Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E038205.437ON39639621420.0
NCAS0F034005.437ON4153959331e-123
NDAI0B056905.437ON4233899181e-120
TDEL0B021805.437ON4183938511e-110
Suva_2.5425.437ON4423768461e-109
Skud_4.6395.437ON4423768401e-109
Smik_4.6365.437ON4463758381e-108
YDR370C5.437ON4423798201e-105
ZYRO0F10098g5.437ON3733667696e-99
Kpol_1016.45.437ON4133797031e-88
KNAG0C048905.437ON4054066952e-87
SAKL0G02596g5.437ON4003726752e-84
CAGL0A02860g5.437ON4023396185e-76
TPHA0J026005.437ON4413836182e-75
TBLA0A028005.437ON4534336122e-74
KLTH0F15994g5.437ON3903595854e-71
Kwal_55.214155.437ON3893625751e-69
AER404C5.437ON3863554922e-57
KLLA0E02245g5.437ON4033734024e-44
NCAS0E002403.570ON3802691241e-06
NDAI0I032603.570ON3772551168e-06
KLLA0E12893g3.570ON3842251132e-05
TPHA0G036503.570ON3772301097e-05
KLTH0G00660g3.570ON383243830.085
Kpol_380.83.570ON379243820.11
Suva_7.153.570ON389234810.16
ZYRO0E09592g3.570ON380188810.18
Kwal_47.192763.570ON386225790.26
SAKL0F00726g3.570ON383182790.32
Skud_7.213.570ON389229770.58
Smik_7.153.570ON38769760.61
TDEL0D063803.570ON378183760.68
YGL246C (RAI1)3.570ON38772750.89
KAFR0J001603.570ON38073750.92
TDEL0F012802.173ON27143702.7
KNAG0C057302.492ON82174713.1
TBLA0B008102.80ON38987695.0
Kpol_1003.252.270ON310150686.5
SAKL0A04422g6.216ON36452677.2
YEL071W (DLD3)singletonON496126678.6
KLTH0G13376g8.276ON22838668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03820
         (396 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   829   0.0  
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   363   e-123
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   358   e-120
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   332   e-110
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   330   e-109
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   328   e-109
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   327   e-108
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   320   e-105
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   300   6e-99
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   275   1e-88
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   272   2e-87
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   264   2e-84
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   242   5e-76
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   242   2e-75
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   240   2e-74
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   229   4e-71
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   226   1e-69
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   194   2e-57
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   159   4e-44
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    52   1e-06
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     49   8e-06
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    48   2e-05
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    47   7e-05
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    37   0.085
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    36   0.11 
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    36   0.16 
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    36   0.18 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    35   0.26 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    35   0.32 
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    34   0.58 
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    34   0.61 
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    34   0.68 
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    33   0.89 
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    33   0.92 
TDEL0F01280 Chr6 complement(226401..227216) [816 bp, 271 aa] {ON...    32   2.7  
KNAG0C05730 Chr3 complement(1110985..1113450) [2466 bp, 821 aa] ...    32   3.1  
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    31   5.0  
Kpol_1003.25 s1003 (67857..68789) [933 bp, 310 aa] {ON} (67857.....    31   6.5  
SAKL0A04422g Chr1 complement(409833..410927) [1095 bp, 364 aa] {...    30   7.2  
YEL071W Chr5 (16355..17845) [1491 bp, 496 aa] {ON}  DLD3D-lactat...    30   8.6  
KLTH0G13376g Chr7 (1149234..1149249,1149315..1149985) [687 bp, 2...    30   8.7  

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MAAASLNATIENFHGLSLGSGKTQKTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATY 60
           MAAASLNATIENFHGLSLGSGKTQKTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATY
Sbjct: 1   MAAASLNATIENFHGLSLGSGKTQKTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATY 60

Query: 61  HDGRIYEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSRE 120
           HDGRIYEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSRE
Sbjct: 61  HDGRIYEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSRE 120

Query: 121 ELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYLG 180
           ELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYLG
Sbjct: 121 ELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYLG 180

Query: 181 NGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLTKSQKEPLFSITENQLDDN 240
           NGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLTKSQKEPLFSITENQLDDN
Sbjct: 181 NGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLTKSQKEPLFSITENQLDDN 240

Query: 241 ITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRS 300
           ITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRS
Sbjct: 241 ITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRS 300

Query: 301 PYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ 360
           PYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ
Sbjct: 301 PYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ 360

Query: 361 GDAPQAFQIKVDTFRNISIRNLSKIPQNAQIPRQYL 396
           GDAPQAFQIKVDTFRNISIRNLSKIPQNAQIPRQYL
Sbjct: 361 GDAPQAFQIKVDTFRNISIRNLSKIPQNAQIPRQYL 396

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  363 bits (933), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/395 (46%), Positives = 261/395 (66%), Gaps = 33/395 (8%)

Query: 24  QKTPIVS-PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKD 82
           ++ PI   PF  F H SI+ FP     F++ S +VA YH+ ++Y  ++   DI+P L  D
Sbjct: 19  KQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQ--YDIIPHLKND 76

Query: 83  ISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK 142
           I+++ +  SA +AR  K  Y+GSDLY GFE F  MS ++LDS  PC ++IK WE     K
Sbjct: 77  IAQLPKK-SASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK 135

Query: 143 YTENKKYTIVSARHHIVNLIMSIF--------DTSK--ETIVNSTYLGN--GLLTFSQDT 190
           Y   +K+ IVS RHHIV + M +F        +T K  + ++N  Y G+  G L F++D 
Sbjct: 136 YKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDW 195

Query: 191 SDPM-TMNEGIFTKNKNLKKICYSGFALEDLLTKSQKE-------------PLFSITENQ 236
           S+   +MNEGI++KN  LK+ICYSGFALEDL+T++  E              +F++ EN+
Sbjct: 196 SNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENK 255

Query: 237 LDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMF 296
           LDD+I +LLRCE+DA+N   + +TELKC++PLKM++  HR+KLLK W+QTGVLP SD++ 
Sbjct: 256 LDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILI 315

Query: 297 GIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELIS 356
           GIR    GEL D+EWYSRD L  + NNRNLPE+K   NFNA +A +WS HCI++IC+L+ 
Sbjct: 316 GIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVD 375

Query: 357 DNLQGDA---PQAFQIKVDTFRNISIRNLSKIPQN 388
           +NL   A   PQ FQI++D+ RNI I+ LSK+P++
Sbjct: 376 ENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKD 410

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  358 bits (918), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 182/389 (46%), Positives = 264/389 (67%), Gaps = 28/389 (7%)

Query: 27  PIVS-PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISK 85
           PI + PFK+F+H SI+ +P  P++FF+ S++VA YH+ ++Y  ++T  +++P L   I+K
Sbjct: 35  PITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDT--NLIPQLEPAIAK 92

Query: 86  IAQGVSAI-DARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYT 144
           +A    ++ +AR  K+ Y+GSDLY G+E+F  M  +ELDS  PCF YI+ WE  +   Y 
Sbjct: 93  LANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQ 152

Query: 145 ENKKYTIVSARHHIVNLIMSIFDTSK--ETIVNSTYLG--NGLLTFSQDTSDPMTMNEGI 200
              K+TIVSARHHIV + M IF+  K  + I+N TY G  NG+L FS+D +     + GI
Sbjct: 153 LGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNK--KDDGGI 210

Query: 201 FTKNKNLKKICYSGFALEDLLTKSQKE---------------PLFSITENQLDDNITLLL 245
           ++K+  ++KI YSGFALEDLLT ++ +                +F+I EN+L+D+I+LLL
Sbjct: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLL 270

Query: 246 RCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGE 305
           RCEMD+YN + + +TE+KC+A LKM +  HR+KLLK W+QTGV+P+SD++ GIR P  GE
Sbjct: 271 RCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGE 330

Query: 306 LLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELIS---DNLQGD 362
           L DIEW+SR  LYR+ NNRNLPE K  LN+NA IAV+WS HCIK+IC+L+    D  + +
Sbjct: 331 LNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLN 390

Query: 363 APQAFQIKVDTFRNISIRNLSKIPQNAQI 391
             Q+FQI+++  R I I+ L  +P N  +
Sbjct: 391 TSQSFQIRINASRAIQIKKLKSVPNNVTM 419

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  332 bits (851), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 244/393 (62%), Gaps = 18/393 (4%)

Query: 14  HGLSLGSGKTQ--KTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNET 71
           HG S    K Q  K  +  PF +F+H  + YFP+  A+FF+   EVATY +G ++  + +
Sbjct: 32  HGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSS 91

Query: 72  SQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAY 131
            + + P L    + IA+        K K+ YIG DLYQG E ++ +   ELDS++ CF Y
Sbjct: 92  KKPLYPCLQMFAALIAENRGP----KNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEY 147

Query: 132 IKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTS 191
           IKKWE     K   + K TI+S RHH+V+L+M++F   + +I+  T +G G L FS D S
Sbjct: 148 IKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSII-CTNIGKGKLIFSGDRS 206

Query: 192 DPMTMNEGIFTKNKNLKKICYSGFALEDLLTKSQKE---PLFSITENQLDDNITLLLRCE 248
                  G+ +KN   +KICYSGFALED LT S  E   P +SI E ++++ ++LLLRCE
Sbjct: 207 K--EERNGLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINERLSLLLRCE 264

Query: 249 MDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLD 308
           MDAYN +   YTELKC+  L +    HR+KLLKTW+Q G++P SDL+ G R    G+L D
Sbjct: 265 MDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLED 324

Query: 309 IEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDN--LQGDAP-- 364
           + WYSR  LY++FNN ++  N K LNFNANIAVEW  HCI++IC+L+  N     D P  
Sbjct: 325 LTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYP 384

Query: 365 --QAFQIKVDTFRNISIRNLSKIPQNAQIPRQY 395
             ++F++ VD   NI ++ L+K+P++ QIPR +
Sbjct: 385 KYESFKVIVDKSHNIIVKKLTKVPRHVQIPRAF 417

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  330 bits (846), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 245/376 (65%), Gaps = 18/376 (4%)

Query: 31  PFKRFQHRSIAYFPNHPA-NFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQG 89
           P+  F H SI  FP  P  + F  S+EVA + D ++Y      +D++P L +DIS + + 
Sbjct: 67  PYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYV--AARKDVIPNLKEDISHLYES 124

Query: 90  VSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENKK 148
              ++ARK K  Y+G DL+   +    M+  ELD+  PC +YI+ W  ++  K +   KK
Sbjct: 125 -PLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKK 183

Query: 149 YTIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTS-DPMTMNEGIFTKNKN 206
           +T+V+ RHHIV+L M  FD  +K+  + +TY+GNG ++ S++   D     EGI++ + N
Sbjct: 184 FTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPN 243

Query: 207 LKKICYSGFALEDLLTKSQKE--------PLFSITENQLDDNITLLLRCEMDAYNQLTQN 258
           +KKIC+SGF  E+ LT++ K         P+FSI E +L ++I LL+RCEMDA+N +++ 
Sbjct: 244 IKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303

Query: 259 YTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLY 318
            TELKC+ PL M +  HRKKLLKTWIQTG+LP+SD+M G+R  Y+G+LLDI+WYSRD L+
Sbjct: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363

Query: 319 RRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ---GDAPQAFQIKVDTFR 375
           R+FN+  LP NKK +N+NA +AVEW  HCIK+IC+L+  N+     + P+ F+I +D   
Sbjct: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDANG 423

Query: 376 NISIRNLSKIPQNAQI 391
            I I  LS IP+N +I
Sbjct: 424 TIIITKLSTIPRNVEI 439

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  328 bits (840), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 249/376 (66%), Gaps = 18/376 (4%)

Query: 31  PFKRFQHRSIAYFPNHP-ANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQG 89
           P+  F H SI      P  + FQ S+EVA + + + Y      +D++P L   I+++ + 
Sbjct: 67  PYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAY--TTARKDLIPSLRDGITELYES 124

Query: 90  VSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENKK 148
            S ++AR+ KV Y+G DL+   + F  M+  ELDS  PC +Y++ W+  +H K +   KK
Sbjct: 125 -SLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKK 183

Query: 149 YTIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTSDPMTMN-EGIFTKNKN 206
           +TIVSARHHIV+L M  FD  +K   +  TY+G GL++FS++  +   M+ EGI++ + N
Sbjct: 184 FTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPN 243

Query: 207 LKKICYSGFALEDLLTK--------SQKEPLFSITENQLDDNITLLLRCEMDAYNQLTQN 258
           +KKICYSGF  E  +T+          K P+FS+ E++L ++I LL+RCE+DA+N +++ 
Sbjct: 244 MKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRT 303

Query: 259 YTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLY 318
            TELKC+ PL M +  HRKKLLKTWIQTG+LP+SD++ G+R  ++G+LLDI+WYSRD LY
Sbjct: 304 NTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLY 363

Query: 319 RRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ---GDAPQAFQIKVDTFR 375
           ++FN+  LP +KK LNFNA +AVEW +HCIK+ICEL+  N+       P++F++ +D   
Sbjct: 364 KKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANG 423

Query: 376 NISIRNLSKIPQNAQI 391
            I+I  L+ +P+N ++
Sbjct: 424 TIAITKLNTVPKNVEL 439

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  327 bits (838), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/375 (42%), Positives = 250/375 (66%), Gaps = 18/375 (4%)

Query: 32  FKRFQHRSIAYFPNHPA-NFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGV 90
           +  F H  +  FP  P  + F  S+EVA + +G+ Y      +DILP L  DI+++ +  
Sbjct: 68  YTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAY--TTVRKDILPNLKGDIAELCER- 124

Query: 91  SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENKKY 149
           S +DAR+ K+ Y+G DL+     F  M+  ELDS LPC +YI+ W  ++H + +   +K+
Sbjct: 125 SLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKF 184

Query: 150 TIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTSDPMTMN-EGIFTKNKNL 207
           T+V+ RHHIV++ M +FD  +K+  + +TY+G GL++FS++  +   M+ EGI++ + N+
Sbjct: 185 TVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNM 244

Query: 208 KKICYSGFALEDLLTKS--------QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNY 259
           KKICYSGF  E+ +T+          K P+FS+ E++L + I LL+RCEMDA+N ++   
Sbjct: 245 KKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGAN 304

Query: 260 TELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYR 319
           TELKC+APL M +  HR+KLLKTWIQTG+ P+SD+M G+R  ++G+LLDI+WYSRD L  
Sbjct: 305 TELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCM 364

Query: 320 RFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDA---PQAFQIKVDTFRN 376
           +FN+  LP NK+ LN+NA +AVEW +HCIK+ICEL+  N+   +   P++F+I +D+   
Sbjct: 365 KFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNT 424

Query: 377 ISIRNLSKIPQNAQI 391
           I+I  L  IP++ ++
Sbjct: 425 IAITKLKNIPKHVEL 439

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  320 bits (820), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 162/379 (42%), Positives = 247/379 (65%), Gaps = 18/379 (4%)

Query: 28  IVSPFKRFQHRSIAYFPNHPA-NFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKI 86
           I  P+  F H  +  F   P  + F  S+EVA + +GR Y      +D++P L + I+++
Sbjct: 64  ICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAY--TILRKDLIPNLKESIAEL 121

Query: 87  AQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTE 145
            +  S ++A+K KV Y+G DL+   + F  M+  ELDS  PCF+YI+ W   +  K +  
Sbjct: 122 YES-SLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180

Query: 146 NKKYTIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTS-DPMTMNEGIFTK 203
            KK+T+V+ RHHIV+L M +F+  +++T +  TY+G GLL+F ++   D     EGI++ 
Sbjct: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240

Query: 204 NKNLKKICYSGFALEDLLTKSQKE--------PLFSITENQLDDNITLLLRCEMDAYNQL 255
           + N+KKICYSGF  E+ +T++ K         P+FS+ E++L + I LL+RCEMDA+N +
Sbjct: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300

Query: 256 TQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRD 315
           ++  TELKC+APL M +  HR+KLLKTW+QTG+LP+SD+M G+R  ++G+LLDI+WYSRD
Sbjct: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 316 GLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNL---QGDAPQAFQIKVD 372
            L ++FN+  LP NKK LN+NA IAVEW H+CI+ IC+L+  N+       P++F+I +D
Sbjct: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420

Query: 373 TFRNISIRNLSKIPQNAQI 391
           T   I I  L   P+N ++
Sbjct: 421 TNNAIVITKLKTTPRNVEL 439

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  300 bits (769), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 146/366 (39%), Positives = 235/366 (64%), Gaps = 15/366 (4%)

Query: 31  PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGV 90
           PF +FQH S   FP+ P N F   +E + Y+ G++++    S      L    +K++   
Sbjct: 17  PFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG----LKSPGNKLSHDR 72

Query: 91  SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150
           S  + R +    +GSDLYQG+E+F  +S E LDS+  C+ +I KWE  +H  Y++   + 
Sbjct: 73  SCSNKRDF----LGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFV 128

Query: 151 IVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNL-KK 209
           ++S RH++V L M +F  SK +I+  T+LG+G +  SQ  +D  +      ++N  + KK
Sbjct: 129 VISPRHYLVELTMQLFQQSKYSIL-CTHLGDGKIVLSQVENDKKSHQHT--SRNTTMTKK 185

Query: 210 ICYSGFALEDLLTKS---QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYA 266
           I +SG+ALEDLLT+    + +P F+I E +LD NI+L+LRCE+D+YN+LT+ +TELKCYA
Sbjct: 186 ILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYA 245

Query: 267 PLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNL 326
           PL M +  HR+KLLKTWIQ  + P  DL+ G+R+ + G L D+++++   LYR+ N+RNL
Sbjct: 246 PLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNL 305

Query: 327 PENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSKIP 386
           P++ K  N+NA++AV+W  HCI++IC+L+ +N+   +PQ F++ +D    I +  L  +P
Sbjct: 306 PKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEKLKHVP 365

Query: 387 QNAQIP 392
            + ++P
Sbjct: 366 AHVELP 371

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  275 bits (703), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 155/379 (40%), Positives = 235/379 (62%), Gaps = 16/379 (4%)

Query: 29  VSPFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQ 88
           + PF RF H +   FP    + F  S+ VA +   +++   E +   LPLL KDI+ I+ 
Sbjct: 40  IIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAA--LPLLKKDIANIS- 96

Query: 89  GVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENK 147
           G S ++++KYK+ Y+GSDLY   + +  +  + LDS  PCF +I+ WE  H  + Y  + 
Sbjct: 97  GKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHA 156

Query: 148 KYTIVSARHHIVNLIMSIFDTSKETIVN--STYLGNGLLTFSQDTSDPMTMNE--GIFTK 203
            YTI+S RHHI  ++MS+F+  K   V    TYL NG++  S+D +   + +   G+ + 
Sbjct: 157 DYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSS 216

Query: 204 NKNLKKICYSGFALEDLLTKSQKE---PLFSITENQLDDNITLLLRCEMDAYNQLTQNYT 260
           N   +KICYSGFA EDL+ +   E   P+FS+ E++L ++I LLLR E+D YN +T  +T
Sbjct: 217 NPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNMFT 276

Query: 261 ELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRR 320
           ELKC+APLK       K++LKTW+QTG++P SD++ GIR   +G L D+ WY+R  L R 
Sbjct: 277 ELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRT 334

Query: 321 FNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNL-QGDAPQAFQIKVDTFRNISI 379
           FNN +LP      NFNANIAVEW    +++I  L+S ++   + P +F++K+D  + ISI
Sbjct: 335 FNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSNHPCSFKLKIDNHKTISI 394

Query: 380 RNLSKIPQNA--QIPRQYL 396
           + LS+IPQ    QIP++++
Sbjct: 395 QKLSRIPQTVQRQIPKEFV 413

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  272 bits (695), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 152/406 (37%), Positives = 225/406 (55%), Gaps = 17/406 (4%)

Query: 2   AAASLNATIENFHGLSLGSGKTQKTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATYH 61
            A   +  + +FH LS+   K  +      FK F H     + + PA+ FQ S+EVA Y 
Sbjct: 6   TAIETDDLLNSFHRLSINDQKRVR------FKEFHHHDPGKYVSKPAHIFQKSKEVACYT 59

Query: 62  DGRIY--EPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFE-SMS 118
            G++Y  + N T+  ILPLL +DI+ +AQ  +   +  +K KY+G  LY GFE++  +MS
Sbjct: 60  GGKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMS 119

Query: 119 REELDSALPCFAYIKKWE--AHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNS 176
            + LDSA PC  YI +W   +    K+ E+ ++ IV  RHH+V L M++F    +  +  
Sbjct: 120 PDMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVC 179

Query: 177 TYLGNGLLTFSQ-DTSDPMTMNEGIFTKNKNLKKICYSGFALEDL--LTKSQKEPLFSIT 233
           T L    +  SQ D       NEGI   ++  + +CYSGF +  +  L +      F   
Sbjct: 180 TVLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYY 239

Query: 234 ENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSD 293
              +         CEMDAYNQ+  +YTELKCY PL M S  H+ KLL+TW+QT V P +D
Sbjct: 240 GTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTD 299

Query: 294 LMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICE 353
           ++ G R+ Y+G L DI   SR+ LYR+FNN++ P    + N+NA +AVEWS + +K I  
Sbjct: 300 VVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIR 359

Query: 354 LISDNLQGDA---PQAFQIKVDTFRNISIRNLSKIPQNAQIPRQYL 396
           LI  NL   +   PQAF + V    +I IR L  +P+ A+IP++++
Sbjct: 360 LIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  264 bits (675), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/372 (38%), Positives = 224/372 (60%), Gaps = 14/372 (3%)

Query: 33  KRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPL--LNKDISKIAQGV 90
           K F H ++++FP+ P  FFQ SRE+ T+    +        D L L  L  DI +     
Sbjct: 28  KGFVHSNVSHFPSVPCKFFQESREIGTF-TRMVSSGKYLFDDKLGLRPLKDDICEYIHN- 85

Query: 91  SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150
            A +A K K +Y+G DL  GFE++  +S +EL++      +I  WE  +  KY    K+T
Sbjct: 86  PAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFT 145

Query: 151 IVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKI 210
           IVS RHH+++LIM  F   +  ++  T+L +GLL  S D S P  ++ GI +K+  ++K+
Sbjct: 146 IVSNRHHLIDLIMCPFSLEEANLI-VTHL-DGLLIISSDKSKP-KVDSGIRSKDTRVRKL 202

Query: 211 CYSGFALEDLLTKSQKEP------LFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKC 264
           CY+GF LE+L+TK + +        +SI EN+L + ++LLL+ EMD+YN  T NY ELKC
Sbjct: 203 CYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKC 262

Query: 265 YAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNR 324
               ++ +  HR+KLL+ WIQTG++P +DL+ G R PY  +L  ++ Y+RD +Y++F+ R
Sbjct: 263 SVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTR 322

Query: 325 NLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSK 384
           NL EN+K  NFN+ +AV+WSHH I  I EL+  NL  +  Q+F++ +     +S+  L+ 
Sbjct: 323 NLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLAN 382

Query: 385 IPQNAQIPRQYL 396
            P    IP ++L
Sbjct: 383 TPA-GLIPEKFL 393

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  242 bits (618), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 133/339 (39%), Positives = 201/339 (59%), Gaps = 14/339 (4%)

Query: 50  FFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQ 109
           F+  ++ +  +HD ++YE N    D+ P L   I+ IA+   A   +  +  ++G  LY+
Sbjct: 62  FYDSAKTLGIFHDHKLYEMNR--MDLFPQLKDPIAHIAKSTPAEKTQLVR-PFLGISLYE 118

Query: 110 GFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTS 169
             + +  M+ +ELD+   C  Y+ ++E  H  KY E++ + IV+ARHH+++L +  F + 
Sbjct: 119 NHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPF-SR 177

Query: 170 KETIVN--STYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLTKS--- 224
           + T VN    Y    LL  SQD +D      G+ T N  LKKIC+SGFALED+LT+S   
Sbjct: 178 QFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESAND 237

Query: 225 -QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTW 283
            ++ P F I EN++  N  LL+RCE+DAYN +T +YTELKCYA     +P HR+KLLK+W
Sbjct: 238 EERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSW 296

Query: 284 IQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEW 343
           IQTGV+P++D++ G+R   +G L D+  Y+R+ LY +  +++LP     LN++  I+V W
Sbjct: 297 IQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVW 356

Query: 344 SHHCIKTICELIS---DNLQGDAPQAFQIKVDTFRNISI 379
               I T+   I+   D    D PQ F IKVD   NI I
Sbjct: 357 YRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  242 bits (618), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/383 (34%), Positives = 222/383 (57%), Gaps = 22/383 (5%)

Query: 31  PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDIL-----PLLNKDISK 85
           PFK F + S A+      N FQ ++ VA Y+D RI +      +++     P L KDIS 
Sbjct: 64  PFKHFSY-SNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISN 122

Query: 86  IAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTE 145
           +++ +S +D++K+K+ Y+G +LY   E F  M    LDS +PCF Y++  +     K   
Sbjct: 123 LSE-ISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY- 180

Query: 146 NKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYL----GNGLLTFSQDTS---DPMTMNE 198
           N  YT ++ RHH+  L+M+++++ +  +   ++L     + L+  S+D +   +P   N 
Sbjct: 181 NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH 240

Query: 199 GIFTKNKNLKKICYSGFALEDLLTKSQKE---PLFSITENQLDDNITLLLRCEMDAYNQL 255
            +  +N   KK+  SGF  E+L+ ++ +E   P F I+EN+L    T ++R EMD+YN  
Sbjct: 241 KL--QNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNK 298

Query: 256 TQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRD 315
           T+ +TELKC+  L +   QHRKKLLKTW QTG+ P+ D++ GIR   +G L D+ WYSR+
Sbjct: 299 TETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRE 358

Query: 316 GLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDA--PQAFQIKVDT 373
            +Y++  + +LP+ K S +F  +I ++W +HCI  I    + +    A  P  +++ +D 
Sbjct: 359 NMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYKVIIDK 418

Query: 374 FRNISIRNLSKIPQNAQIPRQYL 396
            ++I I+ LS +P+N +IP  +L
Sbjct: 419 HKSIIIKKLSIVPKNVEIPTDFL 441

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  240 bits (612), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 155/433 (35%), Positives = 230/433 (53%), Gaps = 50/433 (11%)

Query: 11  ENFHGLSL-----GSGKTQKTPIVS---PFKRFQHRSIAY------FPNHPANFFQISRE 56
           +NF  +SL      S    K P+ S   P K++Q  SI +         H ++ ++ S+E
Sbjct: 6   DNFSKMSLDGNDKNSHNIHKLPVCSHSLPGKKYQGGSIRFNSFVKPSKTHFSDLYRTSKE 65

Query: 57  VATYHDGRI---YEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFEN 113
           VATYH G +    +P       +P L  DI +IA G S +D++KYK KYIG+DL++ +E 
Sbjct: 66  VATYHLGNLNINTDPTIEHTKGVPCLKDDICQIA-GKSLLDSKKYKAKYIGADLFKDYEK 124

Query: 114 FESMSREELDSALPCFAYIKKWEAHH---HCKYTENKKYTIVSARHHIVNLIMSIFD--T 168
           + +M +E L   + CF YI+ ++  H     KY  +K++ I+++RHHI +L+++ F   +
Sbjct: 125 YHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKIS 184

Query: 169 SKETIVNSTYLGNGLLTFSQDTS-DPMTMNEGIFTKNKNLKKICYSGFALEDLLTKS--- 224
             E  V  TYLG+  +  SQD + +P    E     N +++KI  SGFA EDL+ K    
Sbjct: 185 DPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYN-SMRKIVNSGFAFEDLVIKDYTS 243

Query: 225 -----------QKEP-----LFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPL 268
                      +K+P      FS+ EN +   +T+LLR EMD YN LT +YTELKC+  L
Sbjct: 244 SKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRL 303

Query: 269 KMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPE 328
            M SP HR+KLLKTW+Q G LP+SDL+ G R    G L DI W+SRD L  + ++   P 
Sbjct: 304 NMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPR 363

Query: 329 NKKSLNFNANIAVEWSHHCIKTICELISDNLQ------GDAPQAFQIKVDTFRNISIRNL 382
            +   N     A  W +H +  I  L  D L+         P  F++ V+  R I++  L
Sbjct: 364 LRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITLLPL 423

Query: 383 SKIPQNAQIPRQY 395
            K+P +  IP  Y
Sbjct: 424 KKVPASVPIPDFY 436

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  229 bits (585), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 208/359 (57%), Gaps = 19/359 (5%)

Query: 35  FQHRSIAYFPNHPANFFQISREVAT---YHDGRIYEPNETSQDILPLLNKDISKIAQGVS 91
           F+  SI++FP  P +FF   +E+ T   + D   +E         P L KD+     G+ 
Sbjct: 24  FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQS--APHLKKDL-----GLF 76

Query: 92  AIDARKYKV-KYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150
            I  +  K   Y+G DL + +++F+ ++  +L+     F ++ KWE  H   Y+    +T
Sbjct: 77  TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFT 136

Query: 151 IVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKI 210
           IV +RH++++LIM+ F + ++   N  Y+ NG L    D       ++GI++   N+++I
Sbjct: 137 IVCSRHNLIDLIMAPF-SDEDVHFNVKYI-NGYLHIFPDKQF-QKKDDGIYSSESNIRRI 193

Query: 211 CYSGFALEDLLTKSQ----KEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYA 266
           CY+GF LEDL+T++Q    K   +S+ + ++  NI LL + EMD +N   ++YTE+KC  
Sbjct: 194 CYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTT 253

Query: 267 PLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNL 326
            LK+ S  HR+KLL+ W+QT ++PS+DL+ G+R PY  +L   E Y+R  LY++FNNRNL
Sbjct: 254 GLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNL 313

Query: 327 PENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSKI 385
              KK  N+NANI+V+W  H +K +C+ I+  ++    +A   K+   + + +R L KI
Sbjct: 314 SLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELR-LRKI 371

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  226 bits (575), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/362 (34%), Positives = 210/362 (58%), Gaps = 17/362 (4%)

Query: 33  KRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDI---LPLLNKDISKIAQG 89
           K FQH  I  FP +   FF   +EVAT     + + +E   D    +P L +D+ +  + 
Sbjct: 22  KNFQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKLGMPELVQDLCEFTES 79

Query: 90  VSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKY 149
               +    K KYIG DL   F+ +  ++ ++L+      A++++W+  H   + +N  +
Sbjct: 80  GKLAN----KGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADF 135

Query: 150 TIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKK 209
           TIV +RH++++LIM  F  S E +       NG L  S D     T ++GI + +  +KK
Sbjct: 136 TIVCSRHNLIDLIMMPF--SDEDVHLKIQFSNGYLNLSPDAQYQKT-DQGIHSGDTKIKK 192

Query: 210 ICYSGFALEDLLTKSQK----EPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCY 265
           ICY+GF LE+L+T + K       +S+ E +L D I LLL+ EMD +N  T++YTE+KC 
Sbjct: 193 ICYTGFELENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCS 252

Query: 266 APLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRN 325
           + LK+ S  HR+KLL+ W+QT ++PS++L+ GIR PY  +L   E Y+R  LYR+FNN+ 
Sbjct: 253 SGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQR 312

Query: 326 LPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSKI 385
           L   +K+ N+NA I+V+W  H I+ +C++I   ++  + +    ++   +N++I+ L K+
Sbjct: 313 LTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIK-LRKM 371

Query: 386 PQ 387
           P+
Sbjct: 372 PE 373

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  194 bits (492), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 187/355 (52%), Gaps = 26/355 (7%)

Query: 33  KRFQHRSIAYFPNHPANFFQISREVAT-YHDGRIYEPNETSQDILPLLNKDISKIAQGVS 91
           +R + RSI          F  SREV T +  G +Y+ ++     LPLLN +I +     S
Sbjct: 37  RRGKERSI--------RIFSESREVGTAFRQGLVYDLDDKKN--LPLLNDEICEYISHRS 86

Query: 92  AIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTI 151
               +   + Y+GSDL    E F  ++ EEL        +I KWEA +   Y    K+TI
Sbjct: 87  ----KSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTI 142

Query: 152 VSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKIC 211
           VS RHHI++++M  F   +  +V + + G  ++T +     P     GI + +   +KIC
Sbjct: 143 VSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLA-----PSQRPTGINSPSSATRKIC 197

Query: 212 YSGFALEDLLTKS---QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPL 268
           Y+GF LE LLT +   ++   +S  E +L+ +IT+LL+CEMDAYN   Q YTE+K     
Sbjct: 198 YTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDF 257

Query: 269 KMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPE 328
            + + +H  KLLK W QT +LPS+D++ G R P    L  +  YS D +  +   R+   
Sbjct: 258 NVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTR 317

Query: 329 NKKS-LNFNANIAVEWSHHCIKTICELISD--NLQGDAPQAFQIKVDTFRNISIR 380
           +  S  NFN  +A +W+H+ I+ ICE +S   +    +PQ+F +++D    + IR
Sbjct: 318 SHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  159 bits (402), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/373 (31%), Positives = 191/373 (51%), Gaps = 33/373 (8%)

Query: 24  QKTPIVSPFKRFQHRSIAYFPNHPANFFQISREV--ATY--HDGRIYEPNETSQDILPLL 79
           +K  +V   K+F H S+ Y  +         +EV   +Y  +D  +   NE S+   P L
Sbjct: 36  KKGSLVLSCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLW-NEASRK--PRL 92

Query: 80  NKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHH 139
             ++    +  S  + +  K  +IG DL +G++++  + R  L+S +      +++E   
Sbjct: 93  RPEVCTYIKD-SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYE--- 148

Query: 140 HCKYTENKKYTIVSARHHIVNLIMSIF-DTSKETIVNSTYLGNGLLTFSQDTSDPMTMNE 198
             K    +K T VS RHHI+++IM  F D     ++      N L++  +    P  ++E
Sbjct: 149 --KTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHE 206

Query: 199 GIFTKNKNLKKICYSGFALEDLLTKS-------QKEPLFSITENQLDDNITLLLRCEMDA 251
              T+N   KKICY+GFALEDLL +S       + E  +SI    L+D I LL++ EMD+
Sbjct: 207 ---TRNSFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDS 263

Query: 252 YNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEW 311
            N LT  YTE+K     K+ +  HR+KLL+ WIQT +LP SDL+ G R+ Y+ EL  ++ 
Sbjct: 264 INTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKA 323

Query: 312 YSRDGLYRRFNNRNL-PENKKSLNFNANIAVEWSHHCIKTICELISDNL----QGDAPQA 366
           Y    +Y + NN ++  +  K   FN N+A +W  H    I +++  NL    Q      
Sbjct: 324 YKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQH----IFQVLKQNLLLLSQESTSTT 379

Query: 367 FQIKVDTFRNISI 379
           F++++DT   +SI
Sbjct: 380 FKVQIDTNLTLSI 392

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 108/269 (40%), Gaps = 42/269 (15%)

Query: 106 DLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSI 165
           DL  G + F+  S+   D        +     H  CK  +  K  I++ R  I  LI S 
Sbjct: 58  DLSSGIKKFKDCSKNMKDRC-TLNGLLDTIMEHEKCK-NKKIKADIITFRGIIRKLISSA 115

Query: 166 FDTSKETIVN---STYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLT 222
           F+T+    +N    ++ G   +    D +D   +N     +N ++    YSG+  E L T
Sbjct: 116 FETANFNPINLRIVSFDGQLFIKDMADLNDKKVLNA---KENDHIDLGSYSGYKFETLAT 172

Query: 223 KSQKEPLFSITE---------NQLDDNIT----------LLLRCEMDAYNQLTQN----- 258
            SQ  P  S            N  D+ +T          L+L  E+D      ++     
Sbjct: 173 LSQPVPYVSRATLDKRSKKICNNGDEYVTVVKTGVGSAKLVLGAEIDCVFDFKEDGKDNL 232

Query: 259 --YTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSR 314
             Y ELKC   +  A+  H+  +K+ +TW+Q  ++    +++G R   N  L  IE YS 
Sbjct: 233 KHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDE-NYVLKTIEEYST 291

Query: 315 DGLYRRFNNRNLPENKKSLNFNANIAVEW 343
           D +     N N   N   L+     A++W
Sbjct: 292 DEIPILLKNNNTKMNSMCLD-----AIKW 315

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 106/255 (41%), Gaps = 53/255 (20%)

Query: 148 KYTIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTF-----SQDTSDPMTMNEGIFT 202
           K  I++ R  +  LI + FDT +   V+   +      F      Q+T DP+ +N     
Sbjct: 98  KADIITFRGVMRKLISAAFDTPEYNPVDLRIVSFDGQIFIKDVTKQETQDPIDLN----- 152

Query: 203 KNKNLKKICYSGFALEDLLTKSQKEPLFSIT---------ENQLDDNIT----------L 243
                   CY+G+  E L T SQ  PL S T          +  D+ I           L
Sbjct: 153 --------CYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSSKL 204

Query: 244 LLRCEMDAYNQLTQ-------NYTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDL 294
           +L  E+D      +       +Y ELKC   +  A+  HR  +KL KTW+Q  ++    +
Sbjct: 205 VLGAEIDCIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRI 264

Query: 295 MFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICEL 354
           ++G R   N  L  +E +S + +        L E+   +N +   A++W     + + +L
Sbjct: 265 IYGFRDE-NYTLKSVEEFSTEEVPIL-----LKEHNPKMNTSCIDAIKWYGLLTEWLLKL 318

Query: 355 ISDNLQGDAPQAFQI 369
           I  +  GD  + +++
Sbjct: 319 IPRD-SGDEIRPYRL 332

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 94/225 (41%), Gaps = 36/225 (16%)

Query: 106 DLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSI 165
           DL  G + F+  + EE DS       +   E +   K ++  K  I++ R  I  LI S 
Sbjct: 58  DLLSGIKKFKECNTEEFDST-TLHGLLSTLEEYERRK-SKKTKVDIITFRGIIRKLISSA 115

Query: 166 FDTSKETIVNSTYLG-NGLLTFSQDTSDPMTMNEGIFTKNKN--LKKICYSGFALEDLLT 222
           FD+S+   VN   +  +G L   +  +D    +E    KN+     +  YSG+  E L T
Sbjct: 116 FDSSQFNPVNFRIVSFDGQLFIKEVKTDA---SETSINKNRESLQARAYYSGYKFEALAT 172

Query: 223 KSQKEPLFSITE---------NQLDDNITL----------LLRCEMDAYNQLTQN----- 258
            S   PL   T          N  D  I++          L+  E+D      ++     
Sbjct: 173 LSLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIGKCKILIGAEVDCIFDFKEDSDDNL 232

Query: 259 --YTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDLMFGIR 299
             Y ELKC   +   S  H+  +KL KTW+Q  ++  + +++G R
Sbjct: 233 KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFR 277

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 100/230 (43%), Gaps = 48/230 (20%)

Query: 104 GSDLYQGFENFESMSREELDSAL--PCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNL 161
           G DL  G++ F+    E  D++      + +K +E   + K     K  IV+ R  I  L
Sbjct: 56  GLDLNGGYKKFKDYYSEFKDASTLHGLLSSLKDYEQKKNKKM----KVDIVTFRGIIRKL 111

Query: 162 IMSIFDT-SKETIVN-STYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALED 219
           IMS F+T SK  +V+    L +G L F +D S   T+N     K + +  + Y+G+  E 
Sbjct: 112 IMSSFETNSKYNVVDLRIVLFDGQL-FIKDVS---TVN----AKPEKVTPLEYTGYKFEA 163

Query: 220 LLTKSQKEPLFSITENQLD---------------------DNITLLLRCEMDAYNQLT-- 256
           L T    EPL  ++  +L+                      N  +LL  E+DA       
Sbjct: 164 LCT--LPEPLPYVSRTKLNKRPKKIVSHGDEFVSVVKTGVGNCKILLGAEVDAIFDFKEK 221

Query: 257 -----QNYTELKCYAPLKMA--SPQHRKKLLKTWIQTGVLPSSDLMFGIR 299
                Q+Y ELKC A +     + +   KL KTWIQ  ++  + + +G R
Sbjct: 222 GKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFR 271

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 101/243 (41%), Gaps = 47/243 (19%)

Query: 106 DLYQGFENF-ESMSREELDSALPCFAYIKKWEAHHHCKYTENKKY--TIVSARHHIVNLI 162
           DL  G + F E     ++D A      +K  +A+   K   NKK    I++ R  +  LI
Sbjct: 58  DLCSGIKKFKECFGNPDVD-ACTLSGLLKTIQAYEERK---NKKVPADIITFRGIMRKLI 113

Query: 163 MSIFDTSKETIVNSTYLG-NGLLTFSQ-DTSDPMTMNEGIFTKNKNLKKICYSGFALEDL 220
            + FD+ K   V+   L  NG L   + + + P   N    T +   +   YSG+  E L
Sbjct: 114 SAAFDSPKYNRVDLRVLSFNGQLFIREPNQAHPPPAN----TSSMEYRSY-YSGYKFETL 168

Query: 221 LTKSQKEPLFSITENQL-----------DDNIT----------LLLRCEMDAYNQLTQN- 258
            T S+  PL  +T N L           D  IT          L+L  E+D     T++ 
Sbjct: 169 STISK--PLPQVTRNSLEKRHKRICCNGDQYITVVRSGVGHCKLVLGAEVDCVFDFTEDS 226

Query: 259 ------YTELKCYAPLKMASPQH--RKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIE 310
                 Y ELKC   +   +      +K+ KTW+Q  ++  + +++G R   N  L  +E
Sbjct: 227 SDNLKHYAELKCTKGVSTFAEARAFERKMFKTWLQCFLVGINRVIYGFRDE-NFILRSVE 285

Query: 311 WYS 313
            YS
Sbjct: 286 EYS 288

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 98/243 (40%), Gaps = 55/243 (22%)

Query: 121 ELDSALPCFAYIKKWEAHHHC---------------KYTENK----KYTIVSARHHIVNL 161
           ELD  L     IKK++ H+                  Y E K    K  I++ R  I  L
Sbjct: 52  ELDMNLDLCGGIKKFKDHYKNFQDPGTLKGLLKTIQAYEEIKQKKVKVDIITFRGVIRKL 111

Query: 162 IMSIFDTSKETIVN-STYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDL 220
           I S FD+ K   VN    L +G + F ++   P    E    K+  +    YSG+  E+L
Sbjct: 112 ISSAFDSPKFNQVNLRIVLFDGQI-FMKEV--PRKEEE---PKDGKIAPPVYSGYKFENL 165

Query: 221 LTKSQKEPLFS----------ITENQLD---------DNITLLLRCEMDA-YNQLTQNYT 260
           +T S+  P  S          I  N  +          N  L+L  E+DA ++   ++  
Sbjct: 166 VTVSKPIPYTSRTTIEKRPKKIVSNGDEYISVVRTGVGNCKLMLGAEVDAIFDFKEEDKD 225

Query: 261 ELKCYAPLKMASP--------QHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWY 312
            LK Y  LK  +         +  +K+ KTWIQ  ++    +++G R   N  L  +E +
Sbjct: 226 NLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFRD-NNFILKSVEEF 284

Query: 313 SRD 315
           S D
Sbjct: 285 STD 287

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 87/234 (37%), Gaps = 44/234 (18%)

Query: 106 DLYQGFENFESMSREELD--SALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIM 163
           DL  GF+ F+   ++  D  S       I+  E H   K   +    I++ R     LI 
Sbjct: 58  DLSTGFQKFKDYYKDFEDRCSLRGLLGTIESSERHKGKKVNVD----IITFRGIARKLIS 113

Query: 164 SIFDTSKETIVNSTYLG-NGLLTFSQ-----DTSDPMTMNEGIFTKNKNLKKICYSGFAL 217
           S FD+     VN   +  NG L   +     D   P +    +   N+ L    ++G+  
Sbjct: 114 SAFDSPAFNAVNLRIVSFNGQLFIKEVPEAADVVKPASAAGAVPNNNQELSG--FTGYKF 171

Query: 218 EDLLT--------------------KSQKEPLFSITENQLDDNITLLLRCEMDAYNQLTQ 257
           E L T                     S  +   S+    +  N  L+L  E+D      +
Sbjct: 172 ETLATLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-NCKLILGAEVDCVFDFKE 230

Query: 258 N-------YTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDLMFGIRSPY 302
           N       Y ELKC   +   S  H+  +KL +TW+Q  ++    +++G +  +
Sbjct: 231 NGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 77/188 (40%), Gaps = 40/188 (21%)

Query: 212 YSGFALEDLLTKSQKEPLFSITENQLD---------------------DNITLLLRCEMD 250
           YSG+  E L T  Q  PL S T   LD                      N+ ++L  E+D
Sbjct: 158 YSGYKFETLATLPQPLPLVSRT--TLDKRPKKLVNTGEEYITVVKTGVGNVKVILGAEVD 215

Query: 251 AYNQLTQ-------NYTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDLMFGIRSP 301
                 +       +Y ELKC A +   +   +  +K+ +TW+Q  ++    +++G R  
Sbjct: 216 CIFDFKEEGKDNLKHYAELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYGFRD- 274

Query: 302 YNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQG 361
            N  L  +E Y+   +     + N   N   L+     A++W     + + ++I  +  G
Sbjct: 275 NNNVLKTVEEYTTTEVPVLLKSNNPAMNSSCLD-----AIKWYGTLTEWLLKMIPRD--G 327

Query: 362 DAPQAFQI 369
           D  +A+++
Sbjct: 328 DTIRAYRL 335

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 87/225 (38%), Gaps = 38/225 (16%)

Query: 106 DLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSI 165
           DL  G + F+  S      A      +K  +A+   K ++     I++ R  I  LI S 
Sbjct: 58  DLTAGIKKFKECSNNPEVDACTLDGLLKTVQAYEERKQSKVSA-DIITFRGIIRKLISSA 116

Query: 166 FDTSKETIVNSTYLG-NGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLTKS 224
           FD+ K   VN   +  NG L   + T     ++E     +    +  YSG+  E L T S
Sbjct: 117 FDSPKYNHVNLRVVSFNGQLFIREATP----IHEPPKNTDAMQYRSYYSGYKFESLATLS 172

Query: 225 QKEPLFSITENQLD---------------------DNITLLLRCEMDAYNQLTQN----- 258
           +  PL     + L+                      N  L+L  E+D      ++     
Sbjct: 173 K--PLPQTPRSSLEKRSKKICNNGDQFVTVVRSGVGNCKLVLGAEVDCVFDFAEDTSNNL 230

Query: 259 --YTELKCYAPLKMASPQH--RKKLLKTWIQTGVLPSSDLMFGIR 299
             Y ELKC   +   +      +KL KTW+Q  ++  + +++G R
Sbjct: 231 KHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYGFR 275

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 71/182 (39%), Gaps = 35/182 (19%)

Query: 148 KYTIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNL 207
           K  I++ R  I  LI S FD  +   VN   +      F ++  +P    +   T +   
Sbjct: 99  KADIITFRGIIRKLISSAFDNPRYNRVNLRIVSFDGQLFIKEVGEPFVPPK---TTDSIE 155

Query: 208 KKICYSGFALEDLLTKSQKEPLFSITENQLD---------------------DNITLLLR 246
            +  YSG+  E L+T  +  PL  ++   L+                         L+L 
Sbjct: 156 HRSYYSGYKFESLVTLPK--PLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKSKLILG 213

Query: 247 CEMDAYNQLTQN-------YTELKCYAPLKMASPQH--RKKLLKTWIQTGVLPSSDLMFG 297
            E+D      ++       YTELKC   +   +      +K+ KTW+Q  ++  + +++G
Sbjct: 214 AEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYG 273

Query: 298 IR 299
            R
Sbjct: 274 FR 275

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 87/229 (37%), Gaps = 40/229 (17%)

Query: 106 DLYQGFENFESMSREELD--SALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIM 163
           DL  GF+ F+   ++  D  S       I+  E H   K   +    I++ R     LI 
Sbjct: 58  DLSAGFQKFKDYYKDFEDRCSLRGLLETIESSERHKGKKINAD----IITFRGIARKLIS 113

Query: 164 SIFDTSKETIVNSTYLG-NGLLTFSQ--DTSDPMTMNEGIFTKNKNLKKI-CYSGFALED 219
             FD+     VN   +  NG L   +  D  D  T      T + N + +  ++G+  E 
Sbjct: 114 CAFDSPAFNAVNLRIISFNGQLFIKEVPDVIDATTAASTPGTGHSNDQDLNAFTGYKFET 173

Query: 220 LLT--------------------KSQKEPLFSITENQLDDNITLLLRCEMDAYNQLTQN- 258
           L+T                     S  +   S+    +  N  L+L  E+D      +N 
Sbjct: 174 LVTLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-NCKLILGAEVDCVFDFKENG 232

Query: 259 ------YTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDLMFGIR 299
                 Y ELKC   +   S  H+  +KL +TW+Q  ++    +++G +
Sbjct: 233 KDNLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYGFK 281

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 243 LLLRCEMDAYNQLTQN-------YTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSD 293
           L+L  E+D      +N       Y ELKC   +  AS  H+  +KL +TW+Q  ++    
Sbjct: 216 LILGAEVDCIFDFKENGRDNLKHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPR 275

Query: 294 LMFGIRSPY 302
           +++G +  +
Sbjct: 276 IIYGFKDDH 284

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 38/183 (20%)

Query: 148 KYTIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTS---DPMTMNEGIFTKN 204
           K  I++ R  I  LI + FD+ K   V+   +      F +D +   + + M     T++
Sbjct: 98  KADIITFRGVIRRLISAAFDSPKFNKVDLRVVAFDGQIFIRDVASKDEELRMT----TES 153

Query: 205 KNLKKICYSGFALEDLLTKSQKEPLFSITE---------NQLDDNIT----------LLL 245
           +N     Y+G+  E + T SQ  P               N  D+ IT          L+L
Sbjct: 154 RN---AWYTGYKFETVATLSQPLPYVDRETVEKRPKKLVNTGDEYITVVRTGVGNSKLIL 210

Query: 246 RCEMDAYNQLTQ-------NYTELKCYAPLKMASPQHR--KKLLKTWIQTGVLPSSDLMF 296
             E+D      +       +Y ELKC A +   +   +  KK+ KTW+Q  ++    +++
Sbjct: 211 GAEVDCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRIIY 270

Query: 297 GIR 299
           G R
Sbjct: 271 GFR 273

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 240 NITLLLRCEMDAYNQLTQN-------YTELKCYAPLKMASPQHR--KKLLKTWIQTGVLP 290
           N  L+L  E+D      +N       Y ELKC   +   S  H+  +KL +TW+Q  ++ 
Sbjct: 213 NCKLILGAEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVG 272

Query: 291 SSDLMFGIRSPY 302
              +++G +  +
Sbjct: 273 IPRIIYGFKDDH 284

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 257 QNYTELKCYAPLKMAS--PQHRKKLLKTWIQTGVLPSSDLMFGIRS-PYNGELLDIEWYS 313
           ++Y ELKC   L          KKL KTW+Q  ++    + +G R   YN  L  IE Y 
Sbjct: 230 KHYLELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRDRSYN--LTSIEEYL 287

Query: 314 RDGLYRRFNNRNL 326
            + + + F NR +
Sbjct: 288 TEDVPKLFTNRGV 300

>TDEL0F01280 Chr6 complement(226401..227216) [816 bp, 271 aa] {ON}
           Anc_2.173 YOR107W
          Length = 271

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 257 QNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIR 299
           QN+ ++   AP++   PQ  KK  + W   GV+PS D++   R
Sbjct: 83  QNFIQVN--APMECNLPQDIKKAYQEWYDHGVIPSRDVVLEAR 123

>KNAG0C05730 Chr3 complement(1110985..1113450) [2466 bp, 821 aa]
           {ON} Anc_2.492 YMR078C
          Length = 821

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 8/74 (10%)

Query: 32  FKRFQHRSI--------AYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDI 83
           F+   H+S+         Y P  P +FF    +VA   D RI  P    ++IL   +  +
Sbjct: 541 FQDLMHKSLYTHNGELLRYCPTVPLSFFHHFGDVANKTDQRIKNPEYEQREILKQNSDIV 600

Query: 84  SKIAQGVSAIDARK 97
           S I  GVS++  ++
Sbjct: 601 SSIQDGVSSVAPKR 614

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 16/87 (18%)

Query: 166 FDTSKETIVNSTYLGNGLLTFSQDTSD--------PMTMNEGIFTKNKNLKKICYSGFAL 217
           FDT+KE ++         L  S+   D        P+  N+G        KK+   GF  
Sbjct: 119 FDTTKEELIRLIVAKTKTLEESKQVKDANIIRVKLPLAQNDG--------KKLKIKGFCY 170

Query: 218 EDLLTKSQKEPLFSITENQLDDNITLL 244
            D  T++Q E + S++E QL+    L+
Sbjct: 171 MDFETEAQMESVISLSECQLNGRKLLI 197

>Kpol_1003.25 s1003 (67857..68789) [933 bp, 310 aa] {ON}
           (67857..68789) [933 nt, 311 aa]
          Length = 310

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 15/150 (10%)

Query: 208 KKICYSGFALEDLLTKSQKEPLFSITENQLDD-NITLLLRCEMDAYNQLTQ-NYTELKCY 265
           K I     A E+ +  +Q   +F+   +  DD N T+LL+ E  +  Q +   +  +  Y
Sbjct: 64  KSIELFKMARENGIPPNQISNVFNFGNSTQDDTNKTVLLKSESISSQQPSSYKFPPVGNY 123

Query: 266 APLK-MASPQHRKKLLKTWIQTGVLPS---SDLMFGIRSPYNGELLDIEWYSRDGLYRRF 321
            P K +A P+HR+      I    + S   + +      P+   +  I   + +G Y   
Sbjct: 124 LPPKSIAKPKHRRTNSPARIGASAIASLGGTIIKEETTPPHRSSVSPIPIPNENGTYMHR 183

Query: 322 NNRNLPENKKS---------LNFNANIAVE 342
            N +LP N  S         LNFN+N  ++
Sbjct: 184 RNMSLPMNSSSNTFSGMTSVLNFNSNSTLQ 213

>SAKL0A04422g Chr1 complement(409833..410927) [1095 bp, 364 aa] {ON}
           similar to uniprot|P53164 Saccharomyces cerevisiae
           YGL067W NPY1 NADH diphosphatase (pyrophosphatase)
           hydrolyzes the pyrophosphate linkage in NADH and related
           nucleotides localizes to peroxisomes
          Length = 364

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 305 ELLDIEWYSRDGLYRRFNN---RNLPENKKSLNFNANIAVEWSHHCIKTICE 353
           ELLD +W+    + R  +N     L E K  +NF  N A+  +H  I  +C+
Sbjct: 306 ELLDAQWFDTAEIARYMDNYQGDGLVEFKDGINFPGNTAI--AHQLISYVCD 355

>YEL071W Chr5 (16355..17845) [1491 bp, 496 aa] {ON}  DLD3D-lactate
           dehydrogenase, part of the retrograde regulon which
           consists of genes whose expression is stimulated by
           damage to mitochondria and reduced in cells grown with
           glutamate as the sole nitrogen source, located in the
           cytoplasm
          Length = 496

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query: 86  IAQGVSAIDARKYKVKYIGSDLYQGFENFESM------SREELDSALPCFAYIKKWEAHH 139
           +  GVS + A K K     + ++ G ENF+++      ++ EL   L  F ++ +     
Sbjct: 232 VVTGVSIVAAAKPKAL---NAVFFGIENFDTVQKLFVKAKSELSEILSAFEFMDRGSIEC 288

Query: 140 HCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEG 199
             +Y ++  + +   +H+   LI    +TS     N  +    L  F +DT+D   ++EG
Sbjct: 289 TIEYLKDLPFPL-ENQHNFYVLI----ETSGS---NKRHDDEKLTAFLKDTTDSKLISEG 340

Query: 200 IFTKNK 205
           +  K+K
Sbjct: 341 MMAKDK 346

>KLTH0G13376g Chr7 (1149234..1149249,1149315..1149985) [687 bp, 228
           aa] {ON} similar to uniprot|Q12255 Saccharomyces
           cerevisiae YLR093C NYV1 v-SNARE component of the
           vacuolar SNARE complex involved in vesicle fusion
           inhibits ATP- dependent Ca(2 ) transport activity of
           Pmc1p in the vacuolar membrane
          Length = 228

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 52  QISREVATYHDGRIYEPNETS-QDILPLLNKDISKIAQ 88
           Q   E+ TYHD    E  E   QDI+ L+N +I K  Q
Sbjct: 129 QFHEELLTYHDSSTAEATEQDLQDIIQLMNDNIDKFLQ 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,359,900
Number of extensions: 2115586
Number of successful extensions: 5780
Number of sequences better than 10.0: 63
Number of HSP's gapped: 5906
Number of HSP's successfully gapped: 63
Length of query: 396
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 284
Effective length of database: 40,638,807
Effective search space: 11541421188
Effective search space used: 11541421188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)