + + EL DYC+   + VEA++PL       ++ P ++ V K+
Sbjct: 159 WSELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKE 216

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEED 282
               P  V++ W +Q   + LPK+   +R+  NL  ++    D
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSD 259

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  134 bits (338), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 147/285 (51%), Gaps = 39/285 (13%)

Query: 10  KTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRD 69
           K   + +G +IP + LG +     + A N V  AL  GYRH DTA +Y NE +VGE I  
Sbjct: 5   KYYTMVNGIKIPSLALGCYDIPRSQTA-NVVYEALKRGYRHFDTAVLYGNEKEVGEGIYK 63

Query: 70  ------SGVPREEIFVTTKLWNAQ--HHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDK 120
                 +   RE++F TTKLWN+Q  +   +  + E + ++  L Y+DL L+H P+S   
Sbjct: 64  WLKEDPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLS--- 120

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNLKDLLK 179
                          G R        + T++ MQ+ +    V+SIGVSN+   ++++L K
Sbjct: 121 ---------------GPR------RRLETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYK 159

Query: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239
                  P  NQ+E+ P   + +L  +CQ   + VEA+SPL  T    L EP ++ +AKK
Sbjct: 160 WDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKK 217

Query: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEED 282
            G     V++ W +QR ++ LPK+ +  R+++NL+   F L  ED
Sbjct: 218 LGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPED 262

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  135 bits (339), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 159/309 (51%), Gaps = 42/309 (13%)

Query: 9   TKTLKLNDGSQIP---IVGLGT-WQATDERDAYN-----AVRAALDA-GYRHIDTAAIYK 58
           T  + LN+G++IP   I+G GT W   +  D Y+      +  AL+  G  HID A +Y+
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 59  NEVQVGEAIRDSGVPREEIFVTTKLWNAQHHE--PEVALDESLQRLGLDYVDLYLMHWPV 116
              +VGEA+R+S  PR+EIF+T K    +     P+  L  +L+++GL+YVDLYL+H+P+
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI 124

Query: 117 SLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKV-RSIGVSNFSVNNLK 175
              K Y                    D+T    W++M+ L    + ++IGVSNF V +L+
Sbjct: 125 IDPKLY--------------------DFTLEEAWKMMEDLYNEGLAKNIGVSNFRVEDLE 164

Query: 176 DLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYS---PLGSTSAPLLSE 230
            L K+    + P INQ+E +  L      + DYC +N I++EA+    PL   +   L  
Sbjct: 165 QLSKSWV--IKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDLLP 222

Query: 231 PIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAIGK 288
             V  +A+K       ++L W+ QR +I +  S   ERV  A ++ +F L +++ + I K
Sbjct: 223 LYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVEFITK 282

Query: 289 ISQQRGERR 297
           +  Q    R
Sbjct: 283 LGSQHDTIR 291

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  135 bits (339), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/323 (32%), Positives = 171/323 (52%), Gaps = 51/323 (15%)

Query: 14  LNDGSQIP---IVGLGT-WQATDE------RDAYNAVRAALDA-GYRHIDTAAIYKNEVQ 62
           LN+G+++P   I+G GT W  T+E      ++  + ++ AL   G  HID A +Y+   +
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 63  VGEAIRDSG--VPREEIFVTTKLWNAQ---HHEPEVALDESLQRLGLDYVDLYLMHWPVS 117
           VG+A+R+S    PR+EIF+T K ++ Q      P V L   L++LGLDYVDLYL+H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPF- 128

Query: 118 LDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKD 176
                       + K  +G       +T    W+ M+ L K  KV++IGVSNFS+ +L+ 
Sbjct: 129 ------------ISKEKNG-------FTMEEAWKYMEDLYKAGKVKNIGVSNFSMADLQR 169

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG---STSAPLLSE- 230
           +LK+    V P +NQ+E +  L      +V++C++N I+V AY+PLG     S     E 
Sbjct: 170 ILKS--CEVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQEN 227

Query: 231 --PIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAI 286
               V  +A+K     A ++L W+ +R II +  S   +R+  A  L TF L + + + I
Sbjct: 228 FHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEVEKI 287

Query: 287 GKISQQRGERRIN-NPNFEPFKT 308
            ++  +   +R+  N  ++ F +
Sbjct: 288 TQLGLKHEPQRMYWNDQYDKFNS 310

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 160/313 (51%), Gaps = 53/313 (16%)

Query: 12  LKLNDGSQI---PIVGLGTWQATDER------DAYNAVRAALDA-GYRHIDTAAIYKNEV 61
             LN+G++I    I+G GT   T+ +      +  +  + AL   G  H+D A  Y+   
Sbjct: 8   FTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYP 67

Query: 62  QVGEAIRDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLGLDYVDLYLMHWPVSLD 119
           ++ +A+++S  PR EIF+T K          P  AL+ +L  LGLDYVDLY++H+P   D
Sbjct: 68  ELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP-EFD 126

Query: 120 KSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLK 179
             Y   S             +ET W      EL+ K  + K ++IGVSNFS+ +L+ ++K
Sbjct: 127 PEYKDLS-------------IETAWM-----ELLYK--EGKAKNIGVSNFSIEHLERVMK 166

Query: 180 APTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLSEP------ 231
               +V P +NQ+E +  L      +V YCQQN  ++EAYSPL    APL  +P      
Sbjct: 167 --IADVKPQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKNFNEL 220

Query: 232 ----IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDA 285
                + +V+ K G   + ++L W+ +R I+ +  S   ER+  A NL +F L +E+ D 
Sbjct: 221 PFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVDK 280

Query: 286 IGKISQQRGERRI 298
           I K+  ++   R+
Sbjct: 281 ITKLGLEQPALRL 293

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 150/305 (49%), Gaps = 50/305 (16%)

Query: 12  LKLNDGSQIP---IVGLGT-WQATDERDA------YNAVRAALDA-GYRHIDTAAIYKNE 60
            KLN+G ++P   IVG GT W   +E D        + ++ AL   G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLGLDYVDLYLMHWPVSL 118
            +VG A+ ++  PR+EIF+T K W        P V L+  L+RLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 119 DKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDL 177
                      + K  +G       ++    W +M++L    K ++IGVSNF+  +L+ +
Sbjct: 125 -----------ISKETNG-------FSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERV 166

Query: 178 LKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG--------STSAPL 227
           LK     V P +NQ+E +  L      + ++C+QN I++ AYSPLG          S P 
Sbjct: 167 LKV--CKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQPF 224

Query: 228 LSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDA 285
            S   +  +A+     P  V+L W+ +R ++ +  S   ER+  A  +  F L +++   
Sbjct: 225 YS--YINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVTE 282

Query: 286 IGKIS 290
           I K+ 
Sbjct: 283 ITKLG 287

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 159/314 (50%), Gaps = 59/314 (18%)

Query: 8   STKTLKLNDGSQIP---IVGLGT-W--------QATDERDAYNAVRAALDA-GYRHIDTA 54
           S +   LN+G++IP   I+G GT W        + +DE    + ++ AL   G  HID A
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDE--LVDQLQYALTLPGIIHIDAA 61

Query: 55  AIYKNEVQVGEAIRDSGVPREEIFVTTKLWNAQ---HHEPEVALDESLQRLGLDYVDLYL 111
            +Y    +V +A++ +   R+EIF+T K ++        P   L +SL+ L LDYVDLYL
Sbjct: 62  EMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYL 121

Query: 112 MHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFS 170
           +H P        KES                 +T    W+ M+KL K+ K ++IGVSNFS
Sbjct: 122 LHSPF-----ITKES---------------CGYTMEEAWKQMEKLYKDGKAKNIGVSNFS 161

Query: 171 VNNLKDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLL 228
           V++LK +LK     + P INQ+E +  L      +V +CQ + I VEAYSPLG    PL 
Sbjct: 162 VDDLKRILK--ICEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG----PLR 215

Query: 229 SEPI----------VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTF 276
            +P           + ++AKK G     V+L W+ +R I+ +  S   ER+  A +L +F
Sbjct: 216 KKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSF 275

Query: 277 TLPEEDFDAIGKIS 290
            L  E+ + I K+ 
Sbjct: 276 DLTSEEVEKITKLG 289

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  132 bits (333), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 160/306 (52%), Gaps = 48/306 (15%)

Query: 10  KTLKLNDGSQIP---IVGLGT-WQATDERDA------YNAVRAALDA-GYRHIDTAAIYK 58
           K + LN+G++IP   I+G GT W    E DA         +  AL+  G  HID A IY+
Sbjct: 6   KFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYR 65

Query: 59  NEVQVGEAIRDSGVPREEIFVTTKLWNAQ---HHEPEVALDESLQRLGLDYVDLYLMHWP 115
              +VG+A+  +  PR+EIF+T K ++ Q      P   L+ SL+++G DYVDLYL+H P
Sbjct: 66  TYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSP 124

Query: 116 VSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNL 174
                         + K  +G       +T    W+ M++L K  K ++IGVSNF+V +L
Sbjct: 125 F-------------VSKEANG-------FTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDL 164

Query: 175 KDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG---STSAPLLS 229
           + +LK     V P +NQ+E  P L      +  +CQ N I +EAYSPL      +A   S
Sbjct: 165 EKILK--IAEVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDS 222

Query: 230 EPI---VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFD 284
           +P    V ++++K     A ++L W+ +R ++ +  S   +R+  A NL +F L +E+ D
Sbjct: 223 KPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVD 282

Query: 285 AIGKIS 290
            I ++ 
Sbjct: 283 EITELG 288

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  132 bits (331), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 158/306 (51%), Gaps = 52/306 (16%)

Query: 12  LKLNDGSQIP---IVGLGT-WQATDERDAYNA-------VRAALDAGYRHIDTAAIYKNE 60
           + LN+G++IP   I+G GT W   +E DA  +       V A    G  HID A IY+  
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQ---HHEPEVALDESLQRLGLDYVDLYLMHWPVS 117
            +VG+A+  +  PR EIF+T K ++ Q      P V LD +L+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 118 LDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKD 176
                       + K  +G       +T    W+ M++L ++ K ++IGVSNF++ +L+ 
Sbjct: 126 ------------VSKETNG-------FTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLER 166

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG--------STSAP 226
           +LK     + P +NQ+E  P L      +  +CQ+N I +EAYSPLG          S P
Sbjct: 167 ILKV--AEIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESLP 224

Query: 227 LLSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFD 284
                 V ++++K     A + L W+ +R ++ +  S   +R+  A NL +F L +E+ +
Sbjct: 225 FFE--YVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVN 282

Query: 285 AIGKIS 290
            I ++ 
Sbjct: 283 QITELG 288

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  131 bits (329), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 161/310 (51%), Gaps = 44/310 (14%)

Query: 11  TLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI--- 67
           T  L +G ++P +GLG +Q T + +  N V  AL  GYR +D+A +Y NE +    I   
Sbjct: 8   THALKNGVKMPCLGLGLYQ-TPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 68  --RDSGVPREEIFVTTKL--WNAQHHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDKSY 122
                 V R +IF TTK+   +  +   + +++ESL R+  LDY+DL+L+H P++     
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT----- 121

Query: 123 MKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLKAP 181
            KE  L                    TW+  Q+  +  K+++IGVSN+ + +L+++ +  
Sbjct: 122 NKEKRL-------------------GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162

Query: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNG 241
              + P +NQ EL+P L + EL +YC Q  + ++AYSPL  T A  L +P ++ + + + 
Sbjct: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220

Query: 242 VQ--PAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKISQQRGERR 297
            +   A ++++W +Q   + L K+VH +R+  N+K+  F L   D   +    Q      
Sbjct: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQ----YY 276

Query: 298 INNPNFEPFK 307
           ++ P ++P K
Sbjct: 277 LSQPKWDPIK 286

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 166/321 (51%), Gaps = 47/321 (14%)

Query: 11  TLKL-NDGSQIPIVGLGT---WQ----ATDERDAY-----NAVRAALDAGYRHIDTAAIY 57
           TL+L   G +IPI+G G+   W+    + +++D +     + V +A++AG+ HID A  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 58  KNEVQVGEAIRDSGVPREEIFVTTKL----WNAQHHE-PEVALDESLQRLGLDYVDLYLM 112
           K   +VG  +++SGVPR+++++T K     W+ +    P  +L  SL+++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 113 HWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSV 171
           H P       ++ + ++L +                 W  M+++  +   ++IGVSNF V
Sbjct: 127 HVPFIT----VQTAGIDLKE----------------AWRQMEEIYDRGLAKNIGVSNFDV 166

Query: 172 NNLKDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG--STSAPL 227
            +L+ + K      +P +NQ+E +  L Q    ++ YC+ + I VE YSPL   +   P 
Sbjct: 167 ESLEYITK--IGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPG 224

Query: 228 LSEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDA 285
             + ++  +A+K       ++L W+ Q  ++V+  S    RV  + N+  F L  EDFD+
Sbjct: 225 PLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDS 284

Query: 286 IGKISQQRGERRINNPNFEPF 306
           I KI +++  R      +  +
Sbjct: 285 ITKIGREKIFRGFMGEQYSKY 305

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 160/310 (51%), Gaps = 48/310 (15%)

Query: 14  LNDGSQIP---IVGLGT-WQATDERDAYNA-------VRAALDAGYRHIDTAAIYKNEVQ 62
           LN+G++IP   I+G GT W   +E DA  +       V A    G  HID A IY+   +
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQ---HHEPEVALDESLQRLGLDYVDLYLMHWPVSLD 119
           VG+A+  +  PR  IF+T K ++ Q      P   LD +L+++G DYVDLYL+H P    
Sbjct: 70  VGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPF--- 125

Query: 120 KSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLL 178
                     + K  +G    E        W+ M++L K+ K ++IGVSNF+V +L+ +L
Sbjct: 126 ----------VSKEVNGLSLEE-------AWKDMEQLYKSGKAKNIGVSNFAVEDLQRIL 168

Query: 179 KAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG---STSAPLLSEPI- 232
           K     V P +NQ+E  P L      +  +CQ++ I VEAYSPLG     +A   S+P  
Sbjct: 169 K--VAEVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFF 226

Query: 233 --VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAIGK 288
             V ++++K     A ++L W+ +R ++ +  S   +R+  A NL +F L  E+ D I +
Sbjct: 227 EYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITE 286

Query: 289 ISQQRGERRI 298
           +  +    R+
Sbjct: 287 LGLEHEPLRL 296

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  125 bits (315), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 145/304 (47%), Gaps = 46/304 (15%)

Query: 14  LNDGSQIP---IVGLGT-WQATDERDA------YNAVRAALDA-GYRHIDTAAIYKNEVQ 62
           LN+G ++P   I+G GT W    E+D          +  AL   G  HID A +Y    +
Sbjct: 10  LNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGTYPE 69

Query: 63  VGEAIRDSGVPREEIFVTTK--LWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           +  A+R +  PR EIF+T K  L  A   +P   L++SL+   LDYVDLYL+H P     
Sbjct: 70  LSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHSPF---- 125

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLK 179
              KE P                 T    W  M++L K+ K ++IGVSNFSV +LK +L 
Sbjct: 126 -VAKEKP---------------GLTLEGAWRQMEQLYKDGKAKNIGVSNFSVEDLKRVLS 169

Query: 180 APTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLSE------P 231
                + P +NQ+E HP L      ++ +CQ   IE+EA++PLG        +       
Sbjct: 170 --VAEIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDENDEFFK 227

Query: 232 IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAIGKI 289
            +  ++ K     A ++L W+ +R +I +  S   +R+  A NL  F L +E+   I ++
Sbjct: 228 YISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLEDEEVTKITRL 287

Query: 290 SQQR 293
             Q 
Sbjct: 288 GLQH 291

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  124 bits (312), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/301 (30%), Positives = 155/301 (51%), Gaps = 48/301 (15%)

Query: 14  LNDGSQIP---IVGLGT-WQATDE------RDAYNAVRAALDA-GYRHIDTAAIYKNEVQ 62
           LN+G++IP   +VG GT W   +E      ++    ++ AL   G  H+D A  Y    +
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQHHEPEV--ALDESLQRLGLDYVDLYLMHWPVSLDK 120
           +G+A+R+S  PR+EIF+T K      +   V    +  ++++G+DYVDLYL+H P+    
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL---- 144

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDLLK 179
                    + K  +G        T    W+ ++KL    K ++IGVSNF V +L+ +LK
Sbjct: 145 ---------IEKEKNGV-------TLEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQRILK 188

Query: 180 APTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG------STSAPLLSEP 231
                V P +NQ+E H  L      +V + Q N I++EAY+PLG      S +    +  
Sbjct: 189 V--AKVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFYN-- 244

Query: 232 IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAIGKI 289
            V ++AKK G   A V+L W+ +R+++ +  S   +R+  A +L +F L +E+   I ++
Sbjct: 245 YVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKITEL 304

Query: 290 S 290
            
Sbjct: 305 G 305

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  122 bits (307), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 152/302 (50%), Gaps = 48/302 (15%)

Query: 14  LNDGSQIP---IVGLGT-WQATDERDA------YNAVRAALD-AGYRHIDTAAIYKNEVQ 62
           LN+G++IP   ++G GT W   +E DA         +  AL   G  H+D A +Y+   +
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQH---HEPEVALDESLQRLGLDYVDLYLMHWPVSLD 119
             EA++++  PR EIFVT K ++ Q    ++P   LD  L+R GL+YVDLYL+H P +  
Sbjct: 70  FSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFA-- 126

Query: 120 KSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDLL 178
                       K  +G       +T    W  +++L  + K ++IGVSNF V +L+ +L
Sbjct: 127 -----------SKEKNG-------FTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEKIL 168

Query: 179 KAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLSEP----- 231
           K     V P +NQ+E    L      +V + Q + I++EAY+PLG  S    SE      
Sbjct: 169 K--VAKVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPFY 226

Query: 232 -IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAIGK 288
             +  + +K     A ++L W+ +R I+ +  S   +R+  A NL  F L +++ D I K
Sbjct: 227 DYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEITK 286

Query: 289 IS 290
           + 
Sbjct: 287 LG 288

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  122 bits (305), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 142/304 (46%), Gaps = 54/304 (17%)

Query: 18  SQIPIVGLGT---WQATDERDA---------YNAVRAALDAGYRHIDTAAIYKNEVQVGE 65
           + IP++G GT   W+                 + +  A+D G+ HIDTA  Y    +VGE
Sbjct: 16  THIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEEVGE 75

Query: 66  AIRDSGVPREEIFVTTKL----WNA-QHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           A+R S +PR+++F+T K     W       P  A  + L+ LG+ Y DLY++H       
Sbjct: 76  ALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLH------- 128

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKV-RSIGVSNFSVNNLKDLLK 179
                       RPD T+           W  +++L +  + ++IGVSNF +  LK +  
Sbjct: 129 ------------RPDITKE-NAGIDLQEAWRQVEELYEAGIAKAIGVSNFPLETLKQM-- 173

Query: 180 APTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLS------EP 231
                 +P ++QVE HP L      +V++CQ   I VEAYSPL    APL        + 
Sbjct: 174 ESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARPGPLDD 229

Query: 232 IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKI 289
           I+ ++ KK G     +VL W++ R I+ L  S   ER+   L T  F L + D + I ++
Sbjct: 230 ILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVELINEV 289

Query: 290 SQQR 293
             ++
Sbjct: 290 GSKK 293

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  119 bits (298), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 85/303 (28%), Positives = 146/303 (48%), Gaps = 46/303 (15%)

Query: 15  NDGSQIPIVGLGT---WQAT----DERDAY-----NAVRAALDAGYRHIDTAAIYKNEVQ 62
             G ++P++G G+   W+      +++D +     + V  A+ AG+ HID A  YK   +
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 63  VGEAIRDSGVPREEIFVTTKL----WNAQHHE-PEVALDESLQRLGLDYVDLYLMHWPVS 117
           VG  I +SGVPRE+++VT K     W  +  + P  +L+ SL ++ + YVDLYL+H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPF- 130

Query: 118 LDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKD 176
                                P          W  M+++  +   ++IGVSNF V +L+ 
Sbjct: 131 -------------------INPETAGIDLKEAWRQMEEIYDRGWAKNIGVSNFDVESLEY 171

Query: 177 LLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG--STSAPLLSEPI 232
           +         P +NQ+E    + Q    ++ YC+++ I +E YSPL   +   P   + I
Sbjct: 172 I--RTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPLDDI 229

Query: 233 VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKIS 290
           +  +AKK G     ++L W+VQ  +I +  S   +R+  +L    F L  EDF +I ++ 
Sbjct: 230 LPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSITEVG 289

Query: 291 QQR 293
           + +
Sbjct: 290 KTK 292

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  119 bits (298), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 157/320 (49%), Gaps = 47/320 (14%)

Query: 11  TLKLNDGSQIPIVGLGT---WQ----ATDERDAY-----NAVRAALDAGYRHIDTAAIYK 58
           TLK   G  +P +G G+   W+    +   +  Y     + V  A+  G+ HIDTA  YK
Sbjct: 10  TLK-GSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYK 68

Query: 59  NEVQVGEAIRDSGVPREEIFVTTKL--WNAQHHE---PEVALDESLQRLGLDYVDLYLMH 113
              +VG  I ++ VPRE +++T K   W+ +  +   P  +L  SL+ + LDYVDLY++H
Sbjct: 69  TYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH 128

Query: 114 WPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKV-RSIGVSNFSVN 172
            P    K+    + ++L +                 W  M+++   K+ R+IGVSNF V 
Sbjct: 129 VPNITTKT----AGIDLKE----------------AWLQMEEIYTRKMARNIGVSNFDVE 168

Query: 173 NLKDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLG--STSAPLL 228
           +L+ +         P +NQ+E    + Q    ++ YC++N I VE YSPL   +   P  
Sbjct: 169 SLEYI--KSFAKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGP 226

Query: 229 SEPIVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDAI 286
            + I+  +A K G     V+L W+ Q  I+V+  +   ER+  + N+  F L +EDFD I
Sbjct: 227 LDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQI 286

Query: 287 GKISQQRGERRINNPNFEPF 306
             + +++  R   +  +E +
Sbjct: 287 TNVGREKILRNYMHMLYEKY 306

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  117 bits (293), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 157/313 (50%), Gaps = 54/313 (17%)

Query: 14  LNDGSQIP---IVGLGT-WQATDER------DAYNAVRAALDA-GYRHIDTAAIYKNEVQ 62
           LN+G++IP   ++G GT W  T+E       +  + V+ AL   G  HID A IY+   +
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 63  VGEAIRDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120
           +G+A+R++  PR EI++T K   +      P V  +  L+ LG+DY+DLYL+H P     
Sbjct: 70  LGKALRETKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSP----- 124

Query: 121 SYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLK 179
            ++ E                  +T    W+ +++L K+ K ++IGVSNF+  +L+ +LK
Sbjct: 125 -FITEG--------------RNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILK 169

Query: 180 APTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPLGSTSAPLLSEP------ 231
                + P +NQ+E    L      + ++ ++N I +EAYSPLG    PL   P      
Sbjct: 170 --IAEIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLG----PLQRRPEEADSL 223

Query: 232 ----IVIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERV--AANLKTFTLPEEDFDA 285
                + ++A+K G   A V+L W+ +R ++ +  S    RV  A ++ TF L   + + 
Sbjct: 224 PFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEK 283

Query: 286 IGKISQQRGERRI 298
           I ++  +    R+
Sbjct: 284 ITELGLKHEALRL 296

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  100 bits (249), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 146/313 (46%), Gaps = 46/313 (14%)

Query: 8   STKTLKLNDGSQIP---IVGLGT-W-QATDERDAYNAVRAALDA-----GYRHIDTAAIY 57
           + +   LN+G+ IP    VG+G  W +    RD    +   L       G+ HI TA  Y
Sbjct: 5   TKRFFTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFY 64

Query: 58  KNEVQVGEAIRDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLGLDYVDLYLMHWP 115
            N   +  A++ S  PR EI++T K  +       P  AL+ SL RLG DYVDLYL+H P
Sbjct: 65  PNNGLLSAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNP 124

Query: 116 VSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNL 174
             LD S            P+G        +    W+ M+ L K  KV++IGVSNF + +L
Sbjct: 125 C-LDSS------------PNGI-------SLEKAWKQMELLYKTGKVKNIGVSNFRIEDL 164

Query: 175 KDLLKAPTTNVVPTINQVELHPLLPQY--ELVDYCQQNKIEVEAYS---PLGSTSAPLLS 229
           + L  A    + P +N++E H  L      + +Y + + + +  YS   PL + +   + 
Sbjct: 165 ERLKDA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMD 221

Query: 230 EPI---VIDVAKKNGVQPAHVVLSWIVQRNI--IVLPKSVHAERVAANLKTFTLPEEDFD 284
            P    +I +A+K     A ++L W+    +  ++    V   + A+++ +F L  E+ D
Sbjct: 222 FPFYRYIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELD 281

Query: 285 AIGKISQQRGERR 297
            I ++ ++    R
Sbjct: 282 MITELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 61/103 (59%), Gaps = 7/103 (6%)

Query: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66
           N     KLN+G QIP++G G ++   E D  + V +AL  GYRHIDTA +Y+N+ +  + 
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKE-DTADRVYSALKDGYRHIDTAVLYRNQKEAAQG 66

Query: 67  IR----DSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLD 105
           +R    ++G  RE I+ TTKLW++Q    E    ++LQ +  D
Sbjct: 67  VRKYLDETGEARENIWFTTKLWDSQFGREETK--KALQEVAAD 107

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 121/308 (39%), Gaps = 69/308 (22%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +N ++   D G R  DTA  Y N   E+ +GE ++   + RE + + TK++
Sbjct: 11  WVEEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYSEILLGEFLKKYKIKRETVVILTKIF 70

Query: 85  NAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK-SYMKESPLELMKRPDGT-RPVET 142
                     +DE+L        DL+L   P+ +D+   + +  L      DG  R VE 
Sbjct: 71  --------FPVDETL--------DLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVER 114

Query: 143 DWTFINTWEL------------MQKL----PKNKVRSIGVSNFSVNNLKDL-LKAPTTNV 185
             T+I+  ++            M+ L     K  VR IG S+       ++   A     
Sbjct: 115 LGTYIDVLQIHRFDQDTPIKERMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEW 174

Query: 186 VPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGSTSAPLLSEPIV 233
              +N   L+ L+    + EL+ +C+++ I +  +S         P+GST+    ++P V
Sbjct: 175 FQFVNSQSLYNLIYREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFV 234

Query: 234 I-------------------DVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLK 274
                               ++AKK     A +  +W++ +  + +       RV   +K
Sbjct: 235 KCTLTKKLEKSDIEIINRVEELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIK 294

Query: 275 TFTLPEED 282
              +   D
Sbjct: 295 ALKVKFTD 302

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 84/177 (47%), Gaps = 29/177 (16%)

Query: 51  IDTAA--IYKNEV-QVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVAL--DESLQRLGLD 105
           ID AA  IYK    +VGEA+  +  P+ EIF+T K          +A+  D +L+++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 106 YVDLYLMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIG 165
           YVD++ +H P    ++        ++   D           ++T  L +    NK  + G
Sbjct: 67  YVDMHFLHSPFVFKQA-------NVLNLKDA----------MHTDHLRR---SNKANNRG 106

Query: 166 VSNFSVNNLKDLLKAPTTNVVPTINQVELHPLLPQYE--LVDYCQQNKIEVEAYSPL 220
            S+ +V  L+ +LK  T +  P +NQ++L   L      +   CQ+N I +  YS L
Sbjct: 107 ASSVNVEELRRVLK--TEDEEPQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 124/320 (38%), Gaps = 89/320 (27%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++ A D G R  DTA +Y N   E  +GE +R   +PRE + + TK++
Sbjct: 34  WVLDDKEEIFGILKHAYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVF 93

Query: 85  ------------------------NAQHHEPEV---ALDESLQRLGLDYVDLYLMHWPVS 117
                                   N QH   +    A+  S++RLG  Y+D+Y +H    
Sbjct: 94  FPVDDKMDISSNRTKTEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH---- 148

Query: 118 LDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDL 177
                          R D   P E     +N       + +  VR +G S+       ++
Sbjct: 149 ---------------RCDHETPFEETMRALN-----DVVEQGDVRYLGASSMLAVEFAEM 188

Query: 178 -LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLG--- 221
              A        +N    + L+    + E++ +C+++ I +  +S         PLG   
Sbjct: 189 QFIAEKHGWHKFVNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHT 248

Query: 222 ---STSAPLL---------SEPIVID----VAKKNGVQPAHVVLSWIVQRNIIVLPKSVH 265
              ST   L+         SE  +I+    +A K  ++   + L W++Q+  + +     
Sbjct: 249 HRESTDGVLIARKLNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSS 308

Query: 266 AERVAANLKTFT--LPEEDF 283
            ERV   +KT T  L E+D 
Sbjct: 309 IERVDEAIKTLTTKLTEDDM 328

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 120/324 (37%), Gaps = 98/324 (30%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++ A D+G R  DTA  Y N   E+ +GE +++  +PRE + + TK+W
Sbjct: 34  WIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEILLGEFLKEYEIPRETVIIMTKVW 93

Query: 85  N-----------------------------AQHHEPEVALDESLQRLGLDYVDLYLMHWP 115
                                         ++ H  E A   S++RLG  Y+D+Y +H  
Sbjct: 94  APVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIE-ACKNSVRRLG-TYIDVYQIH-- 149

Query: 116 VSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLK 175
                            R D   P+E     +N  +++Q   +   R IG S+       
Sbjct: 150 -----------------RADQDTPMEETMRALN--DVVQ---QGLTRYIGASSMLGTEFA 187

Query: 176 DL-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEP 231
           +    A        +N  + + LL    + E++ Y +++ I    +SPL      LLS P
Sbjct: 188 EYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPL---QRGLLSRP 244

Query: 232 I-------------------------------VIDVAKKNGVQPAHVVLSWIVQRNIIVL 260
           +                               V  VA K G+  A V  +W++ +    +
Sbjct: 245 VEVSSYREDNDRVLKGRRLNQYEDFEIEIINRVEQVAVKKGITMAEVATAWLLSKGTFPI 304

Query: 261 PKSVHAERVAANLKTF--TLPEED 282
                 +RV   +K    TL EE+
Sbjct: 305 LGLNSVQRVKEAIKALDVTLTEEE 328

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 121/313 (38%), Gaps = 78/313 (24%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++   D G R  DTA +Y N   E  +GE ++   + RE + + +K++
Sbjct: 34  WVLEDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIF 93

Query: 85  NAQHHEPEVALDESL-----QRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGTRP 139
                     +DESL      ++  +Y+DL L  +   L++ ++                
Sbjct: 94  --------FPVDESLDLHQGSKVDQEYIDLQL-SFQQGLNRKHIMAGV---------ANS 135

Query: 140 VETDWTFINTW------------ELMQKL----PKNKVRSIGVSNFSVNNLKDL-LKAPT 182
           VE   T+I+              E+M+ L       +VR IG S+       +L   A  
Sbjct: 136 VERLGTYIDILQIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQ 195

Query: 183 TNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGSTSAPLLSE 230
                 IN    + +L    + EL+ +C+++ + +  +S         P   T   +LS+
Sbjct: 196 NGWFQFINVQSYYNVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSD 255

Query: 231 PIVID-------------------VAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAA 271
           P  I                    +AKK G+  A V ++WI+ +    +      ERV  
Sbjct: 256 PTFIKMGLDKLDESDKEIIGVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDE 315

Query: 272 NLKT----FTLPE 280
            ++     FT+ E
Sbjct: 316 AIRAIDVKFTVEE 328

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 110/303 (36%), Gaps = 86/303 (28%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D    +  ++ A D G R  DTA +Y N   E+ +GE +++  +PRE + + TKL+
Sbjct: 34  WVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEIILGEFLKNYKIPRETVIIMTKLY 93

Query: 85  -----NAQHH----EPEVALD-----------------ESLQRLGLDYVDLYLMHWPVSL 118
                NA +      PE  L+                 +S++RLG  Y D+  +H     
Sbjct: 94  FPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSARDSVRRLGT-YADIIQIH----- 147

Query: 119 DKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDL- 177
                         R D   P E     +N       +     R IG S+       ++ 
Sbjct: 148 --------------RADPDTPFEETMRALN-----DIVVDGLTRYIGASSMLATEFVEMQ 188

Query: 178 LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPL---------GSTSA 225
             A   +    IN    + LL    + EL+ + +++ I +  +SPL         G TS 
Sbjct: 189 FIAEKNDWFKFINSQSCYNLLYREDERELIPFAKRHNIALTPWSPLQRGVLCRPVGETST 248

Query: 226 PLLSEPI-------------------VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHA 266
               +                     V ++AKK   + A V L W++Q+    +      
Sbjct: 249 RFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVALYWVIQKGCFPIVGMSKI 308

Query: 267 ERV 269
           +R+
Sbjct: 309 DRI 311

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
          (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKL 83
          W   D+ +A+  ++ A D G R  DTA +Y N   E+ +GE +R   +PRE + + TKL
Sbjct: 34 WVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYNIPRETVVIMTKL 92

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 74/168 (44%), Gaps = 42/168 (25%)

Query: 40  VRAALDAGYRHIDTAAIYK-NEVQVGEAIRD--SGVPREEIFVTTKL-------WNAQHH 89
           +R A+  G   IDT+  Y  +E+  G+A+++     PREE F+ TK+       +N    
Sbjct: 47  LRYAMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKE 106

Query: 90  EPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINT 149
               ++  S +RL  DY+DL  +H     D  Y                 VE D      
Sbjct: 107 NVRFSVKRSCERLHTDYLDLVYLH-----DIEY-----------------VEYD----KI 140

Query: 150 WELMQKLPKNK----VRSIGVSNFSVNNLKDLLKAPTTNVVPTINQVE 193
           WE +++L K K    +R IG+S + V+ L  L  + T   VP I  ++
Sbjct: 141 WEALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVPEIGPLD 186

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 108/295 (36%), Gaps = 92/295 (31%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   +  DAY  ++ A D G R  DTA  Y N   E  +G  ++   +PRE + + TK++
Sbjct: 34  WAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSETILGSFLKHYNIPRETVVIMTKVF 93

Query: 85  N-------------------------------AQHHEPEVALDESLQRLGLDYVDLYLMH 113
                                           ++ H  E A + S++RLG  Y+D+Y +H
Sbjct: 94  YRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHILEAAKN-SVRRLG-TYIDVYQIH 151

Query: 114 WPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNN 173
                              R D   P E     +N       + +   R IG S+     
Sbjct: 152 -------------------RCDHETPFEETMRALN-----DVVEQGYARYIGASSMLGTE 187

Query: 174 LKDL-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPL--GSTSAPL 227
             +    A        +N    + LL    + E++ +C++N + +  +SPL  G  + P+
Sbjct: 188 FAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPLQMGFLARPI 247

Query: 228 LSEPI----------------------VID----VAKKNGVQPAHVVLSWIVQRN 256
             + +                      +ID    +A K  ++ A V L+W+ ++N
Sbjct: 248 TEKSVRQTTDLVIKAMSLDKFSEADKEIIDRVNKLANKKNLKMATVTLAWLFKKN 302

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 94/227 (41%), Gaps = 26/227 (11%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++   D G R  DTA +Y N   E  +GE ++   +PRE + + +KL 
Sbjct: 34  WVEDDKTKIFGILKHCYDRGMRTFDTANVYSNGLSETLLGEFLKHYNIPRETVVIMSKLN 93

Query: 85  NAQHHEPEV-ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGT------ 137
            A   +     L E  + L L +V++        L +  +  S  E ++R  GT      
Sbjct: 94  FATDDKVSFETLKERSEELNLHFVNM------SGLSRKNIMASAKESVRRL-GTYIDVLQ 146

Query: 138 -RPVETDWTFINTWELMQKLPKNKV-RSIGVSNFSVNNLKDL-LKAPTTNVVPTINQVEL 194
               + D  +  T   +  L ++ + R IG S+       ++   A        IN    
Sbjct: 147 IHRADRDTPYEETMRALNDLVESGITRYIGASSMLATEFAEMQFTAEKYGWFKFINSQSC 206

Query: 195 HPLL---PQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238
           + LL    + EL+ + +++ I +  +SPL      LL+ P+ I   +
Sbjct: 207 YNLLYREDERELMPFAKRHNIALTPWSPL---QRGLLTRPVGIKTTR 250

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 116/276 (42%), Gaps = 75/276 (27%)

Query: 4   NLKNSTKTLKLNDGSQIP--IVGLGTWQATDERDAYNA-----VRAALDAGYRHIDTAAI 56
            L+ + + +K  D  ++P  I+G  T       D Y       VR AL+AG   IDT+  
Sbjct: 17  ELRTTVRRVKELDIVELPELILGGATLSPRYIDDPYEVPTLGLVRRALEAGICAIDTSPY 76

Query: 57  Y-KNEVQVGE---AIRDSGVPREEIFVTTKL---------WNAQHHEPEVALDESLQRLG 103
           Y K+E   GE   A+RD   PRE  F+ TK+         ++A H     ++  S  RL 
Sbjct: 77  YGKSEEIYGEALAAVRDEH-PRETYFICTKVGREGPSDFDYSAAH--VRASVHRSCARLH 133

Query: 104 LDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNK--- 160
            +Y+DL  +H     D  +++ +                       WE +Q+L + K   
Sbjct: 134 TEYLDLVYLH-----DIEFVEAA---------------------GIWEALQELRRLKDEG 167

Query: 161 -VRSIGVSNFSVNNLKDLLKAPTT-------NVVPTINQVELHP--LLPQYELVDYCQQN 210
            +R  G+S + V  L+++ +           + V T  Q+ L    LL Q E   + +Q+
Sbjct: 168 VIRFFGISGYPVELLQEVSEQACERPDVGPLDAVLTYCQLTLQSVRLLEQEE--RFFRQS 225

Query: 211 KIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGVQPAH 246
           ++ V     LG++S       + + + +  G +P H
Sbjct: 226 RVRV-----LGNSSI------VGMRLLRSGGPRPFH 250

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 94/245 (38%), Gaps = 64/245 (26%)

Query: 24  GLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE----VQVGEAIRDSGVPREEIFV 79
           G   W   D++ +Y  ++ A D G R  DTA +Y N     + +GE +++  + RE + +
Sbjct: 7   GWHKWVIDDKQKSYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEYNISRETVVI 66

Query: 80  TTKLW-------------NAQHHEPEV---------------ALDESLQRLGLDYVDLYL 111
            TKL+                H    +               A   SL+RLG  Y+D+Y 
Sbjct: 67  MTKLFAPVDDTLPDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGT-YIDVYQ 125

Query: 112 MHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSV 171
           +H                   R D   P+E     +N  +++Q   +   R IG S+   
Sbjct: 126 VH-------------------RADPDTPMEETMRALN--DVVQ---QGLTRYIGASSMLG 161

Query: 172 NNLKDL-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPLGSTSAPL 227
               +    A        +N  + + LL    + E++ Y +++ I    +SPL      L
Sbjct: 162 TKFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPL---QRGL 218

Query: 228 LSEPI 232
           LS P+
Sbjct: 219 LSRPV 223

>KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 126/324 (38%), Gaps = 67/324 (20%)

Query: 11  TLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ---VGEAI 67
            +   D  +IP      W   DE   +  ++   D G R  DTA +Y N V    +G+ +
Sbjct: 23  CMSYGDRKRIP------WVIEDEEKVFEILKYCYDHGVRTFDTANVYSNGVSERLLGKFL 76

Query: 68  RDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESP 127
           +   + RE + + TK++          +DESL+   +   +  L    +S  +   +++ 
Sbjct: 77  KKYNINRETVVILTKVY--------FPVDESLEPFKIGGENDPLTDVTLSNQRGLSRKNI 128

Query: 128 LELMKRPDGTRPVETDWTFINTW------------ELMQKL----PKNKVRSIGVSNFSV 171
           L  +      + VE   T+I+              E+M+ L      NKVR +G S    
Sbjct: 129 LASVD-----KSVERLGTYIDVLQIHRLDHECTGKEIMKALNDVVESNKVRYVGASTMLA 183

Query: 172 NNLKDL-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSP--LGSTSA 225
               +L + A   +    ++    + LL    + EL+ Y ++N I V  +SP   G    
Sbjct: 184 TEFVELQMIAEKYDWFQFVSSQTEYSLLFREDERELLSYTKRNNIAVLPWSPNAGGYLCR 243

Query: 226 PL---------------------LSEPIVIDVAKKNGVQPAHVVLSWIVQR--NIIVLPK 262
           PL                     ++   V ++AKK  V  A +  +W++ +  N I+   
Sbjct: 244 PLDAATERSNSNTYKTEITEGDKITIKRVEEIAKKKSVSMAMISEAWVMSKGYNPIIGFS 303

Query: 263 SVHAERVAANLKTFTLPEEDFDAI 286
           SV   + A       L EE+ + +
Sbjct: 304 SVERVKEAIEATKIELTEEEINYL 327

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 65/316 (20%), Positives = 115/316 (36%), Gaps = 91/316 (28%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++   D G R  DTA  Y N   E  +GE +    + RE + + TK++
Sbjct: 35  WVEDDKNTIFGILKYCYDKGLRTFDTADYYSNGLSEKLLGEFLVKYNIKRETVVIMTKIF 94

Query: 85  -------NAQHHEPEVALDE--------------------SLQRLGLDYVDLYLMHWPVS 117
                  N + + P   L E                    ++ RLG  Y+D+  +H    
Sbjct: 95  FPFDETLNLKSNTPLSELQELDVVNQRGLSRKHILDGVEKAIARLG-TYIDVLQIH---- 149

Query: 118 LDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDL 177
                          R D   P++     +N       +    VR IG S+       ++
Sbjct: 150 ---------------RFDPETPIKETMKALN-----DVIESGHVRYIGASSMLATQFAEM 189

Query: 178 -LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGSTS 224
              A   N    +N   ++ L+    + EL+ +C+++ I +  +S         P+G+ S
Sbjct: 190 QFIADKYNWFQFVNAQSMYNLVYREDERELIPFCKRHNIALTPWSPNHRGFLTRPIGTKS 249

Query: 225 APLLSEPIVI-------------------DVAKKNGVQPAHVVLSWIVQRN---IIVLPK 262
               S+   I                   ++A+K GV  A +  +W+V +    II L K
Sbjct: 250 LRSESDRFTINKLRDNVLESDIKIVKRVEELAEKKGVSMAAISTAWVVSKGCQPIIGLSK 309

Query: 263 SVHAERVAANLK-TFT 277
           +   +   + L  TFT
Sbjct: 310 TERVDDAISALSVTFT 325

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 21/109 (19%)

Query: 26  GTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE---VQVGEAIRDSGVPREEIFVTTK 82
           G     D+  A+  + A  +AG   IDTA  Y+NE     +GE + +S   R++I + TK
Sbjct: 45  GYMGTMDKERAFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWM-ESRKLRDQIVIATK 103

Query: 83  L-----W------------NAQHHEPEVALDESLQRLGLDYVDLYLMHW 114
                 W                H   V++ +SL++L  D++D+  +HW
Sbjct: 104 FSTDYKWYDVGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 125/311 (40%), Gaps = 72/311 (23%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ---VGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++   D G R  DTA +Y N +    VGE ++   + RE + + TK++
Sbjct: 34  WVMEDKDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIF 93

Query: 85  NAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDG-TRPVETD 143
                     +DESL       V+   M   ++L +   ++  +      DG    VE  
Sbjct: 94  --------FPVDESLDLHHGSNVNQEAMELQLTLQRGLSRKHII------DGVANSVERL 139

Query: 144 WTFINTW------------ELMQKL----PKNKVRSIGVSNFSVNNLKDL-LKAPTTNVV 186
            T+I+              E+M+ L       +VR IG S+       +L   A      
Sbjct: 140 GTYIDVLQIHRLDEETSMEEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGWF 199

Query: 187 PTINQVELHPLL---PQYELVDYCQQNKIEVEAYSP--LGSTSAP-------LLSEPI-- 232
             I+    + L+    + EL+ +C+++ + +  +SP   G  + P       +L++P   
Sbjct: 200 KFISAQSYYNLINREDERELIPFCKKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFN 259

Query: 233 -----------------VIDVAKKNGVQPAHVVLSWIVQR--NIIVLPKSVHAERVAANL 273
                            +  VA++  V  A + ++W + +  N IV   SV  ERV   +
Sbjct: 260 RMRLNELGDDEKEIVRRIQMVAERRSVTMAIISMAWTLHKGCNPIVGLNSV--ERVDEAV 317

Query: 274 KT--FTLPEED 282
           K   FTL E++
Sbjct: 318 KAIEFTLTEDE 328

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa]
          {ON} 
          Length = 343

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ---VGEAIRDSGVPREEIFVTTKLW 84
          W   D+   +N ++   D G R  DTA +Y N V    +GE ++   + RE + + TK++
Sbjct: 34 WVIEDKEKIFNILKHCYDNGLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIF 93

Query: 85 NA 86
           A
Sbjct: 94 YA 95

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 97/262 (37%), Gaps = 68/262 (25%)

Query: 38  NAVRAALDAGYRHIDTAAIY-KNEVQVGEAI---RDSGVPREEIFVTTKLWNAQHHEPEV 93
           N +   L AG + IDTA IY  NE  +GE     R +   +   F    L     ++   
Sbjct: 19  NEIVTVLKAGVKDIDTARIYPDNEKAIGELQLPDRFTIHTKASGFSGGCLTRDNINK--- 75

Query: 94  ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELM 153
           +++ESL  LG+  V+ +L+H                    PD   P+E     IN+    
Sbjct: 76  SIEESLSLLGVPSVETFLLH-------------------SPDPEIPLEETLDAINSL--- 113

Query: 154 QKLPKNKVRSIGVSNFSVNNLKDLLKAPTTN--VVPTINQVELHPLLPQY--ELVDYCQQ 209
               + K    G+SNFS  ++K +     +   V+PT+ Q   + L      +L    ++
Sbjct: 114 --YEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNALSRAIVNDLFPLLKE 171

Query: 210 NKIEVEAYSP--------------------------LGSTSAPLLSEPIVI-------DV 236
             I + AYSP                          +G     L + P +I        +
Sbjct: 172 LHISLYAYSPIARGFLAETPEEILGEKSGRFDNSTMIGQMYLKLYNRPAIIKGLEEWNKL 231

Query: 237 AKKNGVQPAHVVLSWIVQRNII 258
           AKK G+    +   WIV  + +
Sbjct: 232 AKKTGISKYSLAYRWIVHNSFL 253

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 40  VRAALDAGYRHIDTAAIYKN-EVQVGEAIRDSG--VPREEIFVTTKLWNAQHHEPEVALD 96
           +R A + G   IDT+  Y N E+ +G+A+ + G   PR+   + TK+        + + D
Sbjct: 30  LRVAFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSAD 89

Query: 97  -------ESLQRLGLDYVDLYLMH 113
                   S +RL  DY+DL  +H
Sbjct: 90  NVRRSVVRSCKRLNSDYLDLVYLH 113

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 52/105 (49%), Gaps = 21/105 (20%)

Query: 30  ATDERDAYNAVRAALDAGYRHIDTAAIYKNE---VQVGEAIRDSGVPREEIFVTTKL--- 83
           + ++  A+  + A  +AG   IDTA  Y+NE   + +GE ++   + R++I + TK    
Sbjct: 3   SMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGD 61

Query: 84  -------------WNAQH-HEPEVALDESLQRLGLDYVDLYLMHW 114
                        +   H H   V++ +SL++L  D++D+  +HW
Sbjct: 62  YKKYEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 120/302 (39%), Gaps = 55/302 (18%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   +E + +  ++   D G R  DTA  Y N   E  VG+ ++   + RE + + TK++
Sbjct: 34  WVLDNEEEIFKVLKHCYDNGLRTFDTADFYSNGLSERLVGKFLKRYNINRETVVILTKVF 93

Query: 85  -------NAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK-ESPLELMK--RP 134
                  +  H +    +DE+ Q    +   L   H    + KS  +  + +++++  R 
Sbjct: 94  FPVDETLDLSHSK---GMDEATQLTVANQRGLSRKHILDGVAKSVERLGTYIDVLQIHRF 150

Query: 135 DGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDL-LKAPTTNVVPTINQVE 193
           D   PV      +N       + K   R IG S+       +L   A   +    I+   
Sbjct: 151 DTETPVNETMKALN-----DVVSKGYARYIGASSMLATQFAELQFVAEKHDWFKFISSQS 205

Query: 194 LHPLL---PQYELVDYCQQNKIEVEAYSP--LGSTSAPLLSEPI---------------- 232
            + LL    + EL+ + +++ I +  +SP   G  + PL ++ +                
Sbjct: 206 CYNLLYREDERELIPFAKRHNIGLIPWSPNARGVLTRPLGTQTLRHSTDFGLKRISAFDL 265

Query: 233 ----------VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPE 280
                     V ++A+K GV  A V ++W++ +    +      ERV   +K   F L E
Sbjct: 266 QPHEEEIVRRVGEIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTE 325

Query: 281 ED 282
           E+
Sbjct: 326 EE 327

>ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} similar
           to uniprot|Q02895 Saccharomyces cerevisiae YPL088W
           Putative aryl alcohol dehydrogenase transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 343

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 11/76 (14%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D++  ++ ++   D G R  DTA +Y N   E  VGE +R   + RE + + TK++
Sbjct: 35  WVVEDKQRIFSILKHCYDRGLRTFDTADVYSNGMSERLVGEFLRHYNINRETVVILTKVY 94

Query: 85  NAQHHEPEVALDESLQ 100
                     +DES+Q
Sbjct: 95  --------FPVDESIQ 102

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 90/243 (37%), Gaps = 63/243 (25%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ---VGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++   D G R  DTA +Y N +    +GE ++   + RE + + TK +
Sbjct: 35  WVQDDKEKVFEILKHCYDRGLRTFDTADVYSNGISERLLGEFLKKFNIKRETVVILTKTF 94

Query: 85  NAQHHEPEVALDE----------------------------SLQRLGLDYVDLYLMHWPV 116
                   +AL E                            S++RLG  Y+D+  +H   
Sbjct: 95  FPVDESLSLALGEMSFSESDTLDLTNQRGLSRKHILQSVKNSVERLGT-YIDVLQIH--- 150

Query: 117 SLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKD 176
                           R D T P++     +N       +    VR IG S+       +
Sbjct: 151 ----------------RFDPTTPIKETMKALN-----DVVESGDVRYIGASSMLPTQFVE 189

Query: 177 LLK-APTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPI 232
           +   A   +    +N    + LL    + +L+ YC+++ I +  +SP       LL+ PI
Sbjct: 190 MQSVADKHDWFQFVNVQSCYNLLYREDERDLMQYCEKHNIALTPWSP---NHQGLLTRPI 246

Query: 233 VID 235
            ++
Sbjct: 247 GVE 249

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 94/236 (39%), Gaps = 61/236 (25%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++ A D G R  DTA +Y N   E  +GE +R   + RE + + TK++
Sbjct: 71  WLIEDKEEVFKILKRAYDRGLRTYDTADVYSNGLSERILGEFLRHYNINRETVVILTKVF 130

Query: 85  -----------NAQHHEPEV----------------ALDESLQRLGLDYVDLYLMHWPVS 117
                           E E+                 +  S++RLG  Y+D+  +H    
Sbjct: 131 FPTDESIHVTSKFDFSEQELLTLTNQRGLSRKHILAGVKASIERLG-TYIDVLQIH---R 186

Query: 118 LDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDL 177
           LD     E+P+E + R                  L   + +  VR IG S+       +L
Sbjct: 187 LD----HETPMEEIMRA-----------------LNDVVTQGDVRYIGASSMLATEFAEL 225

Query: 178 -LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPL--GSTSAPL 227
              A   +    ++    + LL    + EL+ + +++ I +  +SPL  G+ + PL
Sbjct: 226 NFIAERHDWFKFVSSQSYYSLLYREDERELIPFAKRHGIALIPWSPLSGGALTRPL 281

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 13/83 (15%)

Query: 15 NDGSQI-PIV------GLGTWQA---TDERDAYNAVRAALDAGYRHIDTAAIYKN---EV 61
          N G +I PIV      G   WQA    D  +A+  ++   D G R  DTA +Y N   E 
Sbjct: 11 NTGIKISPIVVGCMSFGSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNGESEK 70

Query: 62 QVGEAIRDSGVPREEIFVTTKLW 84
           +GE ++   + RE + + TK++
Sbjct: 71 FLGEFLKRYNIRRETVVILTKVY 93

>NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTK 82
          W   D+   +  ++   D G+R  DTA +Y N   E  +GE +R   + RE + + TK
Sbjct: 35 WVEDDKEKVFQILKHCYDIGFRTFDTADVYSNGKSERLLGEFLRKFNIRRETVVILTK 92

>NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 11/76 (14%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++   D G R  DTA +Y N   E  +GE ++   + RE + + TKL+
Sbjct: 35  WVQDDKEKVFTILKHCYDRGLRTFDTADVYSNGYSERLLGEFLKKYNIRRETVVILTKLF 94

Query: 85  NAQHHEPEVALDESLQ 100
                     +DESL+
Sbjct: 95  --------APVDESLK 102

>NDAI0B01300 Chr2 (303531..304532) [1002 bp, 333 aa] {ON} Anc_2.604
           YMR041C
          Length = 333

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 81/204 (39%), Gaps = 45/204 (22%)

Query: 22  IVGLGTWQATDERDAYN-----AVRAALDAGYRHIDTAAIYKN-EVQVGEAIRD--SGVP 73
           IVG GT+      D  +      +R A   G   IDT+  Y + E+ +G+A+++     P
Sbjct: 8   IVGGGTFSEQYNSDPESLPISEILRYAFTNGVNAIDTSPYYGDSEILIGKALKELSDEFP 67

Query: 74  REEIFVTTKL-------WNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKES 126
           RE   + TK+       ++      E ++  S +RL   Y+DL  +H     D  ++   
Sbjct: 68  RESYSICTKVGRISLDSFDYSKEHVEFSVRRSCERLNTTYLDLVYLH-----DVEFV--- 119

Query: 127 PLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKAPTTNVV 186
           PLE               T I   EL +      ++  G+S + V+ L ++ +   T  V
Sbjct: 120 PLE--------------DTLIALRELRRLKDIGLIKRFGLSGYPVHYLYEVTRKCATEYV 165

Query: 187 PTINQVELHPLLPQYELVDYCQQN 210
             I         P   ++ YC  N
Sbjct: 166 DDIG--------PLDAILSYCNLN 181

>NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {ON}
           
          Length = 345

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 93/248 (37%), Gaps = 63/248 (25%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   ++   +  ++   D G R  DTA +Y N   EV +GE ++   + RE + + TK++
Sbjct: 35  WVEDNKEKVFALLKHCYDVGLRTFDTADVYNNGQSEVLLGEFLKKYNIRRETVVILTKIY 94

Query: 85  NAQHHEPEV----------------------------ALDESLQRLGLDYVDLYLMHWPV 116
                  EV                             +  S++RLG  Y+D+  +H   
Sbjct: 95  FDSDDSMEVGSNFASINESTKLDLVNQRGLSRKHIIQGVKNSVRRLGT-YIDVLQIH--- 150

Query: 117 SLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKD 176
                           R D   P+++    +N   L        VR IG S+       D
Sbjct: 151 ----------------RLDDNVPMKSIMKSLNDVVL-----SGDVRYIGASSMLATEFAD 189

Query: 177 LLK-APTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPI 232
           L   A   +    +N    + LL    + E++ Y +++ I V  +SP    +  LL++P 
Sbjct: 190 LQAIADKHDWFQFVNWQSQYNLLYREDEREVIPYAKRHNIAVTPWSP---NARGLLAKPA 246

Query: 233 VIDVAKKN 240
            +   +KN
Sbjct: 247 NVTSERKN 254

>CAGL0E05192g Chr5 complement(506831..507868) [1038 bp, 345 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 345

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 121/320 (37%), Gaps = 91/320 (28%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++ A D G R  DTA +Y N   E  + E      + RE + + TK++
Sbjct: 37  WVLEDKEKIFGILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKYQIKRETVVIMTKVF 96

Query: 85  NAQHH----EPEVALDE-----------------------SLQRLGLDYVDLYLMHWPVS 117
                    +P V +DE                       S +RLG  Y+D+  +H    
Sbjct: 97  FGVDEDLNLQPGVKIDEQEDLVLTNQRGLSRKHILEGVKNSTERLG-TYIDVLQIH---R 152

Query: 118 LDKSYMKESPL-ELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKD 176
           LD    KE+P+ E+MK  +    VE  +                 R IG S+       +
Sbjct: 153 LD----KETPMKEIMKALNDV--VEAGYA----------------RYIGSSSMLATEFAE 190

Query: 177 L-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGST 223
           L   A   N    ++   L+ LL    + E++ + +++ I +  +S         PL  T
Sbjct: 191 LQFIAEKHNWFQFVSLQSLYNLLIREDEREIIPFAKRHNIALIPWSPNARGLLTRPLNKT 250

Query: 224 SAPLLSEPI-------------------VIDVAKKNGVQPAHVVLSWIVQR--NIIVLPK 262
           +  + S+P                    V +VAKK+    A +  SW++ +  N IV   
Sbjct: 251 TDRIKSDPTFKYLELDKLTEDQKEIINRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLN 310

Query: 263 SVHAERVAANLKTFTLPEED 282
           S+     A     F LPEED
Sbjct: 311 SIDRVDEAIASIDFELPEED 330

>KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa]
          {ON} highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 338

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKL 83
          W   D+ + +  ++   D G R  DTA IY N   E  +GE +R+  + RE + + +K+
Sbjct: 34 WLLDDKEEIFKILKYCYDNGLRTFDTADIYSNGLSERLIGEFLRNYNINRETVVILSKV 92

>NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON} 
          Length = 339

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 27 TWQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKL 83
          +W   D+++ +  ++   D G R  DTA  Y N   E  +GE +R   + RE + + TK+
Sbjct: 33 SWLMEDKQEVFRLLKYCYDQGLRTFDTADQYSNGQSERILGEFLRFYNIKRETVVIMTKI 92

Query: 84 W 84
          +
Sbjct: 93 F 93

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ---VGEAIRDSGVPREEIFVTTKLW 84
          W  +D+ + +  ++   D G R  DTA  Y N V    +GE ++   + RE + + +KL+
Sbjct: 34 WIVSDKEEVFRLLKYCYDKGLRTYDTANTYSNGVSEQLLGEFLKRYNIRRETVVIMSKLF 93

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIY---KNEVQVGEAIRDSGVPREEIFVTTKLW 84
          W   D+   +   +   D G+R  DTA +Y   K+E  +GE +R   + RE + + TK +
Sbjct: 35 WVEDDKEKIFQIFKHCYDIGFRTFDTADVYSNGKSERLLGEFLRKFEIRRETVVILTKTY 94

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON}
          highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 344

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 26 GTWQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTK 82
            W   D+   ++ ++   D G R  DTA  Y N   E  VGE ++   + RE + + TK
Sbjct: 32 AAWVEDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKYNIRRETVVILTK 91

Query: 83 LW 84
          ++
Sbjct: 92 VY 93

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 38  NAVRAALDAGYRHIDTAAIYK-NEVQVGEA---IRDSGVPREEIFVTTKLWNAQHHEPEV 93
           + ++   + G R IDT+  Y  +E+  G+A   IRD   PR   ++ TK+   Q  E + 
Sbjct: 44  DMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICTKVGRIQLDEFDY 102

Query: 94  ALDE-------SLQRLGLDYVDLYLMH 113
           + +        S QRL  DY+DL  +H
Sbjct: 103 SREHVRFSVLRSCQRLKTDYLDLVYLH 129

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 21/118 (17%)

Query: 17  GSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE---VQVGEAIRDSGVP 73
           G+ I     G   + ++  A+  + A  +AG   IDTA  Y+NE   + +GE +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 74  REEIFVTTKL----------------WNAQHHEP-EVALDESLQRLGLDYVDLYLMHW 114
           R++I + TK                 +   H     V++ +SL++L  D++D+  +HW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON}
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 117/304 (38%), Gaps = 62/304 (20%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++   D G R  DTA +Y N   E  +GE ++   + RE + + +K+ 
Sbjct: 34  WVIEDKEEIFKILKHCYDNGLRTFDTADVYSNGLSERLLGEFLKRYKINRETVVILSKV- 92

Query: 85  NAQHHEPEVALDESLQR-----LGLDYVDLYLMHWPVSLDKSYMKESPLELMKRP----- 134
                     +DESL+       G D V    +     L + ++ +   + ++R      
Sbjct: 93  -------RFPVDESLELPLSTIYGTDEVTALTLANQGGLSRKHIMDGVAKSVERLGTYID 145

Query: 135 -------DGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDL-LKAPTTNVV 186
                  D   P+E     +N       + K   R IG S+       +L   A   +  
Sbjct: 146 VLQIHRFDHETPMEETMKALN-----DVVEKGYTRYIGASSMLATEFAELQFVAEKHSWF 200

Query: 187 PTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGSTS---------- 224
             I+    + LL    + EL+ + ++++I +  +S         PLG T+          
Sbjct: 201 KFISSQSCYNLLYREDERELIPFAKRHRIGLIPWSPNSRGLLTRPLGLTTARYEADSRLH 260

Query: 225 --APLLSEPI--VIDVAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTL 278
             AP   E I  V +VAKK     A V  +W++ +    +      ERV   LK   F L
Sbjct: 261 NIAPDEQEIIRRVEEVAKKRDTTMAIVSTAWVLSKGCYPIVGLSSTERVDEALKAIDFEL 320

Query: 279 PEED 282
            EE+
Sbjct: 321 TEEE 324

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
          {ON} 
          Length = 344

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ---VGEAIRDSGVPREEIFVTTKLW 84
          W   D+   ++ ++   D G R  DTA +Y N      VGE ++   + RE + + TKL+
Sbjct: 37 WVLEDKEKIFSILKHCYDHGLRTFDTADVYSNGASGRLVGEFLKKYNIDRETVVILTKLF 96

>KNAG0L01270 Chr12 (230125..231156) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 111/290 (38%), Gaps = 86/290 (29%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   DE   +  ++   D G R  DTA +Y N   E  +G+ ++   + RE + + TK++
Sbjct: 34  WVLEDEEKVFEILKYCYDHGVRTFDTANVYCNGASERLLGKFLKKYNINRETVVILTKVY 93

Query: 85  NAQHHEPE------------------------------VALDESLQRLGLDYVDLYLMHW 114
                  E                               ++D+S++RLG  Y+D+  +H 
Sbjct: 94  FPVDESLEPFDFTVGGKNDPLTDVTLSNQRGLSRKNIIASVDKSIERLG-TYIDVLQIH- 151

Query: 115 PVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNL 174
              LD     +   E+MK                   L   +  NKVR IG S       
Sbjct: 152 --RLDHECTGK---EIMK------------------ALNDVVESNKVRYIGASTMLATEF 188

Query: 175 KDL-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLG 221
            +L + A   +    ++    + LL    + EL+ Y ++N + V  +S         PLG
Sbjct: 189 VELQMIADKYDWFQFVSSQTEYSLLFREDERELLSYTKRNNLAVLPWSPNARGLLCRPLG 248

Query: 222 ------STSAPLL-----SEPIVI----DVAKKNGVQPAHVVLSWIVQRN 256
                 +T + +L     S+ +++    ++AKK  V  A +  +W++ + 
Sbjct: 249 TKTERSTTESRMLLNMSESDKLIVKRVEELAKKKNVSMAMISEAWVMSKG 298

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 21/109 (19%)

Query: 26  GTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE---VQVGEAIRDSGVPREEIFVTTK 82
           G   + ++  A+  + A  +AG   IDTA  Y+NE     +GE +    + R++I + TK
Sbjct: 45  GFMGSMNKERAFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATK 103

Query: 83  L----------------WNAQH-HEPEVALDESLQRLGLDYVDLYLMHW 114
                            +   H H   V++ +SL++L  D++D+  +HW
Sbjct: 104 FTTDYKKYEVGKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   D+   ++ ++   D G R  DTA +Y N   E  +GE ++   + RE + + TK++
Sbjct: 34 WVIEDKEKIFSILKHCYDNGLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIF 93

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 12/107 (11%)

Query: 40  VRAALDAGYRHIDTAAIYKNEVQVG----EAIRDSGVPREEIFVTTKLWNAQHHEPEVAL 95
           ++ A+  G R IDT+  Y +  ++     E+++D  +PRE  F+ TK+   +  E + + 
Sbjct: 49  LKYAVQHGIRAIDTSPYYGDSEKLFGKALESLKDE-IPRENYFICTKVGRIRLDEFDYSR 107

Query: 96  DE-------SLQRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPD 135
           +        S +RL  DY+D+  +H    ++ + + E+  EL K  D
Sbjct: 108 EHVRSSVLRSCERLRTDYLDVVFLHDVEFVETAQVLEALKELRKLKD 154

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 21/105 (20%)

Query: 30  ATDERDAYNAVRAALDAGYRHIDTAAIYKNE---VQVGEAIRDSGVPREEIFVTTKL--- 83
           A ++  A+  + A  +AG   +DTA  Y+NE     +GE ++   V R++I + TK    
Sbjct: 49  AMNKEQAFELLDAFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGD 107

Query: 84  -------------WNAQHHEP-EVALDESLQRLGLDYVDLYLMHW 114
                        +   H     V++ +SL++L  D++D+  +HW
Sbjct: 108 YKKYEAGDGKSANYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>ZYRO0A00286g Chr1 (15089..16114) [1026 bp, 341 aa] {ON} highly
          similar to uniprot|Q02895 Saccharomyces cerevisiae
          YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 341

 Score = 35.8 bits (81), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 14/92 (15%)

Query: 7  NSTKTLKL-NDGSQIPIVGLGT----------WQATDERDAYNAVRAALDAGYRHIDTAA 55
           S K +KL N G +I  + +G           W   D+++ +  ++   D+G R  DTA 
Sbjct: 2  GSIKPVKLGNSGLKISPILVGCMSYGSKKWQEWVIEDKQEVFKILKHCYDSGLRTFDTAD 61

Query: 56 IYKNEVQ---VGEAIRDSGVPREEIFVTTKLW 84
           Y N +    +GE ++   + RE + + +K++
Sbjct: 62 FYSNGISERLLGEFLKTYNINRETVVILSKVF 93

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 63/135 (46%), Gaps = 31/135 (22%)

Query: 10  KTLKLNDGSQIPIVGLGT------WQAT----DERDAYNAVRAALDAGYRHIDTAAIYKN 59
           + L  N G ++  + LG       W+ T    D++ ++  + A  +AG   IDTA  Y+N
Sbjct: 19  RILSKNAGIRVSPLVLGAMSIGDAWEETLGSMDKQRSFELLDAFYEAGGNFIDTANNYQN 78

Query: 60  ---EVQVGEAIRDSGVPREEIFVTTKL----------------WNAQHHEP-EVALDESL 99
              E  +GE +    + R++I + TK                 ++  H    ++++ +SL
Sbjct: 79  GQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFSGNHRRSLQLSVRDSL 137

Query: 100 QRLGLDYVDLYLMHW 114
           ++L  D++D+  +HW
Sbjct: 138 RKLQTDWIDILYVHW 152

>NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   D+ + +  ++   D G R  DTA +Y N   E  +GE ++   + RE + + TK++
Sbjct: 34 WLIDDKEEIFKILKYCYDRGLRTYDTADVYSNGLSERLLGEFLKRYKIKRETVVIFTKVF 93

>CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 344

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 121/321 (37%), Gaps = 93/321 (28%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++ A D G R  DTA +Y N   E  + E      + RE + + +K++
Sbjct: 36  WVLEDKEKIFGILKRAYDRGLRTYDTADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVF 95

Query: 85  NA------QHHEPEV---------------------ALDESLQRLGLDYVDLYLMHWPVS 117
            A       HH  ++                     A+  S +RLG  Y+D+  +H    
Sbjct: 96  YAVDEDLDLHHGLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLG-TYIDVLQIH---R 151

Query: 118 LDKSYMKESPL-ELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKD 176
           LD    KE+P+ E+MK  +    VE  +                 R IG S+       +
Sbjct: 152 LD----KETPMKEIMKALNDV--VEAGYA----------------RYIGSSSMLATEFAE 189

Query: 177 L-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGST 223
           L   A   N    ++    + LL    + E++ + +++ I +  +S         P+   
Sbjct: 190 LQFIAEKHNWFQFVSLQSFYNLLNREDEREIIPFAKRHNIALTPWSPNARGLLTRPVSKI 249

Query: 224 SAPLLSEPI-------------------VIDVAKKNGVQPAHVVLSWIVQRN---IIVLP 261
           S  + S+P                    V +VAKK+    A +  SW++ +    I+ L 
Sbjct: 250 SVRIKSDPTFKIVGLDKLTEDQKEIINRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLN 309

Query: 262 KSVHAERVAANLKTFTLPEED 282
                +   A++  F LPEED
Sbjct: 310 SIARVDEAIASI-DFELPEED 329

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
          (REAL)
          Length = 344

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   ++   +  ++   D+G R  DTA +Y N   E  +GE ++   + RE + + TK++
Sbjct: 36 WVIDEKEKIFEILKHCYDSGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVY 95

>Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W
          (REAL)
          Length = 344

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   ++   +  ++   D G R  DTA +Y N   E  +GE ++   + RE + + TK++
Sbjct: 36 WVINEKGKIFEILKHCYDGGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVY 95

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 45/174 (25%)

Query: 16  DGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKN-EVQVGEAIRDSGVPR 74
           D   +P+V +        R  +NAV           DT+  Y + E+ VG+A+R+  +PR
Sbjct: 20  DPESLPVVEILRKCLITHRRCFNAV-----------DTSPYYGDSELLVGQALRELQIPR 68

Query: 75  EEIFVTTKL-------WNAQHHEPEVALDESLQRLGLD--YVDLYLMHWPVSLDKSYMKE 125
            EI+V TK+       ++       +++  S++RL  +  Y+D+  +H     D  +   
Sbjct: 69  GEIYVCTKVGRVGVSEFDYSRENVRMSVMRSVERLVGEGGYLDVVYLH-----DVEF--- 120

Query: 126 SPLELMKRPDGTRPVETDWTFINTWELMQKLPKNK-VRSIGVSNFSVNNLKDLL 178
                       +P E     ++    +QKL +   VR++GVS + ++ L  L+
Sbjct: 121 ------------QPQEACLAALDE---LQKLKRAGIVRNVGVSGYPLSKLYSLV 159

>NDAI0G04890 Chr7 (1178096..1179127) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKL 83
          W   D+   +  ++   D G R  DTA +Y N   E  +GE ++   + RE + + TK+
Sbjct: 34 WVLDDKEKIFKILKHCYDNGLRTFDTADVYSNGFSERLLGEFLKKYNIRRETVVILTKV 92

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 36/197 (18%)

Query: 33  ERDAYNAVRAALD-AGYRHIDTAAIYKNEVQVGEAIRDSGVP-REEIFVTTKLWNAQHHE 90
           +R   + + A L+ AG + IDTA IY +  ++   I +  +P R  I      ++     
Sbjct: 18  QRSDIDEISAILEKAGVKDIDTARIYPDSEKI---IGELQLPNRFTIHTKASGFSGGCLT 74

Query: 91  PE---VALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFI 147
            +    +++ESL  LG+  V+ + +H                    PD   P+E     I
Sbjct: 75  KDNINKSIEESLSLLGVPSVETFFLH-------------------SPDPETPIEETLGAI 115

Query: 148 NTWELMQKLPKNKVRSIGVSNFSVNNLKDLLK-APTTN-VVPTINQVELHPLLPQYE--L 203
           N+        + K +  G+SNF+  ++K + + A + N V+PT+ Q   +      E  L
Sbjct: 116 NSL-----YEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDL 170

Query: 204 VDYCQQNKIEVEAYSPL 220
               ++      AYSP+
Sbjct: 171 FPLLRELHFSFYAYSPI 187

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 21/99 (21%)

Query: 36  AYNAVRAALDAGYRHIDTAAIYKNE---VQVGEAIRDSGVPREEIFVTTKL--------- 83
           A+  + A  +AG   IDTA  Y+NE     +GE +    + R++I + TK          
Sbjct: 55  AFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDV 113

Query: 84  -------WNAQHHEP-EVALDESLQRLGLDYVDLYLMHW 114
                  +   H     V++ +SL++L  D++D+  +HW
Sbjct: 114 GGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++   D G R  DTA +Y N   E  + E + +  + RE + + TKL+
Sbjct: 34  WIEDDKEKVFKILKHCYDQGLRTFDTADVYSNGLCERLLKEFLEEYKIRRETVVIMTKLF 93

Query: 85  NAQHHEPEVALDESLQRLGLDYVDL 109
                  +++L  +++  G+  +DL
Sbjct: 94  FPVDETLDLSLGGAIED-GVGKLDL 117

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 67/320 (20%), Positives = 131/320 (40%), Gaps = 87/320 (27%)

Query: 18  SQIPIVGLGTWQATD-ERDAYNAVRAAL-DAGYRHIDTAAIYKNEVQVGEAIRDSGVPRE 75
           +++P +  G +  T   +D ++ + + L + G    DTA IY    +   +I D G+  +
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSEK---SIGDLGIA-D 57

Query: 76  EIFVTTKLWNAQHHEPEV--------ALDESLQRLGLDYVDLYLMHWPVSLDKSYMKESP 127
           ++ + TK   A+  E           ++ +S   L +D V++Y +H              
Sbjct: 58  DLVIDTK---ARSFEEGALTRDGIFESIKQSFDELKVDSVEIYYLH-------------- 100

Query: 128 LELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLK-APTTN-V 185
                 PD   P+E     IN  EL ++    K +  G+SN++ +++K + + A + N V
Sbjct: 101 -----APDPITPIEETIDAIN--ELYKQ---GKFKKFGLSNYTPDDVKKIYEYAKSKNYV 150

Query: 186 VPTINQ-----------VELHPLLPQYELVDYC----------------QQNKIEVEAYS 218
           +PT+ Q            +L P+L +Y +  Y                 ++     +  +
Sbjct: 151 LPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSPIAGGFLVKSVQQIEEGAGRFKKGT 210

Query: 219 PLGSTSAPLLSEPIVI-------DVAKKNGVQPAHVVLSWIVQRNII-------VLPKSV 264
            +G   + L + P ++       D+AKK  +  +H+   WI   + +       V+    
Sbjct: 211 MIGDLYSKLYNTPKLLKGLEKWDDIAKKYDIPKSHLAYRWIAFHSSLSKKDDDAVIIGGK 270

Query: 265 HAERVAANLKTF---TLPEE 281
           + E+VA  L  F    LP+E
Sbjct: 271 NHEQVADTLNAFKEGALPKE 290

>AGR227W Chr7 (1175673..1176830) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL113C
          Length = 385

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 4   NLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQV 63
           NL N+    K  DG +I  +G G+    DE    +A+ AALD+G  H     +YKNE  V
Sbjct: 281 NLLNAATLAKCKDGVRIVNIGRGS--CVDE----DALLAALDSGKVHSAGLDVYKNEEAV 334

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 56/278 (20%), Positives = 106/278 (38%), Gaps = 69/278 (24%)

Query: 22  IVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAIRDSGVPREEIFVTT 81
           I G  T+ +  + +A   V          +DTA IY       EAI    +P+  I  T 
Sbjct: 8   IYGAFTFASLTQEEASKFVDVLEKYKVEELDTARIYPGSE---EAIGKFELPKSFIIDTK 64

Query: 82  KLWNAQHHEPEVALDESLQR----LGLDYVDLYLMHWPVSLDKSYMKESPLELMKRPDGT 137
                +    + +++ES++     LG++ V+++ +H                    PD  
Sbjct: 65  ARGFGEGTLTKESINESIEESFGLLGVESVEIFYLHC-------------------PDPA 105

Query: 138 RPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLK--APTTNVVPTINQVEL 194
            P+E       T + +  L K  K +  GVSNFS  +++ +         V+PT+ Q   
Sbjct: 106 TPLE------ETLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNY 159

Query: 195 HPLLPQYE--LVDYCQQNKIEVEAYSPL-------------------------GSTSAPL 227
           + +  + E  L    ++  +   AYSP+                         G+  + L
Sbjct: 160 NAVGRKIETSLFPVLRELGLSFYAYSPIAGGFLAKTPEEVLGGKGRFDTSNHVGALYSKL 219

Query: 228 LSEPIVI-------DVAKKNGVQPAHVVLSWIVQRNII 258
            ++P++I        +A+K G+  A +   W+   +I+
Sbjct: 220 YNKPLLIKGLGQWGKIAEKVGISRASLAYRWVYNNSIL 257

>Skud_16.195 Chr16 (353315..354343) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 68/337 (20%), Positives = 125/337 (37%), Gaps = 95/337 (28%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+ + +  ++   D G R  DTA  Y N   E  + E +    + RE + + TK++
Sbjct: 34  WVIEDKAEIFKILKHCYDNGLRTYDTADFYSNGLSERIIKEFLEHYNIKRETVVIMTKIF 93

Query: 85  N------AQHHEPEVALDE-----------------------SLQRLGLDYVDLYLMHWP 115
                    HH  ++ LDE                       S++RLG  Y+DL  +H  
Sbjct: 94  FPVDEKLVLHH--KLTLDEIEELELSNQRGLSRKHIIAGVKNSVERLG-TYIDLLQIH-- 148

Query: 116 VSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLK 175
             LD    +E+P+  + R                  L   +    VR IG S+       
Sbjct: 149 -RLD----QETPMREIMRA-----------------LNDVVEAGHVRYIGASSMLATEFA 186

Query: 176 DL-LKAPTTNVVPTINQVELHPLL---PQYELVDYCQQNKIEVEAYS---------PLGS 222
           +L   A        I+    + LL    + EL+ + +++ I +  +S         PLG 
Sbjct: 187 ELQFIADKYGWFQFISSQSYYNLLHREDERELIPFAKRHNIGLLPWSSNARGLLTRPLGQ 246

Query: 223 TSAPLLSEPI-------------------VIDVAKKNGVQPAHVVLSWIVQRN---IIVL 260
            +  + S+P                    V  ++K   V  A + ++W++ +    I+ L
Sbjct: 247 NTERMRSDPTFKSLQLDTLEEDQMEIINRVEKISKDKNVSMAMISIAWVLHKGCHPIVGL 306

Query: 261 PKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297
             +   +   A L   TL E++ + + +  + + +RR
Sbjct: 307 SSTSRVDEAIAALHV-TLTEKEIEYLEEPYKPKRQRR 342

>NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa]
          {ON} 
          Length = 338

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 27 TWQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKL 83
          +W   D+ + +  ++   D G R  DTA  Y N   E  + E ++   + RE + + +K+
Sbjct: 33 SWLLEDKEEVFALMKFCYDQGIRTFDTADQYSNGLSERLICEFLKRYSIRRETVVIMSKI 92

Query: 84 WNA 86
          + A
Sbjct: 93 FFA 95

>YPL088W Chr16 (381965..382993) [1029 bp, 342 aa] {ON} Putative
          aryl alcohol dehydrogenase; transcription is activated
          by paralogous transcription factors Yrm1p and Yrr1p
          along with genes involved in multidrug resistance
          Length = 342

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   D+   +  ++   D G R  DTA  Y N   E  + E +    + RE + + TK++
Sbjct: 34 WVIEDKTQIFKIMKHCYDKGLRTFDTADFYSNGLSERIIKEFLEYYSIKRETVVIMTKIY 93

>Smik_3.210 Chr3 (309527..310615) [1089 bp, 362 aa] {ON} YNL331C
           (REAL)
          Length = 362

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 28/120 (23%)

Query: 21  PIVGLGTWQATDERDAYNAVRA--ALDA----GYRHIDTAAIYKNEVQ---VGEAIRDSG 71
           P+V LG   ++D  D+ N  RA   LDA    G   ID A  Y+NE     +GE + +S 
Sbjct: 31  PLV-LGATTSSDFLDSMNKKRAFKLLDAFNKAGGNFIDAANNYENEQWDEWIGEWM-ESR 88

Query: 72  VPREEIFVTTKLWN---------------AQHHEP--EVALDESLQRLGLDYVDLYLMHW 114
             R++I + TK                    +H+P   V++ +SL +L  D++D+  + W
Sbjct: 89  KLRDKIVICTKYAGDYKRCEAAQGKSANYCGYHQPSLRVSVRDSLHKLKTDWIDILYVQW 148

>CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa]
          {ON} highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088w
          Length = 346

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   D+   +  ++ A D G R  DTA +Y N   E  + E      + RE + + TK++
Sbjct: 37 WVLEDKEKIFGILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKYQIKRETVVIMTKVF 96

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 3/76 (3%)

Query: 28  WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
           W   D+   +  ++   D G R  DTA +Y N   E  + E ++   + RE + + +K++
Sbjct: 34  WVEDDKEKVFKILKHCYDQGLRTFDTADVYSNGLSEKLLKEFMQKYNIRRETVVIMSKVF 93

Query: 85  NAQHHEPEVALDESLQ 100
                  ++ L   L+
Sbjct: 94  FPVDETLDLGLGSGLE 109

>SAKL0B11462g Chr2 (995743..996762) [1020 bp, 339 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 339

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 12/85 (14%)

Query: 40  VRAALDAGYRHIDTAAIYK-NEVQVG---EAIRDSGVPREEIFVTTKL-------WNAQH 88
           +R A+D G R IDT+  Y  +E   G   +AI+D    R+  ++ TK+       ++   
Sbjct: 46  LRYAMDHGIRAIDTSPYYGPSETLYGNALDAIKDE-YARDTYYICTKVGRIRLDEFDYTR 104

Query: 89  HEPEVALDESLQRLGLDYVDLYLMH 113
                ++  S  RL   Y+DL  +H
Sbjct: 105 EHVRFSVQRSCARLKTTYLDLVYLH 129

>Kpol_1043.31 s1043 (66691..67539) [849 bp, 282 aa] {ON}
           (66691..67539) [849 nt, 283 aa]
          Length = 282

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 3/80 (3%)

Query: 128 LELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKAPTTNVVP 187
           LEL+K    + PV T  +F + W   +   K   + +   N S  N  + +  PT+N+  
Sbjct: 176 LELLK---SSNPVTTSKSFAHLWSFKECYIKYIGKGLHYDNLSELNFSNHINTPTSNISI 232

Query: 188 TINQVELHPLLPQYELVDYC 207
             N +  H      E++  C
Sbjct: 233 DNNPLTFHSKWSNQEVITIC 252

>Smik_79.1 Chr79 complement(3..761) [759 bp, 253 aa] {ON} YNL331C
           (REAL)
          Length = 253

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 28/120 (23%)

Query: 21  PIVGLGTWQATDERDAYNAVRA--ALDA----GYRHIDTAAIYKNEVQ---VGEAIRDSG 71
           P+V LG   ++D  D+ N  RA   LDA    G   ID A  Y+NE     +GE + +S 
Sbjct: 31  PLV-LGATTSSDFLDSMNKKRAFKLLDAFNKAGGNFIDAANNYENEQWDEWIGEWM-ESR 88

Query: 72  VPREEIFVTTKLWN---------------AQHHEP--EVALDESLQRLGLDYVDLYLMHW 114
             R++I + TK                    +H+P   V++ +SL +L  D++D+  + W
Sbjct: 89  KLRDKIVICTKYAGDYKRCEAAQGKSANYCGYHQPSLRVSVRDSLHKLKTDWIDILYVQW 148

>Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088W
          (REAL)
          Length = 342

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 28 WQATDERDAYNAVRAALDAGYRHIDTAAIYKN---EVQVGEAIRDSGVPREEIFVTTKLW 84
          W   D+   +  ++   D G R  DTA  Y N   E  + E +    + RE + + TK++
Sbjct: 34 WVIEDKAQIFKILKHCYDNGLRTFDTADFYSNGLSERIIKEFLDHYSIKRETVVIMTKIF 93

>NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3.441
           YGR098C
          Length = 1648

 Score = 30.8 bits (68), Expect = 5.1,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 110 YLMHWPVSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPKNKVRSIGVSNF 169
           YL H+ V +  +Y+       MKR      +    +FI+ W L  +L + K R   +S+F
Sbjct: 581 YLYHYEVLIKSAYILNID---MKRHSTNNLLLLTRSFIDKWILRLELSQYKERKDDISSF 637

Query: 170 SVNNLKDLLK 179
            VN +K L +
Sbjct: 638 EVNFVKTLFQ 647

>Skud_3.183 Chr3 (296810..296845,296849..297115,297116..297466) [654
           bp, 217 aa] {ON} YCR107W (REAL)
          Length = 217

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 25/95 (26%)

Query: 44  LDAGYR---HIDTAAIYKNEVQ---VGEAIRDSGVPREEIFVTTKLWN------------ 85
           LDA Y     ID A  Y+NE     +GE  +   + RE+I + TK               
Sbjct: 5   LDAFYEACNFIDAANNYENEQWEEWIGEWTKSRKL-REKIVICTKYAGDYKKCEADEGKS 63

Query: 86  ------AQHHEPEVALDESLQRLGLDYVDLYLMHW 114
                  Q H   V++ +SL +L  D++D+  +HW
Sbjct: 64  ANYCGYHQKHSLHVSVRDSLHKLQTDWIDILYVHW 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,043,886
Number of extensions: 1489695
Number of successful extensions: 4667
Number of sequences better than 10.0: 194
Number of HSP's gapped: 4305
Number of HSP's successfully gapped: 196
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)