Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E038305.435ON84584542420.0
YDR369C (XRS2)5.435ON8547485961e-64
Skud_4.6385.435ON8438365704e-61
Suva_2.5415.435ON8697615371e-56
NCAS0F033905.435ON8617665238e-55
CAGL0A02838g5.435ON8288284368e-44
ZYRO0F10054g5.435ON6603113786e-37
TDEL0E019005.435ON7623173734e-36
Smik_4.6355.435ON8632183496e-33
NDAI0B056805.435ON8562343237e-30
KNAG0C049005.435ON7693262881e-25
SAKL0G02552g5.435ON8343492782e-24
TBLA0A028205.435ON9254312657e-23
Kwal_55.214225.435ON7821372585e-22
KLTH0F16038g5.435ON7921312488e-21
Kpol_1016.55.435ON8123522479e-21
Ecym_47615.435ON7986942452e-20
AER402C5.435ON8699572327e-19
TPHA0J025905.435ON775902282e-18
KLLA0E02201g5.435ON8352471442e-08
Ecym_33042.266ON579111800.65
SAKL0D08800gna 1ON57957762.1
Smik_11.201.519ON1103147752.9
TPHA0C013907.201ON1123104753.1
YKL205W (LOS1)1.519ON1100144734.4
TBLA0I031504.290ON40058716.5
Suva_11.171.519ON740136719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03830
         (845 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...  1638   0.0  
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   234   1e-64
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   224   4e-61
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   211   1e-56
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   206   8e-55
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   172   8e-44
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   150   6e-37
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   148   4e-36
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   139   6e-33
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   129   7e-30
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   115   1e-25
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   111   2e-24
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   106   7e-23
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   103   5e-22
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   100   8e-21
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   100   9e-21
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    99   2e-20
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    94   7e-19
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    92   2e-18
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    60   2e-08
Ecym_3304 Chr3 (580892..582631) [1740 bp, 579 aa] {ON} similar t...    35   0.65 
SAKL0D08800g Chr4 complement(732221..733960) [1740 bp, 579 aa] {...    34   2.1  
Smik_11.20 Chr11 (34512..37823) [3312 bp, 1103 aa] {ON} YKL205W ...    33   2.9  
TPHA0C01390 Chr3 (314359..317730) [3372 bp, 1123 aa] {ON} Anc_7....    33   3.1  
YKL205W Chr11 (50051..53353) [3303 bp, 1100 aa] {ON}  LOS1Nuclea...    33   4.4  
TBLA0I03150 Chr9 complement(762920..764122) [1203 bp, 400 aa] {O...    32   6.5  
Suva_11.17 Chr11 (34690..35130,35204..36985) [2223 bp, 740 aa] {...    32   9.2  

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score = 1638 bits (4242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/845 (94%), Positives = 802/845 (94%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
           GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYS             RISWTPIFWDL
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 121 SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLLS 180
           SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLLS
Sbjct: 121 SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLLS 180

Query: 181 EVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISHDD 240
           EVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISHDD
Sbjct: 181 EVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISHDD 240

Query: 241 LLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKIYAIK 300
           LLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKIYAIK
Sbjct: 241 LLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKIYAIK 300

Query: 301 EIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNTNTHA 360
           EIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNTNTHA
Sbjct: 301 EIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNTNTHA 360

Query: 361 TIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXXXXXXXXDSLSFFAGGSTNPSTTLKTV 420
           TI               PPTVMGPS               DSLSFFAGGSTNPSTTLKTV
Sbjct: 361 TISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFAGGSTNPSTTLKTV 420

Query: 421 SPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQSLSSQPTTNRSIQ 480
           SPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQSLSSQPTTNRSIQ
Sbjct: 421 SPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQSLSSQPTTNRSIQ 480

Query: 481 NKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLIQPIDSNSNVSQETNVPKESME 540
           NKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLIQPIDSNSNVSQETNVPKESME
Sbjct: 481 NKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLIQPIDSNSNVSQETNVPKESME 540

Query: 541 DNDNSSNTLSEVNRNILSRKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTK 600
           DNDNSSNTLSEVNRNILSRKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTK
Sbjct: 541 DNDNSSNTLSEVNRNILSRKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTK 600

Query: 601 IVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQ 660
           IVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQ
Sbjct: 601 IVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQ 660

Query: 661 HRDGYDSLRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAV 720
           HRDGYDSLRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAV
Sbjct: 661 HRDGYDSLRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAV 720

Query: 721 SEDDILLNEMRTKAIGLTDNGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSEDELQEER 780
           SEDDILLNEMRTKAIGLTDNGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSEDELQEER
Sbjct: 721 SEDDILLNEMRTKAIGLTDNGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSEDELQEER 780

Query: 781 LEKGFGSNRNSNHSFVKEGSTSGILNDFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFK 840
           LEKGFGSNRNSNHSFVKEGSTSGILNDFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFK
Sbjct: 781 LEKGFGSNRNSNHSFVKEGSTSGILNDFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFK 840

Query: 841 FRRNR 845
           FRRNR
Sbjct: 841 FRRNR 845

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  234 bits (596), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 227/748 (30%), Positives = 340/748 (45%), Gaps = 121/748 (16%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MW++RY+N LEDG++  +SCCLQ +K YSIGRSSKNPL IKNDKSISRQHIT +W+ NN 
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  G--TGTVLSVVNQGKLTAIDENYMKSDESKAFD-DETYSXXXXXXXXXXXXXRISWTPIF 117
                + L +VN+GKLT++++ +MK  E+   +  +                   W    
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDI--SLVIND---EKSNWSRIMFALLKQNCT 172
           W++     QF   ++  GI T++   ++ DI  +L+I+D    + N  R ++AL+     
Sbjct: 121 WNIPPHLTQFRTMLSEYGISTEI---SINDIPANLMISDYPKSEDNSIRELYALV-STIP 176

Query: 173 LVKPVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQF 230
           + K   L E+CN LL   +TN  FDE+W  +  S   Y V   F  + N +L  F  +  
Sbjct: 177 MKKSRFLMELCNTLLPTSKTNLKFDEMWNDMI-SNPEYNV---FDFDPNILLSKFMRLNN 232

Query: 231 YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN---LLKCIALKQEDPA 287
             V +    +   L + +     N  +FD  D L  Y+ ++  +   L+     K+E+  
Sbjct: 233 IRVLTTIKSE-PRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKEN-- 289

Query: 288 PDEIQGIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVH 347
                G  +  IK ++ +I+DG    +    G S+ +      D IS             
Sbjct: 290 -----GKILCTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQIS------------- 331

Query: 348 PDNTSTLNTNTHATIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXXXXXXXXDSLSFFA 407
            +  ST+   + A                 P     P                DSL FFA
Sbjct: 332 -EGMSTILKTSRA-----------------PEVEASPVVSKKRKLNRRRVLPLDSLDFFA 373

Query: 408 GGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQ 467
           GG      + KT+S     N S T +       ESK  +++    E        +Q AL+
Sbjct: 374 GG-----LSTKTLS----ENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQNALK 424

Query: 468 SL------SSQPTTNRSIQNKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLIQP 521
                   S   +    I +   L T N  E   + S++   +P +P  P+V   +  Q 
Sbjct: 425 PTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLP-QPSLPEV-AGIGSQT 482

Query: 522 IDSNSNVSQETNVPKESMEDNDNSSN-----------------TLSEVNRNILSRKSES- 563
           I SNS   +   V   SM+D + + N                  LS  +R I S   E+ 
Sbjct: 483 ISSNSADYETAAV--NSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENC 540

Query: 564 -GPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTI 622
             P K ++S+ ++S +P AF+EA+Q TK REVKR+++ IV++   ELSEEAIN+L NL I
Sbjct: 541 KSPVK-ELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAI 599

Query: 623 VESNPNLIRE----------RRADK--NDSVNDMWKGRRNFKKFNKVWPQ---HRD---- 663
           VE + NL+R+          R  +K  N  +   W  R+NFK F KV P+   H++    
Sbjct: 600 VEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKN 659

Query: 664 ---GYDSLRNNAFLIIRNYVELKPYDGK 688
                D +RN AFLI RNYV LK Y  K
Sbjct: 660 NTQSSDFIRNAAFLITRNYVPLKKYSKK 687

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  224 bits (570), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 229/836 (27%), Positives = 371/836 (44%), Gaps = 128/836 (15%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNN- 59
           MW++RY+N +EDG +  +SCCLQ  K YSIGRSSKN L IKNDKSISRQHIT +W+ N  
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 60  -EGTGTVLSVVNQGKLTAIDENYMKSDES-KAFDDETYSXXXXXXXXXXXXXRISWTPIF 117
                + LS++NQGKLT+I++ ++K  E    +  E  +              ++W    
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRD--ISLVINDEKS---NWSRIMFALLKQNCT 172
           W++     +F  +++  GI T+   S++ D  I+L+I+D  S   N  R ++AL+     
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTE---SSIDDGPINLMISDFPSSDDNGMRELYALVNA-IP 176

Query: 173 LVKPVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQF 230
           L K  LL +VC  LL     N  FDE+W  +     N   +  F  + + +   F  +  
Sbjct: 177 LKKLRLLVDVCKTLLPASVRNLKFDEMWKDVL----NSPEFNVFNFDASVLSSKFMKLNR 232

Query: 231 YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDE 290
             V + + ++   L AT+  L     +FD    L  ++  +  ++   I          +
Sbjct: 233 IIVLTTTSNE-RRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQ 291

Query: 291 IQ----GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHV 346
           IQ    G+    I++ + AI   N K++P  I                  N+  +R S V
Sbjct: 292 IQCTINGLITSVIEDALPAIT--NTKSVPCEI-----------------QNKKFERVSEV 332

Query: 347 HPDNTSTLNTNTHATIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXXXXXXXXDSLSFF 406
              ++ TL+T                     P   +GP+               DSLSFF
Sbjct: 333 QSTSSKTLHT---------------------PEIEVGPAILKKRRLNRRRVQPLDSLSFF 371

Query: 407 AGGSTNPSTT-------LKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQV 459
           AGG ++ S++        + +SP +      ++ +       S L V N ++ ++ N++ 
Sbjct: 372 AGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKE 431

Query: 460 DVVQTALQSLSSQPTTNRSIQNKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLI 519
           +           Q +T   + +   L  E+  E   +     R  PL    P + +N LI
Sbjct: 432 N----------GQKSTGAIVISSPELYAEHISE--DSEDKPPRLSPLTVTRPGLQSNPLI 479

Query: 520 ------------QPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILSRKSESGPHK 567
                       +  ++  N    T    +++E+N        E  +N  S+     P K
Sbjct: 480 SRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQE--KNSYSQVDRKSPVK 537

Query: 568 FDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNP 627
            ++   ++S +P +F+EA+Q TK REV+R ++ IV +   ELSEE IN+L NL IVE N 
Sbjct: 538 -ELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNE 596

Query: 628 NLIRE----------RRADKNDS--VNDMWKGRRNFKKFNKVWPQHR----------DGY 665
           +L+R+           RA KN+S  +   W  R+NFK F KVWP+ +             
Sbjct: 597 DLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNS 656

Query: 666 DSLRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFN-DENDYEVIRRGNPAVSEDD 724
           D +R+ AFLI RNYV L+ Y  K N     +  E        E +  V   G    +   
Sbjct: 657 DFIRSAAFLITRNYVPLRKY-SKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSA 715

Query: 725 ILLNEMRTKAI----GLTDNGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSEDEL 776
           ++    RT+       ++D GN + F+   +SD A P     ++LFV +DD ++ +
Sbjct: 716 VIQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIAQP---AKNKLFVTEDDDKNNM 768

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  211 bits (537), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 221/761 (29%), Positives = 347/761 (45%), Gaps = 130/761 (17%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MW++RY+N LEDG++  +SCCLQ  K YSIGRSSKN L IKNDKSISRQH+T +W+ N+ 
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  --GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXX-XXXRISWTPIF 117
               G  LS+VNQGKLT+I++ +MK  E+        S              +  W    
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSN---WSRIMFALLKQNCTLV 174
           W++  +  QF+  ++  GI T+  S +    S++I+D  SN     R ++AL+     L 
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKT-SIDDDSASILISDFPSNNDDGMRELYALV-HTIPLK 178

Query: 175 KPVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQD----V 228
           K  LL ++CN LL+    N  FDE W  +     N  ++  F  + + +   F      +
Sbjct: 179 KSQLLVDLCNSLLSSSVMNLKFDETWNNMV----NKPLFKVFDYDPSVLFSKFMRLDNVI 234

Query: 229 QFYTVGSISHDDLLYLKATVSELQGNFKSFDTADDL---VTYIKTVNHNLLKCIALKQED 285
              T+G+ S      L   +  L      FD  +DL   V  +K     L+     K+E+
Sbjct: 235 TLTTIGNESG-----LPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKREN 289

Query: 286 PAPDEIQGIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSH 345
                  G K+  ++ ++ +I+D     LP+ I           T ++            
Sbjct: 290 -------GQKLCTLQNLITSIIDDT---LPSVIN----------TKAVPF---------E 320

Query: 346 VHPDNTSTLNTNTHATIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXXXXXXXXDSLSF 405
           V  +NT       H  I               P T   P+               DSL+F
Sbjct: 321 VQENNTPEKVFEGHTAISKTVHT---------PETEATPAVLKKRRLNRRRVQPLDSLNF 371

Query: 406 FAGG-STNPSTTLKTVS----PVVPSNASNTTSD---EKPNKVESKLGVNNARRDEQTND 457
           FAGG S +PS+  K  +    P+   N+  T S    E+ ++  S    N  R    T  
Sbjct: 372 FAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQNTQRISRDTWK 431

Query: 458 QVDVVQTALQSLSSQPTTNRSIQNKGILRTENNDEMLTNASIKR---RNMPLKPLSPDVD 514
           +   + T    + S P    S+++        N+ +  + ++ R   +N+   P++   +
Sbjct: 432 ENGYIGTGAVVVGS-PEIGGSVRHDE--EEPVNESLQPSPTVTRPDSQNISAYPVTTTPE 488

Query: 515 TNLLIQPI--------DSNSNVSQETNVPKESMEDNDNSSNTLSEV-------NR--NIL 557
            ++  + I        DS  N +Q  N   E+   N+N +    ++       NR  ++L
Sbjct: 489 KHMEGRKIVESYKISDDSTQNENQTQN---ENQTQNENQTQNEMKIKLQTLKDNRKFSVL 545

Query: 558 SRKSES-------GPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELS 610
           S+K+ S        P + ++SL ++S +P +F+EA+Q TK REVKR+++ IV++   ELS
Sbjct: 546 SQKTPSHQQAGHNSPLR-ELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELS 604

Query: 611 EEAINKLSNLTIVESNPNLIRE-------------RRADKNDSVNDMWKGRRNFKKFNKV 657
           EEAIN+L+NL IVE +  L+R+             RR++K  ++   W  R+NFK F KV
Sbjct: 605 EEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKG-AIRQEWPKRKNFKTFAKV 663

Query: 658 WPQHR----------DGYDSLRNNAFLIIRNYVELKPYDGK 688
           WP  +             D +R+ AFLI RNYV LK Y  K
Sbjct: 664 WPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKK 704

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  206 bits (523), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 201/766 (26%), Positives = 331/766 (43%), Gaps = 141/766 (18%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MW+LRY+ +LEDG+ +K+S C+QK   Y+IGRS+KN L+IKNDKSISRQH++++W+  N+
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
                + ++NQGKLT I E Y+   +S  F +   +              + +    W +
Sbjct: 61  -----IHIINQGKLTYIGEQYLDVGQSLTFGN--VNSLSIKLGTKPVMVHLEFYSSNWLI 113

Query: 121 SKDFLQFEKSINSMG--ICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVL 178
                QF +++   G  + TQ+       I L++ DE +    I      ++  + KP  
Sbjct: 114 PNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIV-DEINGSGLIPLWGFMKDIPVKKPQF 172

Query: 179 LSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQD-VQFYTVGSIS 237
            S  C +L ++   +FD  W +L E+ SN T++    +   D  R F++ V      + +
Sbjct: 173 FSTACEILSSN-DNDFDNSWHRLQET-SN-TLFCSHYISLKDRSRLFENYVILILFDNET 229

Query: 238 HDDLLYLKATVSELQG----NFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQG 293
           + D +    T   L G    +F   + + D +  +K   +  +  +         D++  
Sbjct: 230 NKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPD 289

Query: 294 IKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTST 353
           ++ + +++I+ AI D     L T I        ++ +  I      + R +++ P     
Sbjct: 290 LEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVS-LIPEITYPSDRKTNIQP----- 343

Query: 354 LNTNTHATIXXXXXXXXXXXXXXXP--PTVMGPSXXXXXXXXXXXXXXXDSLSFFAGGST 411
               +H T+               P   T++ P                DSL+FFAGG++
Sbjct: 344 ----SHHTVDSIHNDKKNVLSNRDPGEATLVNP-IVKKRRLNRQRVKPLDSLAFFAGGAS 398

Query: 412 NPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQV----------DV 461
                 K  SP V   A   T DE       K   NN       N Q           +V
Sbjct: 399 P-----KIGSPAVQETAQ-ATKDESAE--SDKFRTNNGLTQPSGNSQPLIHSEPIVLKEV 450

Query: 462 VQT---------------ALQSLSSQPTTNRSIQNK----GILRTENNDEMLTNASIKRR 502
           ++                 +QS S+QP  +   QNK    G +      E+LT   ++R 
Sbjct: 451 LEADHNKNIQEGPTTAVPVIQSKSTQPLEHTE-QNKNSEIGSVAATPTPEVLTGNGVERP 509

Query: 503 NMPLKPLSPDVDTNLLIQPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILSRKSE 562
           N P  P      T  L+      SN  ++ N+   S+E+                     
Sbjct: 510 NTPQVP-----STQALV------SNHKEKKNLKSNSLEE--------------------- 537

Query: 563 SGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTI 622
                           P +F++A+Q TK REV R+++ +V++   EL+E AIN+L +L I
Sbjct: 538 ----------------PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVI 581

Query: 623 VESNPNLIRERRA---------DKNDSVNDMWKGRRNFKKFNKVWPQHR------DGYDS 667
           VE N +LIR++ +         + +D     W  R+NFKKF K++P++       D  D 
Sbjct: 582 VEPNQSLIRKKASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDL 641

Query: 668 LRNNAFLIIRNYVELKPYDGKRND--NDSSDFHEGRSHFNDENDYE 711
           +RNNAFLI RNYV +K + G+ N+  ND  D +E        +DYE
Sbjct: 642 IRNNAFLITRNYVPMKKFTGQYNNVPNDDEDMYE-------HHDYE 680

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  172 bits (436), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 226/828 (27%), Positives = 370/828 (44%), Gaps = 138/828 (16%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MW+LRY    E G ++KVSCC+++   Y+IGRSSKN L IKNDKSISRQH++++W     
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSS--- 57

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFD-DETYSXXXXXXXXXXXXXRISWTPI--F 117
            +   + + N GKLT   E Y+ S+E   +  DET               +I  + I   
Sbjct: 58  -SKNCIELTNTGKLTKSSEKYLGSNELITYSADET----QIEMLLGVAPVKIILSRIDEL 112

Query: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPV 177
           +D+     QF +++ ++GI   + ++NV   SL+   +     R +FA    +  +    
Sbjct: 113 FDIPNSLSQFRETLETLGIQISVDNANVNSTSLITVGDFG--YRELFAAC-NDINIYSSG 169

Query: 178 LLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSIS 237
           LL+E+CN L+ D   NFD  W  +  S+       G   +   I   F    F+ +  I 
Sbjct: 170 LLTEICNKLVND-HDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKF----FFLLYKID 224

Query: 238 HDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKI- 296
              + YLK  + +L     S +  D +       N +LL+ I+ KQ D  P  I   KI 
Sbjct: 225 WFIISYLKPFLLKL-----SVEIHDSIHK-----NDDLLRLISSKQADEIPIVISNEKIK 274

Query: 297 YAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNT 356
           Y  ++ +Q   D  +K + +     N  R ++      +  ED   N+ + P   S  NT
Sbjct: 275 YLPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNA-IIPQKRSLANT 333

Query: 357 NTHATIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXXXXXXXXDSLSFFAGGSTNPSTT 416
           +                     PT                    +SLSFFAGG       
Sbjct: 334 SQ--------------------PTDTSLESTKKKRVRRHKVEPLNSLSFFAGG------- 366

Query: 417 LKTVSPVVPSNASNTTSDEKPN-KVESKLGVNNAR--RDEQTNDQVDVVQT-----ALQS 468
              +SPV  +N  N  +  K N  ++S++  ++A   R+++   Q   + T     AL  
Sbjct: 367 ---ISPVPGTN--NEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALTD 421

Query: 469 LSSQPT-TNRSIQNKGILRTENNDEMLTNASI--KRRNMPLKPLSPDVDTNLLIQPIDSN 525
            +S+PT   RSI  +GI    + D+++ N  +   + ++P +    D+  N +       
Sbjct: 422 DNSEPTIVQRSIA-EGI---SHRDQLIGNDEVVEDQHHLPDRK-KRDIHENTMY------ 470

Query: 526 SNVSQETNVPKESMEDNDNSSNTLSEV------NRNILSRKSESGPHKFDVSL------- 572
            N S   N     +E++   SN L  +      N+  LS+K+  G    + +L       
Sbjct: 471 -NNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNL 529

Query: 573 ------------TKRS--KSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLS 618
                        KR+  K     ++ VQ+TK  EVKR+ + IV +  SEL+EEAINKL+
Sbjct: 530 KSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLN 589

Query: 619 NLTIVESNPNLIRERR-ADKNDSVNDMWKGRRNFKKFNKVWPQHRDGYDS-------LRN 670
           +L +VE   +LIR +     N++    WK R+NFKKF K+ P+++    S       +R 
Sbjct: 590 DLVLVEPVADLIRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRG 649

Query: 671 NAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAVSEDDILLNEM 730
           +  ++ R +++ K        N   D++   SH +D+ND+       P  ++ +  ++++
Sbjct: 650 SGEILTREFLQTK--------NVPVDYY--NSH-HDQNDFVDEINTAPQANKSNSFVHQI 698

Query: 731 RTKAIGLTDNGNDEDFTRIA----NSDQAVPTVHGVSRLFVADDDSED 774
             + IG  +N N   FTR A    N++ A    +   +LFV DDD ED
Sbjct: 699 LPE-IG-DENENSFSFTRTAIGNGNNNSANEINNSNQQLFVVDDDFED 744

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  150 bits (378), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 167/311 (53%), Gaps = 28/311 (9%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWILRY+ +LEDG L+ VSCCL+  + Y+IGRSSKN L IKNDKSISRQH++I WD    
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWD---- 56

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
           G    L ++NQGK+TA+ E Y+K  ES +F  ++               ++ W    W +
Sbjct: 57  GKDRQLKLINQGKMTAVSEKYLKMGESISF-GKSMGTVLVELGTKPLKMQLQWMDSIWMV 115

Query: 121 SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLLS 180
            +       ++  +GI  ++ SS +   +L++ DE+ N+SR ++ L+K+      P++  
Sbjct: 116 PQGSRSDHSALEELGI--EVLSSELSRANLIVIDEQQNYSRWLYGLVKR-----IPLMNL 168

Query: 181 EVCNVL---LADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSIS 237
           E  NV+   ++  +T FD IW ++    S    Y  + V+     +  Q+++F TVG   
Sbjct: 169 EFLNVVSQKVSGHETEFDSIWTKIMNDGS--LRYKSWEVQA----QVLQNLEFLTVGK-D 221

Query: 238 HDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGI-KI 296
            D  L ++A      G + +  + ++L   +K    +L   + LK      +E+  + K 
Sbjct: 222 EDTSLAIEAA----GGKYSAVLSVEELREAVKR-KGDLSNVVILKSHLTPAEELAPLGKT 276

Query: 297 YAIKEIVQAIL 307
           + ++++V+AIL
Sbjct: 277 FTVQDVVEAIL 287

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 88/151 (58%), Gaps = 16/151 (10%)

Query: 565 PH-KFDVSLTKRSKSPAA--FIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLT 621
           PH K  +S  ++ +SP+    I+ +Q TK  EVKR+ + I+ V   EL+E+AIN+L NL 
Sbjct: 440 PHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLV 499

Query: 622 IVESNPNLIRER-RADKNDSVNDMWKGRRNFKKFNKVWPQH-------RDG-YDSLRNNA 672
           +V+ N NL+R R R+   DS N  W  R+NFK F KVWP++       R+G  D++RN A
Sbjct: 500 LVDRNDNLMRRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKYGGQDSTSREGSSDTIRNRA 559

Query: 673 FLIIRNYVELKPY----DGKRNDNDSSDFHE 699
           FL+ R YV  + Y      K+   D  DF E
Sbjct: 560 FLLTRQYVPTRTYTSGDSSKQAQEDLYDFPE 590

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  148 bits (373), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 163/317 (51%), Gaps = 16/317 (5%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWIL+Y  ELEDGT+R+VS CL K + +SIGRSSKNPL IKNDKSISR HI++ WD   +
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRIS--WTPIFW 118
               ++ ++NQG+LTA    Y+K  ES  F+++ +              ++   W  + +
Sbjct: 61  ----LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVF 116

Query: 119 DLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVK-PV 177
           DL     QF  +++ +GI  +  + + R  ++++ D+     + +F L+  N  +++   
Sbjct: 117 DLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLI--NGAVIRNSQ 174

Query: 178 LLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSIS 237
            L EV N+ L+   T F+E W  L ++ S Y +YP        IL+ +   +FY + S  
Sbjct: 175 FLVEVTNI-LSKPTTTFEESWDSLIQNES-YMLYPNNLGPHEVILKGY---KFYLIAS-D 228

Query: 238 HDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKIY 297
              + Y++  +    G     +  + L+  +K  N +    I LK E+        IK++
Sbjct: 229 VITMAYVQEALERGNGELIVVENTEQLLDRLKQEN-STDDLIVLKAEETTKIPGDKIKLH 287

Query: 298 AIKEIVQAILDGNFKNL 314
            + ++V A+     K L
Sbjct: 288 TLVDLVNAVSHNTVKTL 304

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 15/139 (10%)

Query: 576 SKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERRA 635
           + S    ++ ++  K+REVKR+++ +V V   EL+E+AIN+L +L IV+ N +LIR ++ 
Sbjct: 512 ASSTEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKI 571

Query: 636 DKND-SVNDM---WKGRRNFKKFNKVWPQHRD----------GYDSLRNNAFLIIRNYVE 681
           D  + S ND    W GR+NFK F KV  ++++            D +RN+ +L+ R YV 
Sbjct: 572 DSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVP 631

Query: 682 LKPYDGKRNDNDSSDFHEG 700
            K Y  K +  +  DF E 
Sbjct: 632 SKIY-TKESSKEMQDFPEA 649

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 123/218 (56%), Gaps = 9/218 (4%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCN-- 58
           MW++RY+N LEDGT+  +SCCLQ  K YSIGRSSKNPL IK+DKSISRQHIT++W  N  
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXX-XXXRISWTPIF 117
           ++     L ++NQGKLT+I+  +MK  E+   +    S               + W    
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFAL--LKQNCTLVK 175
           W++     QF  +++  GI T+  S N    +++I+D  S+   ++  L  L +N  L K
Sbjct: 121 WNIPSHLAQFRTALSQFGISTET-SINEVPTNIMISDYPSSDDNVIRELCALAENIPLKK 179

Query: 176 PVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVY 211
             LL ++CN LL+   T+  FDE W  + +S   Y V+
Sbjct: 180 SQLLVKLCNTLLSASITDLTFDERWNDIVKS-PEYDVF 216

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 123/251 (49%), Gaps = 44/251 (17%)

Query: 569 DVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPN 628
           +VS  ++S +P +F++A+Q TK REVKR+++ IV++   ELSEEAIN+L  L IVE+N +
Sbjct: 542 EVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANND 601

Query: 629 LIRE------------RRADKNDSVNDMWKGRRNFKKFNKVWPQ---HRDG-------YD 666
           L+R+                 N  +   W+ R+NFK F K WP+    ++G        D
Sbjct: 602 LLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSD 661

Query: 667 SLRNNAFLIIRNYVELKPYDGKR-----NDNDSSDFHE--------GRSHFNDENDYEVI 713
            +R  AFLI RNYV LK Y  K      +  +S D H           ++ +D  +   I
Sbjct: 662 FIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTTI 721

Query: 714 RRGNPAVSEDDILLNEMRTKAIGLTDNGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSE 773
            +  P      I ++E        +DNG ++ F+    SD A     G  +LF+ DD+  
Sbjct: 722 HK-RPQTQR--IFISE------DSSDNGEEDSFSFSRGSDAAPNAQPGTIKLFITDDNGN 772

Query: 774 DELQEERLEKG 784
           D   +   +KG
Sbjct: 773 DNKSDRVYDKG 783

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  129 bits (323), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 118/234 (50%), Gaps = 17/234 (7%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWILRY+  LEDG ++KVS CL++   YSIGRSSKNPL+IKNDKSISRQHITI+W+ + +
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
                L +VNQGKLT++ E Y+  DES  F+                  +I W P+   +
Sbjct: 61  -----LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYI 115

Query: 121 SKDFLQFEKSINSMGICTQ----MQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKP 176
              + QF   +   GI        + S++  + +  ND       +    L     + K 
Sbjct: 116 PNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPND-----YYVPLLALALGIPVFKS 170

Query: 177 VLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQF 230
             L+EV N+L  D  T FD    Q   S  +  + P F++  N     FQD  F
Sbjct: 171 QYLTEVSNMLRPDNIT-FD-TDVQKINSMESLKLVPSFSLSNNS-KNFFQDYFF 221

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 86/157 (54%), Gaps = 33/157 (21%)

Query: 578 SPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRER---- 633
           +P + +E +Q  K REV R+++ I  V   EL+E+AIN+ SNL IVESN +LIR      
Sbjct: 537 TPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENND 596

Query: 634 ----------RADKNDSVNDMWKGRRNFKKFNKVWPQH-------------RDGYDSLRN 670
                     R D  D++ ++ +GRRNFK+F KV+P++                 D +RN
Sbjct: 597 NTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRN 656

Query: 671 NAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDE 707
           NAFLI RNYV LK Y      +   D H G++ FNDE
Sbjct: 657 NAFLITRNYVPLKQY------SKYDDSHGGKNGFNDE 687

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 147/326 (45%), Gaps = 25/326 (7%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSK-NPLTIKNDKSISRQHITIRWDCNN 59
           MWILRY  E ED     VSCCLQ+ + YSIGRSSK N L IKNDKSISRQHI+ +W  ++
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  EGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWD 119
                 + +VN GKLT I++ ++K  E+                       + W  +F D
Sbjct: 61  -----YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFID 115

Query: 120 LSKDFLQFEKSINSMGI--CTQMQSSNVRDI--SLVINDEKSNWSRIMFALLKQNCTLVK 175
           ++       +S+  +GI         N+ D   +L I  ++  W   + AL++    L K
Sbjct: 116 MTP-ISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYK 174

Query: 176 PVLLSEVCNVLLADCQ--TNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTV 233
             L+  +   L+   +  ++FDEIW +  +S   Y  YP F V+ N   R F  + F   
Sbjct: 175 ADLVDLMAQQLVDSNENISSFDEIWNRTVDS-GQYKEYPNFKVDRNS-FRDFTIIYFDNN 232

Query: 234 GSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQE-----DPAP 288
            S    D+  +++ V    G   SF   +    Y  T N  L   + L+ E      P  
Sbjct: 233 DS----DISGVRSCVEFCGGTLLSFVNNESFEKYAST-NETLHNVLLLRSERFQVSHPVY 287

Query: 289 DEIQGIKIYAIKEIVQAILDGNFKNL 314
           + +  I I +     +A+ + N   L
Sbjct: 288 EILNKIDICSTGSFFKAVTENNVSTL 313

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 74/112 (66%), Gaps = 2/112 (1%)

Query: 575 RSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERR 634
           + ++ ++ +E +QS K  E +R++  +  V PSEL++EAI   SN+ IVE   N++R++ 
Sbjct: 540 KPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKP 599

Query: 635 ADKNDSVNDMWKGRRNFKKFNKVWPQHRDGYDSLRNNAFLIIRNYVELKPYD 686
           A   +S   +   R NFKKF KVWP+ R G DSLRNNA+LI R+YV +K Y+
Sbjct: 600 AMVTES--SIRSDRPNFKKFMKVWPKARKGNDSLRNNAYLITRDYVPMKAYN 649

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 100/349 (28%), Positives = 160/349 (45%), Gaps = 51/349 (14%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWILRY  + EDG    +SCCL++  +Y IGRS+K+PL IKNDKSISR+HI ++ +  NE
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
                L+++N GKLT ++   +  D+S  F  +                 I W    W +
Sbjct: 61  -----LNLLNTGKLTTLNAEVLMVDQSLNFHPK--GQLRLELGIKPIIATIEWQDQVWKV 113

Query: 121 SKDFL---QFEKS-INSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKP 176
           S D L    F++   NS GI      S   ++  +I   +  +S  +F+L+K    +V+ 
Sbjct: 114 SHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQ-IIKQNQDTYSNCLFSLVK-GIDIVRE 171

Query: 177 VLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSI 236
             LS+  + L     T++D IW  L +    + V+P FT      +  FQ++    V S 
Sbjct: 172 SFLSDFQSHLYM-TPTDYDGIWKNLLQK---HMVFPNFTT----CVSIFQNISI-IVASK 222

Query: 237 SHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN----LLKCI------------- 279
           S  +L   K T+    G     +  +    +I+   H+    +LK I             
Sbjct: 223 SIYNL--FKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNI 280

Query: 280 -----ALKQED-PAPDEIQGIKIYAIKEIVQAILDGN----FKNLPTHI 318
                A K E+  A  E  G K++ + ++V A+L  +     + +PT I
Sbjct: 281 DMSEDARKLEELKAAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKI 329

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 131/281 (46%), Gaps = 34/281 (12%)

Query: 580 AAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRE--RRADK 637
            A +EA+Q TK+REV R++  ++ +  +EL+E AIN LSNL IVE   +LIR+   R   
Sbjct: 573 TALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKK-DLIRKNSERGHC 631

Query: 638 NDSVNDMWKGRRNFKKFNKVWPQ--HRDGYDS-----LRNNAFLIIRNYVELKPYDGKRN 690
             S   +W+GR+NFKKF KV P+   R+ +DS     ++N+AFLI R YV LK +D    
Sbjct: 632 ISSDTCLWEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPNEK 691

Query: 691 DNDSSDF---HEGRSHFNDENDYEVIRRGNPAVSEDDILLNEMRTKAIGLTDNGNDEDFT 747
           +     F   H             +    N    E+  + N  RTK+   + +   E   
Sbjct: 692 EQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEH-- 749

Query: 748 RIANSD-QAVPTVHGVSRLFVADDDSEDELQEERLEKGFGSNRNSNHSFVKEGSTSGIL- 805
            + N D +   T    +RLFV D+D    L           N   N     E S S  L 
Sbjct: 750 TLTNGDIEMKETSRSENRLFVTDEDDFQSL-----------NITDNSIEAPERSISNPLR 798

Query: 806 -NDFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFKFRRNR 845
            ND        S L R   FT+  + D+DDD P+F+F   R
Sbjct: 799 VNDKPSSGGNTSRLPR---FTE--ASDDDDDEPRFRFSSRR 834

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 118/431 (27%), Positives = 189/431 (43%), Gaps = 41/431 (9%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWI+ Y  +  D TL  VSCCL++ + YSIGRS K+PL +KNDKSISRQH+T  W  N  
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
              ++L+   QGKLT ++   +   E+  F+ +                  +WT   +++
Sbjct: 61  NQLSLLN---QGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNI 117

Query: 121 SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDE----KSNW-SRIMFALLKQNCTLVK 175
             +F QFE  +   G            I+ VI+ E     +N+ S  ++  L     ++K
Sbjct: 118 PIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILK 177

Query: 176 PVLLSEVCNVLLADCQT---NFDEIW-AQLFESFSNYTVYPGFTVEGNDI-LRAFQDVQF 230
              L+ + N+L  +  T   +F  +  A   E F N  +     VE   I L    D   
Sbjct: 178 SSFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINL-ESLKVELTGIKLIVLND--- 233

Query: 231 YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTV-NHNLLKCIALKQEDPAPD 289
                 +  DL+Y  A +  +  N  +  T DD + +I TV +H+  + I L   +    
Sbjct: 234 ------NTTDLIYFIAAMEVI--NLPTITTEDDTI-FINTVKSHSEERLILLTTSNSR-- 282

Query: 290 EIQGIKIYAIKEIVQAILDGNFKNLPTHIGR-SNTSRKRNFTDSISHYNED---AQRNSH 345
            I+ IK++  K+  Q I + N  +L   I + S  + +RN  ++IS  NE+   +Q + +
Sbjct: 283 HIETIKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPY 342

Query: 346 VHPDNTSTLNTNTHATIXXXXXXXXXXXXXXXP--PTVMGPSXXXXXXXXXXXXXXXDSL 403
           +  +N    NT + + +               P  P V                   DSL
Sbjct: 343 IEDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPV------KRRRLNRKRVQPLDSL 396

Query: 404 SFFAGGSTNPS 414
            FF GG+TNP+
Sbjct: 397 HFFVGGNTNPT 407

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 157/349 (44%), Gaps = 65/349 (18%)

Query: 555 NILSRKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAI 614
           N L R  E    K  VS  KRS +P  FI A+Q  K RE  R+ +K V +   EL+EEAI
Sbjct: 584 NSLKRSKEQ--EKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAI 641

Query: 615 NKLSNLTIVESNPNLIRERRADKNDSVNDM---WKGRRNFKKFNKVWPQHR--------D 663
           NK SNL +VE+N +++       N+S+ D+   WKGR+NFK F K  P++R        +
Sbjct: 642 NKFSNLAVVETNVDIVISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDN 701

Query: 664 GYDS-LRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRG------ 716
           G  S +RN+AFL+ R YV ++ +      N   +F E    ++ +   ++   G      
Sbjct: 702 GVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTI 761

Query: 717 NPAVSEDDIL---------------LNEMRTKAIGLTDNGN--------DEDFTRIANSD 753
               S DD+                +N      I  T  GN        D+D T   N D
Sbjct: 762 TQTFSSDDLETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFD 821

Query: 754 QAVPTVH----GVSRLFVADDDSE-----DELQEERLEKGFGSNRNSNHSFVKEGSTSGI 804
                 H     ++R  V+ DD+      D+  +  +E     N + NH      STS  
Sbjct: 822 TETSPDHNLVANLARNMVSIDDTHPNISIDQNNDLGIEISMSGN-DDNHI----RSTSSN 876

Query: 805 LNDFSKDTVLRSHLGR-------KKAFTQID-SGDEDDDGPKFKFRRNR 845
           +N  +++   + H  R       +++F  ++ S D+DDD PKFKF R R
Sbjct: 877 MNSLNRNHSTKLHNSRSLPSNNSRQSFRVMEGSEDDDDDAPKFKFSRKR 925

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (60%), Gaps = 16/137 (11%)

Query: 573 TKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRE 632
           T+ +K P +F +AV+ TK+ EV R+   IV+V+  EL+EEAINKL  L +VE+   +   
Sbjct: 514 TREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKDLM--- 570

Query: 633 RRADKNDSV------NDMWKGRRNFKKFNKVWPQH--RDGYDS----LRNNAFLIIRNYV 680
            RAD+  +V      ++ W GR+NFKKF K+WP    R+  DS    LRN A LI R YV
Sbjct: 571 -RADREYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYV 629

Query: 681 ELKPYDGKRNDNDSSDF 697
            L+PY+G+  +N    F
Sbjct: 630 PLRPYEGQNANNQDDSF 646

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/345 (27%), Positives = 150/345 (43%), Gaps = 57/345 (16%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWD--CN 58
           MWILRY+    +G    VSCCL++   YSIGRS+KNPL IK+DKSISR H+ +  D  CN
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAF--DDETYSXXXXXXXXXXXXXRISWTPI 116
                 VL VV  GKLT +    +K+ +   F  D+E                + S+  I
Sbjct: 61  -----VVLRVV--GKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKI 113

Query: 117 FWD------LSKDFLQFEKSI-NSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQ 169
             D      LS+    F+  + NS+   T +Q         +I D   ++S  +F+L+K 
Sbjct: 114 PHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQ---------IIKDSSKSFSNCLFSLIK- 163

Query: 170 NCTLVKPVLLSEVCNVLLADCQTNFDEIWAQLF---ESFSNY--------TVYPGFTVEG 218
           N  +++   + +     + D   +FD  W ++      F NY        T++  F V  
Sbjct: 164 NIPILREHFIGDFV-TQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIH--FLVTN 220

Query: 219 NDILRAFQDVQFYTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKC 278
                 F+ +     G+      L+L   +S L    K   T+D+++  +   N      
Sbjct: 221 RRAFAIFKHIIDAGSGT------LWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSIS 274

Query: 279 IALKQEDPAPDEIQ---------GIKIYAIKEIVQAILDGNFKNL 314
              +  D    E +         G +I+ + +IV A+LD NF+ L
Sbjct: 275 STEQSSDLDVQEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKL 319

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 73/131 (55%), Gaps = 10/131 (7%)

Query: 577 KSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERRAD 636
           K P + I+A Q  K  EV R++  + DV   EL+EEAINKL NL  VE    + R     
Sbjct: 523 KRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVP 582

Query: 637 KNDS----VNDMWKGRRNFKKFNKVWPQHR------DGYDSLRNNAFLIIRNYVELKPYD 686
           +N +     N  W  R+NFKKF K+WP H       +  D++RN A+LI R+YV L PYD
Sbjct: 583 ENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYD 642

Query: 687 GKRNDNDSSDF 697
           G RN++    F
Sbjct: 643 GTRNNSADDGF 653

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 136/292 (46%), Gaps = 25/292 (8%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWILRY+   E G+  +VSCCL+K   Y +GRS K+PL IK DKSISR+H+ +    N++
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFD-DETYSXXXXXXXXXXXXXRISWTPIFWD 119
                L V+N GKLT I  + +K D+   F  D++ +              +++ P  W 
Sbjct: 61  -----LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGT---VTYEPAIWK 112

Query: 120 LSKDFLQFEKSINSMGIC-TQMQSSNVRDISL-VINDEKSNWSRIMFALLKQNCTLVKPV 177
           +  D    E   N + +   Q+ +S     S+ +I + + +    +FAL+K+   + +  
Sbjct: 113 IPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGF 172

Query: 178 LLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSIS 237
           +   V     AD Q +FD  W Q+  +  N    P   ++  D   AF+ + F      +
Sbjct: 173 IGDFVSQ--FADTQIDFDAKWEQI--TLKN---APFLELQTKDA--AFKGLNFVVT---N 220

Query: 238 HDDLLYLKATVSELQGNFKSFDTADDLVTYI--KTVNHNLLKCIALKQEDPA 287
                  K+ +    GN        +L T+I  +  + N++  I L +E PA
Sbjct: 221 QKTFAIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPA 272

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 165/352 (46%), Gaps = 63/352 (17%)

Query: 401 DSLSFFAGGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVN-NARRDEQTNDQV 459
           DSL+FFAGG T+   +   + PV  +N      D++  K + K  +N     DE  N ++
Sbjct: 362 DSLNFFAGGVTSIGASQLPL-PVEEANNITRKKDKEVIKSQGKGEINIETEMDESGNGEL 420

Query: 460 DVVQTALQSLSSQPTTNRSIQNKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLI 519
                 L + S        +Q+K   R +         +I R   P K   P ++ N+ I
Sbjct: 421 ------LSTASEFKKPKSDVQHKLEKRMQ--------VAIDRS--PEKIKKPKLEENISI 464

Query: 520 QPIDSN--------SNVSQETNVPKESMEDNDNSSNTLSEVNRNILSRKSESGPHKFDVS 571
           Q + SN        S+V  ET + KES        NT +     +  +      H  D  
Sbjct: 465 QQLLSNKVKSTSDTSSVLIETQIAKES--------NTKAIEYGKVRQKTLTDYKHTSD-- 514

Query: 572 LTKRSKSPAA-FIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLI 630
             +R + P+   + A+Q  K RE  R++T IV++  +EL+EEAINK S+LT+V+ N  L 
Sbjct: 515 --ERIERPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLF 572

Query: 631 RERRAD----KNDSVNDM-WKGRRNFKKFNKVWP---------QHRDGYDS-LRNNAFLI 675
           +++  D     N + N+M W G++NFKKF K+ P         QH D   + +RN+A LI
Sbjct: 573 KDKSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLI 632

Query: 676 IRNYVELKPY---DGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAVSEDD 724
            RN+V +K Y   D   N N+ +DF       N E + + + +   A S DD
Sbjct: 633 TRNFVPMKQYSKLDNNSNSNEMTDFS------NIEVNKKPVEKNREAYSSDD 678

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 135/282 (47%), Gaps = 33/282 (11%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MW+LRY+  L+DG++ K+SCC++  + Y +GRSSKN L+++NDKSISRQ I+I+WD + +
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFWDL 120
                + V N GK+T ++E Y+   E+ +F  +                +I  TPI  +L
Sbjct: 61  ----CIMVKNLGKVTMVEERYLSDGETLSFQSKN----------DLVTMKIGTTPIVVNL 106

Query: 121 SKDFLQFEKSINSMGICTQMQS--------SNVRDISLVINDEKSNWSRIMFAL--LKQN 170
           S +  +       M +   +QS         N   + ++I ++ +  S        +  +
Sbjct: 107 SWEVKRCNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHD 166

Query: 171 CTLVKPVLLSEVC--NVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDV 228
             L+    L ++   N+++      FD  W +L    SN       T+    + ++ + +
Sbjct: 167 TILINSKTLRDILTNNIIMT---KKFDSYWVKLNSHESNIQ---NHTINVTKLAKSLKGM 220

Query: 229 QFYTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKT 270
             + +   S+ +  Y +  + E+    + F   +DL TY++T
Sbjct: 221 HMFLLDPESY-NCEYFEKFLEEIGCIPRKFLNINDLETYLET 261

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 167/694 (24%), Positives = 285/694 (41%), Gaps = 122/694 (17%)

Query: 1   MWILR--YENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCN 58
           MWI +  Y+N+ +  TL  +S  ++  K Y +GR+SK+ L I +++ +SR H+ ++ + N
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWT---- 114
                 ++ +   G    I    ++   S  F  +  S             ++ WT    
Sbjct: 60  ------IIEITLLGAQLKIGHKTIEKGISCEFHPKQ-SPLRLEVGSHSIECKLLWTQWEF 112

Query: 115 PIFWDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDE-KSNWSRIMFALLKQNCTL 173
            +  DL  +++   K    +GI      S      +V + + + ++ + +FAL+K    L
Sbjct: 113 KVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVK-GLPL 171

Query: 174 VKPVLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTV 233
           V+   L  + ++L +D    F+    +L   FS   ++P F    N I    + + F   
Sbjct: 172 VEVGFLKGISSLLNSDT-LKFESKVKELEREFS---IFPEF----NPIPNPLKGLYFIVP 223

Query: 234 GSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN---LLKC-----IALKQED 285
                D+   LK T+    G   +  T +D V    T+  +   L+KC      A+  + 
Sbjct: 224 ---EKDEFDILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQK 280

Query: 286 PAPDEIQ-------GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKR----NFTDSIS 334
           P    I        G K +  +E+  A+L+ NF+     +  S+ S KR    N  D + 
Sbjct: 281 PTDHNILLEKAHSIGFKQHDTRELTIAVLNNNFEET---LIDSSISDKRLISCNSNDKLK 337

Query: 335 HYNEDAQRNSHVHPDNTSTLNTNTHATIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXX 394
             +   +    V+   TS LN NT                   PP               
Sbjct: 338 TTSTSLEDGLKVNVSATSGLNLNTEG-----------------PPA---------KKRRI 371

Query: 395 XXXXXXDSLSFFAGGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQ 454
                 DSLSFFAGGS                        E+  +VE     ++ ++  Q
Sbjct: 372 NSVKPLDSLSFFAGGSI-----------------------ERSTRVERN---SSEKQTVQ 405

Query: 455 TNDQVDVVQTALQSLSSQPTTNRSIQNKGIL-RTENNDEMLTNASIKRRNMPLKPLSPDV 513
             +   + +T++ S+   PT +   +   ++  TEN  E +   S K+R       SP  
Sbjct: 406 PAEHNKIAETSIASIELLPTKSGIKEITDVVPETENEPEPM--VSPKKR-------SPAK 456

Query: 514 DTNLLIQPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILSRKSE-SGPHKFDVSL 572
           + +L       N +VS +T +    +E +   S+   +V   I   K E S   K+ ++ 
Sbjct: 457 NESLADMRAGDN-HVSIKTTL---EVEKSAEPSHKKLKV-EGIFDEKVEMSNEQKYHLNA 511

Query: 573 -----TKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNP 627
                T  ++S ++ + A++  K REV RI+T IV++ P EL+EEAI KLS L +VES  
Sbjct: 512 ESKDSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVD 571

Query: 628 NLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQH 661
            L + +        N     RRNFK+F KVWP +
Sbjct: 572 MLRKTQSRHMKTETNKRHHVRRNFKRFVKVWPAY 605

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 217/957 (22%), Positives = 369/957 (38%), Gaps = 200/957 (20%)

Query: 1   MWILR--YENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCN 58
           MW+ +  Y+   + G L+ +SC L   + + +GR+SK+ L I+ +K +SR H+  R +  
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHL--RLEVI 57

Query: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPIFW 118
           ++    +L + +Q K+   D     S  S      + S              + W    +
Sbjct: 58  DDHV-NILLLGSQLKVGGED----ASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEF 112

Query: 119 DLSKDFLQFEKS----INSMGI--CTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCT 172
            +    LQ + +    I  +GI   T    +    I +  +++  ++ + +FAL+K    
Sbjct: 113 KVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHI-IRPHEDDQDYEKYLFALVKG--- 168

Query: 173 LVKPVLLSEVC---NVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQ 229
              P+L  E       LL    T+FD    QL      +  + GFT +  D+      + 
Sbjct: 169 --IPILHLEFLKQFTALLRQPVTDFD---PQLRSIQEQHYAFRGFTKKAADL----NGLH 219

Query: 230 FYTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPD 289
           F  + +  HD    LK T+    G        +DL   +KT+  N    +ALK +     
Sbjct: 220 F--IVNRKHD-FEMLKYTLEIGGGTVHFCHDINDLSACLKTIPIN--GALALKYDHGISA 274

Query: 290 EIQ--------------GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISH 335
           E++              GI+++ + E+ +AIL      L +    +          +IS 
Sbjct: 275 EVKKVDDTRYCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQ 334

Query: 336 YNEDAQRN-SHVHPDNTSTLNTNTHATIXXXXXXXXXXXXXXXPPTVMGPSXXXXXXXXX 394
             E  Q + S +   NT         TI               P  +             
Sbjct: 335 TQEMKQESLSPISLGNT---------TIKDLPRKDKTRKRLKKPQPL------------- 372

Query: 395 XXXXXXDSLSFFAGGSTNPSTTLKTVSPVVPSNASNTTSDEK---PNKVESKLGVNNA-- 449
                 DSLSFFAGG +  ++++   + +V   + +  +D     PN V+S     +   
Sbjct: 373 ------DSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPATQSPKK 426

Query: 450 RRDEQTNDQVDVVQTALQSLSSQPTTN--------------RSIQNK------GILRTEN 489
           RR  +     +++ + LQ     PT +              R  Q K      G     +
Sbjct: 427 RRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGAFNGTS 486

Query: 490 NDEMLTNASIKRR---NMPLKPLSPDVDTNLLI---------QPIDSNSNVSQETNVPKE 537
               + + S KR+     P +PL   V    ++         QP      + QET++  E
Sbjct: 487 QKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRM-QETDLYSE 545

Query: 538 SMEDNDNSSN---TLSEVN----RNILSRKSESGPHKFDVSLTKRSKSPAA----FIEAV 586
            M  +        T S++N     +I SRK  S   +  V+  KR ++PA      ++A+
Sbjct: 546 VMSGSSEEYREELTRSKLNSLDEESIKSRKRTSS--EKPVNSCKRRQAPAVPEQNIVDAI 603

Query: 587 QSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKNDSVNDMWK 646
           +  K REV RIRT IV++ P EL+E+AI +L +L IV+   +++R++        + +  
Sbjct: 604 KQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPV-DMLRQQHTVDTVGSSPLTF 662

Query: 647 GRRNFKKFNKVWPQH--RDGYDSLRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHF 704
            R+N+K F KVWP++  R      RN   +  R Y+ L+ Y+        +D  + R+ F
Sbjct: 663 ARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYE--------TDL-QSRTLF 713

Query: 705 NDENDYEVIRRGNPAVSEDDI--------LLNEMRT---------------KAIGLTDNG 741
            D         G P   +D+I        L N++ +                A+   DN 
Sbjct: 714 ED---------GAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNA 764

Query: 742 NDE---DFTRIANSDQAVPTVHGVS------RLFVADDDSE--DELQEERLEKGFGSNRN 790
             E   +F+  +  D   PT            LFV DD++E  D + +  + +     R 
Sbjct: 765 GPEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIAQRVSRER- 823

Query: 791 SNHSFVKEGSTSGILNDFSKDTVLRSHLGRKKA-FTQIDSGDEDDDG-PKFKFRRNR 845
             H+  K             DT    H  RK A      + D D+DG P F F+R R
Sbjct: 824 --HATTKPAEP---------DTAEPRHTRRKHAPRPSAAAADSDEDGEPTFAFKRAR 869

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa]
          {ON} Anc_5.435 YDR369C
          Length = 775

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 59/90 (65%)

Query: 1  MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
          M ILRY+N L DG +  VSCCL     Y+IGRSSKN   IKNDKSISRQH+++ W  +++
Sbjct: 1  MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 61 GTGTVLSVVNQGKLTAIDENYMKSDESKAF 90
              ++ + N GK+T I + Y+  DE+  F
Sbjct: 61 DKNVIIQIKNFGKVTMIKDKYLSQDETLQF 90

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 109/247 (44%), Gaps = 37/247 (14%)

Query: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60
           MWI+ +  + E     KV   LQ    YSIGRS+K    I+ DKSISR H+ I++D    
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD---- 56

Query: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSXXXXXXXXXXXXXRISWTPI---- 116
             G+ L + N+GKLT  +E  +  DE+    ++                 I   PI    
Sbjct: 57  --GSDLIITNKGKLTKFNEEIIPLDETIVVHNQN------------TVINIGGMPIDVNV 102

Query: 117 --FWDLSKDFLQFE----KSINS-MGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQ 169
             F++  K   + E    KS+ S  G+  ++  S  +  +  I  + S++S  +FALLK 
Sbjct: 103 RYFYEEWKIPHRLELNETKSLVSDFGV--KLSESFSKKTTTQICSDSSSYSGCLFALLK- 159

Query: 170 NCTLVKPVLLSEVCNVLLADCQTNFDEIWAQLF---ESFSNYTVYPGFTVEGNDILRAFQ 226
              +V    L+++  +L      +F  ++  L    + F +Y   P   V  N  L  F+
Sbjct: 160 GVPVVSIEFLNQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVP--NVLSNMTLIVFE 217

Query: 227 DVQFYTV 233
              + T+
Sbjct: 218 QKMYDTL 224

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 97/220 (44%), Gaps = 44/220 (20%)

Query: 562 ESGPH---KFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAI---N 615
           +S PH   + +  L  RS +    I A+  TK +EVKR++  I++V  SEL+E A+    
Sbjct: 573 DSRPHSVARLETDLQVRSST--NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFK 630

Query: 616 KLSNLTIVESNPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQH-RDGYDSL--RNNA 672
             + +  ++  P ++           N  W GR+NFKKF K WP + R   + L   N +
Sbjct: 631 DAAKINTIQIKPRVLASIPISNG---NTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTS 687

Query: 673 FLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAVSEDDILLNEMRT 732
             I R Y+ ++ YD ++           + H  +E D            E DI      +
Sbjct: 688 NQIGREYITMRKYDSRK----------AKKHIAEEMD------------EIDIFPCRSHS 725

Query: 733 KAIGLTD----NGNDEDFTRIANSDQAVPTVHGVSRLFVA 768
            ++G+ D    N   +   R +N + ++PT      LFVA
Sbjct: 726 NSVGVMDIAIANTEHDSGFRFSNREYSIPT----RSLFVA 761

>Ecym_3304 Chr3 (580892..582631) [1740 bp, 579 aa] {ON} similar to
           Ashbya gossypii ADL235W
          Length = 579

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 11/111 (9%)

Query: 702 SHFNDENDYEVIRRGNPAVSEDDILLNEMRTKAIGLTDNGNDEDFT----RIANSDQAVP 757
           + F  E  +E+I R      +D+  +N M    IG T N  D D+     ++A  D  +P
Sbjct: 358 AQFRPEKRHELIIRSFARFIDDNPTINHMNLILIGSTRNQEDRDYVEHLQQLAFGDLQIP 417

Query: 758 TVHGVSRLFVADDDSEDELQEERLEKGFGSNRNSNHSF---VKEGSTSGIL 805
                 +L    + + DE++    E  FG N   N  F   V E + SG++
Sbjct: 418 P----DKLQFKTNCTYDEMKLYLHESSFGINAMWNEHFGIAVVEYAASGLI 464

>SAKL0D08800g Chr4 complement(732221..733960) [1740 bp, 579 aa] {ON}
           conserved hypothetical protein
          Length = 579

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 562 ESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLS 618
           E+  ++F V L  +SK      EA+Q  KT EV+ ++ K++++  +    E  NKL+
Sbjct: 504 ETPMYEFFVELIAQSKYKGCLPEAIQEMKTMEVEVLKKKMLELRDNVRESEIWNKLT 560

>Smik_11.20 Chr11 (34512..37823) [3312 bp, 1103 aa] {ON} YKL205W
           (REAL)
          Length = 1103

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 58/147 (39%), Gaps = 19/147 (12%)

Query: 174 VKPVLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVY--------PGFTVEGNDILRAF 225
           V  +LL ++  +LL      FD I  + F  +SNY  +        P F     D L  F
Sbjct: 361 VDTILLEKIIPILLEFMNNEFDSITGKTFPFWSNYLAFLKKYKASSPNFIPLHKDFLNNF 420

Query: 226 QDVQF----YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNH----NLLK 277
           Q V F    ++   I+ DD      T+     NF+      D   ++  +      NL+ 
Sbjct: 421 QQVCFKRMKFSDDEITQDDFEEFNETIRFKLKNFQEVIVVIDPSLFLNNITQEISVNLMN 480

Query: 278 CIALKQEDPAPDEIQGIKIYAIKEIVQ 304
           C   K E+    E+   +I+ + E ++
Sbjct: 481 C---KNENWQVFELTIYQIFNLSECIK 504

>TPHA0C01390 Chr3 (314359..317730) [3372 bp, 1123 aa] {ON} Anc_7.201
           YIL026C
          Length = 1123

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 56/104 (53%), Gaps = 16/104 (15%)

Query: 140 MQSSNVRDISLVINDEKSNWSRIMFALLKQ-NCTLVKPVLLSEVCNVLL----------- 187
           M++ N  DISL  +D  + W    F L+K+ + T +  +L++EV +++L           
Sbjct: 712 MRTFNEMDISLKHDDLVTKWFAKTFELVKEMDITNLNDILINEVSSLMLHLQKFLTDKLD 771

Query: 188 -ADCQTNFDEIWAQLFESFSNYTVYPG--FTVE-GNDILRAFQD 227
            +D  ++F+E+   L+E++ N  V  G  +++E  +D L+ F +
Sbjct: 772 PSDYDSDFNELTTILYETYLNKLVLLGRSYSIELDSDFLKLFME 815

>YKL205W Chr11 (50051..53353) [3303 bp, 1100 aa] {ON}  LOS1Nuclear
           pore protein involved in nuclear export of pre-tRNA and
           in re-export of mature tRNAs after their retrograde
           import from the cytoplasm
          Length = 1100

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 58/144 (40%), Gaps = 19/144 (13%)

Query: 174 VKPVLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVY--------PGFTVEGNDILRAF 225
           V  +LL ++  +LL      FD I A+ F  +SNY  +        P F     D L  F
Sbjct: 361 VDSILLEKIIPILLEFMNNEFDSITAKTFPFWSNYLAFLKKYKASSPNFVPLHKDFLDNF 420

Query: 226 QDVQF----YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYI----KTVNHNLLK 277
           Q + F    ++   ++ DD      TV     NF+      D   ++    + ++ NL+ 
Sbjct: 421 QQICFKRMKFSDDEVTQDDFEEFNETVRFKLKNFQEIIVVIDPSLFLNNISQEISANLMN 480

Query: 278 CIALKQEDPAPDEIQGIKIYAIKE 301
           C   K E     E+   +I+ + E
Sbjct: 481 C---KNESWQIFELTIYQIFNLSE 501

>TBLA0I03150 Chr9 complement(762920..764122) [1203 bp, 400 aa] {ON}
           Anc_4.290 YLR418C
          Length = 400

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 494 LTNASIKRRNMPLKPLSPDVDTNLLIQPI-DSNSNVSQETNVPKESMEDNDNSSNTLS 550
           L N S   RN  +  LS   +T+  IQ I DSN+N+++   V  E + DN NS +TL+
Sbjct: 94  LINVSFLFRNDLINWLSGKSETSAYIQKINDSNTNINENATVLSEDVNDNINSPSTLT 151

>Suva_11.17 Chr11 (34690..35130,35204..36985) [2223 bp, 740 aa] {ON}
           YKL205W (REAL)
          Length = 740

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 55/136 (40%), Gaps = 18/136 (13%)

Query: 159 WSRIMFALLKQNCTLVKPVLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVY------- 211
           W+     LL Q  TL + +LL ++  +LL      FD I  + F  +SNY  +       
Sbjct: 6   WTLYTSNLLFQ--TLTQYLLLEKIIPILLEFMNNEFDSITGRTFPFWSNYLAFLKKYKAS 63

Query: 212 -PGFTVEGNDILRAFQDVQF----YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVT 266
            P F     D L  FQ + F    ++   ++ DD      T+     NF+      D   
Sbjct: 64  SPNFIPLHKDFLNNFQQICFRRMKFSDEEVTQDDFEEFNETIRFKLKNFQEIIVVIDPSL 123

Query: 267 YI----KTVNHNLLKC 278
           ++    + ++ NL+ C
Sbjct: 124 FLNNITQEISANLMNC 139

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,053,961
Number of extensions: 4796328
Number of successful extensions: 22800
Number of sequences better than 10.0: 674
Number of HSP's gapped: 23553
Number of HSP's successfully gapped: 783
Length of query: 845
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 727
Effective length of database: 39,950,811
Effective search space: 29044239597
Effective search space used: 29044239597
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)