Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E038105.441ON49049026480.0
TBLA0A027905.441ON54753911491e-152
CAGL0A02904g5.441ON50150811441e-152
TDEL0D026005.441ON52352011401e-151
SAKL0G02684g5.441ON53953011351e-150
ZYRO0F10186g5.441ON51950811201e-148
NDAI0B057105.441ON56347111241e-148
KNAG0C048705.441ON45847410971e-146
Kpol_1062.255.441ON53352210821e-142
KLLA0E02333g5.441ON48049510331e-136
TPHA0E017205.441ON53747110221e-133
NCAS0F034205.441ON52551510111e-132
Ecym_45125.441ON5274769901e-129
Skud_4.6405.441ON5114859731e-126
YDR371W (CTS2)5.441ON5114609721e-126
Smik_4.6375.441ON5114539691e-126
Suva_2.5435.441ON5114999541e-123
ACL166W5.441ON4904299091e-117
Kwal_55.214025.441ON5165218251e-104
KLTH0F15906g5.441ON5154738221e-104
TBLA0C041904.88ON12346711.1
CAGL0F08965g5.305ON639125761.1
Kwal_33.130821.20ON447128696.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03810
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...  1024   0.0  
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   447   e-152
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   445   e-152
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   443   e-151
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   441   e-150
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   436   e-148
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   437   e-148
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   427   e-146
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   421   e-142
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   402   e-136
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   398   e-133
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   394   e-132
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   385   e-129
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   379   e-126
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   379   e-126
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   377   e-126
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   372   e-123
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   354   e-117
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   322   e-104
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   321   e-104
TBLA0C04190 Chr3 complement(1012769..1013140) [372 bp, 123 aa] {...    32   1.1  
CAGL0F08965g Chr6 complement(880296..882215) [1920 bp, 639 aa] {...    34   1.1  
Kwal_33.13082 s33 complement(68025..69368) [1344 bp, 447 aa] {ON...    31   6.2  

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score = 1024 bits (2648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/490 (100%), Positives = 490/490 (100%)

Query: 1   MMSFKQLIKYFVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERMHESRNRSFSC 60
           MMSFKQLIKYFVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERMHESRNRSFSC
Sbjct: 1   MMSFKQLIKYFVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERMHESRNRSFSC 60

Query: 61  GLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILKNNK 120
           GLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILKNNK
Sbjct: 61  GLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILKNNK 120

Query: 121 LVKGNVGELFDLKMKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFD 180
           LVKGNVGELFDLKMKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFD
Sbjct: 121 LVKGNVGELFDLKMKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFD 180

Query: 181 GIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDK 240
           GIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDK
Sbjct: 181 GIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDK 240

Query: 241 LEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEG 300
           LEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEG
Sbjct: 241 LEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEG 300

Query: 301 LNGDYAVKYMINQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASE 360
           LNGDYAVKYMINQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASE
Sbjct: 301 LNGDYAVKYMINQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASE 360

Query: 361 GEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGG 420
           GEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGG
Sbjct: 361 GEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGG 420

Query: 421 GFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKY 480
           GFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKY
Sbjct: 421 GFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKY 480

Query: 481 LKEYEKNEFQ 490
           LKEYEKNEFQ
Sbjct: 481 LKEYEKNEFQ 490

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  447 bits (1149), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 239/539 (44%), Positives = 337/539 (62%), Gaps = 82/539 (15%)

Query: 12  VILSTILIALDLFMCQMFPMFRRRGEEDRRG----------VTLDDERMHESRN------ 55
           +IL+ I I L   MC    +F ++ E+              +   D  + +++N      
Sbjct: 13  IILTFIAITLITEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVA 72

Query: 56  --RSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ- 112
             + ++ G+YYSNWS Y PR HFPH+I+F  ISHVYY+FFLV+G NGK+  GDKW+D + 
Sbjct: 73  NPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEM 132

Query: 113 ---RPI------LKN---------------NKLVKGNVGELFDLKMKNRV---------- 138
              +P+      LKN                 L KG +GE F L+    +          
Sbjct: 133 DLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKN 192

Query: 139 -KCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQ 197
            K IM IGGWSNR+++   +  P KI +F   A++MMFEYGFDGIDLDWE+P+++  EP 
Sbjct: 193 FKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPA 252

Query: 198 LYLEIMRRIKHHMNKLESEIFKDTSATTS---YFELSVATPAFKDKLEIFPLKEMDTVID 254
           +YL+IM++++  MN+LE EI+K+++       +F+LSVA+PAF++KL + P+KEM+ V+D
Sbjct: 253 VYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLD 312

Query: 255 YWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI-NQ 313
           YWNMMTYDY GEWSE+TGYHSNLYDGSK        ++H   + E LN D A+KYMI  Q
Sbjct: 313 YWNMMTYDYNGEWSEKTGYHSNLYDGSK--------VKH---DEEVLNADSAIKYMIETQ 361

Query: 314 GIKKDKIILGMAAYGRGFTNVDVPTPR---PNESPR-------YIGRTFDGVGGASEGEP 363
           G++ +K++LG+A YGRG+TNV+V   +    N   R       +I   + GVGG SEGEP
Sbjct: 362 GVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEP 421

Query: 364 GMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFW 423
           GMW Y+QLPI G++EQFDP++VS YC++  T T V YD ++S+ VK QY+K K + GGF 
Sbjct: 422 GMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFM 481

Query: 424 WESCGDTHKNPERSLVNAYVKELGRDNIKKPE-SIYKNLHCVSHYKQSFHGKGFLSKYL 481
           WESCGD H NP+RSL+ A+  ELG+  IKK E SI+++      Y + F  +G+LS+ +
Sbjct: 482 WESCGDVHDNPKRSLITAFTNELGK--IKKQESSIFQDEKTFEFYLEEFGNEGYLSEAI 538

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  445 bits (1144), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/508 (47%), Positives = 314/508 (61%), Gaps = 47/508 (9%)

Query: 5   KQLIKYFVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERMHES---RNRSFSCG 61
           K+L  + VIL T LI       ++F   +RR + D       D RM ES    N S+  G
Sbjct: 7   KRLGTFIVILITSLILQMSLHYKIFQKLKRRSQSD-------DYRMPESDVLSNTSYIAG 59

Query: 62  LYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK---- 117
           LYYSNWS YEPRLHFPH+I+F+ +SH+YYAF L+D + G L S D+W+D Q  + K    
Sbjct: 60  LYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQCRE 119

Query: 118 ---------------NNKLVKGNVGELFDL-----KMKNR-VKCIMCIGGWSNREAWHIF 156
                          N +   G +GEL  L     K+K R VK IM +GGWSNRE++ I 
Sbjct: 120 YMFKRFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIM 179

Query: 157 STDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESE 216
             D  K ++F    ++ M  YGFDGIDLDWE+PEDD  EP  YL + R +K  + KLE+ 
Sbjct: 180 VRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEAN 239

Query: 217 IFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSN 276
           I  D S  T  F+LS+ATPAFKDKL I P+ ++D  ID WN+MTYDYYGEWSERTG H+N
Sbjct: 240 ILGDHSNKT--FQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHAN 297

Query: 277 LYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVD 335
           LY+  KG      +  H   E  GL+GD A+ YM+N+  I   K+ILGMAAYGRGFTNVD
Sbjct: 298 LYN-EKGKL----LHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVD 352

Query: 336 VPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTG 395
           + +  P+      G  F GVGGASEGEPGMW Y+QLPIPG+ E++D R+V  YC++  T 
Sbjct: 353 MKSTNPHNP---YGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTH 409

Query: 396 TFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPE 455
           T VGYD   SV  K  YI    +GG FWWESCGDTHKNP+RSL+N Y++ + R+     E
Sbjct: 410 TLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVI-RNVKNNKE 468

Query: 456 SIYKNLHCVSHYKQSFHGKGFLSKYLKE 483
           +IY       +Y +++   GFL+ ++K+
Sbjct: 469 TIYSTTKLHDYYLENYDTNGFLTGFIKD 496

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  443 bits (1140), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 235/520 (45%), Positives = 324/520 (62%), Gaps = 49/520 (9%)

Query: 2   MSFKQLIKYFVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERMHESRNRS---- 57
           M  +  + + VI+  IL ++ + MC    +F R  +  R+ V     +  +++  +    
Sbjct: 1   MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQ--RKVVDYVQSQPQQAQLVTNPGT 58

Query: 58  -----FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWAD-- 110
                +  GLYYSNWS Y PR+HFPH+I+   +SH+YYAFFLVDG  G L  GD+W+D  
Sbjct: 59  VEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVG 118

Query: 111 --FQRPI-LKNNKL---------------VKGNVGELFDLKMKN--------RVKCIMCI 144
               +P+ +K NKL                 G +GELF ++  N          K IMC+
Sbjct: 119 MDLYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCV 178

Query: 145 GGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMR 204
           GGWSNRE +     +P +++ F +  ++ MF+YGFDGIDLDWE+PEDDG EPQ+YL++ +
Sbjct: 179 GGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAK 238

Query: 205 RIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYY 264
           R+K  MN+LE  IF   +     F+LS+ATPAF +KL+I P+ EMD  ID WNMMTYDY+
Sbjct: 239 RLKERMNELEDAIF-GPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYH 297

Query: 265 GEWSERTGYHSNLYDGSKGSTTIESVLRHGMS--EVEGLNGDYAVKYMIN-QGIKKDKII 321
           GEWSE+TGYH NLY+GS  S   E+  +H  S   VEGL+   A+++M+N  G+   KI 
Sbjct: 298 GEWSEKTGYHCNLYNGSTKSFD-ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKIC 356

Query: 322 LGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFD 381
           LGMAAYGRGFTNV   +       R+I + F GVGGAS+GEPGMW Y+QLPI GT E FD
Sbjct: 357 LGMAAYGRGFTNVVAQS----TDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFD 412

Query: 382 PRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNA 441
           P YVSG+C+  T+ TFVGYD+++SVR K QY++ K++ GGFWWESCGD H N  RSL+NA
Sbjct: 413 PDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNA 472

Query: 442 YVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481
           +  E+ +   K  + +Y+    + +Y   F    FLS ++
Sbjct: 473 FTNEI-KFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFI 511

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  441 bits (1135), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 227/530 (42%), Positives = 328/530 (61%), Gaps = 60/530 (11%)

Query: 2   MSFKQLIKYFVILSTILIALDLF-MCQMFPMFRRRGEEDRRGVTLDDERMHESRN----- 55
           M +K+ + +   L  +L +L    M   F   + R  +  + +  D      ++N     
Sbjct: 20  MQWKRSLTFQTFLICLLTSLLFLEMSVFFGTLKGRATQKFKQIYSDMNSNDNNQNLQEEV 79

Query: 56  -------RSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKW 108
                  +S+  G+YY+NWS Y PR HFPH++NF  I++V+Y+FF+VD K+G + S D+W
Sbjct: 80  GPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEW 139

Query: 109 ADFQRPILKN-----------------------NKLVKGNVGELFDLK------------ 133
           +DFQ  + K                          L  G +GELF LK            
Sbjct: 140 SDFQMDLYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDG 199

Query: 134 MKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDG 193
           +    K  M +GGWSNR+A+ I   D +K ++F    V+ MF+YGFDG+D+DWE+P++DG
Sbjct: 200 VHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDG 259

Query: 194 IEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVI 253
           +EP++YL ++RR++  ++ LE +IF+D   +  +F L+VA PAFK+KL++ PL++MD  +
Sbjct: 260 LEPKMYLTMIRRLREALDDLERDIFQDEHHSEHFF-LTVAVPAFKEKLQVLPLRDMDAYV 318

Query: 254 DYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI-N 312
           D+WN+M YDY+GEWSE TGYHSNLY  S+ S  +    RH   E   LN D AVKY++ N
Sbjct: 319 DFWNLMAYDYHGEWSELTGYHSNLY--SEDSNHVHR--RHFRDEENQLNADSAVKYLLKN 374

Query: 313 QGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLP 372
            GI   K++LGMAAYGRGFT V         S  YIG+ ++GVGGASEGEPGMW Y+QLP
Sbjct: 375 FGINSRKVVLGMAAYGRGFTRVKTTA----NSGSYIGKPYNGVGGASEGEPGMWLYNQLP 430

Query: 373 IPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHK 432
           +PGT+E FDPR VS Y F+P + TFVGYD +DS+R K QY+K  ++ GGFWWESCGD HK
Sbjct: 431 LPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHK 490

Query: 433 NPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLK 482
           + ++SL+NA+  +LG    ++P SIY + H + +Y +++  +GFLS+  K
Sbjct: 491 DEQKSLLNAFTNDLGSLAKQQP-SIYTSAHVIRYYLKNY-PQGFLSRVFK 538

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  436 bits (1120), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 230/508 (45%), Positives = 318/508 (62%), Gaps = 47/508 (9%)

Query: 12  VILSTILIALDLFMCQMFPMFRRRGEEDRRGV-------TLDDERMHESR--NRSFSCGL 62
           +IL+ I+ ++ + MC    +F+   E D           +L   + H +   +  ++ GL
Sbjct: 13  IILAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGL 72

Query: 63  YYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ----RPI--- 115
           YYS+WS Y PR HFPH+I+F  +SH+YYAFFL+DG  G+L S D+W+DFQ    +P+   
Sbjct: 73  YYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVK 132

Query: 116 -----LKNNK-------LVKGNVGELFDLKMKN--------RVKCIMCIGGWSNREAWHI 155
                LKN+        L KG VGELF L+             K +M +GGWSNR+ W  
Sbjct: 133 LNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPK 192

Query: 156 FSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLES 215
              DP ++E+F    V+ MF+YGFDGIDLDWE+P++DG EP++YLE+ R+++   ++LE 
Sbjct: 193 MVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEE 252

Query: 216 EIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHS 275
            IF         F+LS+ATPAFKDKL + P+KE+D  ID WNMMTYDY+GEWS  TGYH 
Sbjct: 253 VIFA-GEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHC 311

Query: 276 NLYDGSKGSTTIESVLRH-GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTN 333
           NLYDG      + S  +H   S+ EGL+ + A+  MIN+ G+   KI LGMAAYGRGFT+
Sbjct: 312 NLYDGP---VKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTH 368

Query: 334 VDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPT 393
           V   +       R+I ++F GVGGASEGEPGMW Y+QLPI G+ E++DP YVSG+CF+  
Sbjct: 369 VKASS----NDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHK 424

Query: 394 TGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKK 453
           T TFVGYD ++SV+VK  Y+K   + GGFWWESCGD H +P+RSL+NA+   + +   K 
Sbjct: 425 TKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRI-KTIAKN 483

Query: 454 PESIYKNLHCVSHYKQSFHGKGFLSKYL 481
             S+Y     + +Y + F    FLS ++
Sbjct: 484 ENSVYHKPEALRYYLEKFGQDEFLSPFI 511

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  437 bits (1124), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 221/471 (46%), Positives = 293/471 (62%), Gaps = 48/471 (10%)

Query: 55  NRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRP 114
           N +F  G+YYS+WS Y+PR HFPH+I+   I+HVYY+FFLV+G  G +   D+W+D +  
Sbjct: 90  NNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMD 149

Query: 115 ILK-----------NNKLVK--------------------GNVGELFDLKMKNRVKCIMC 143
           + K           N+K++                     G VGELF LK     K IM 
Sbjct: 150 LYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQNFKLIMS 209

Query: 144 IGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIM 203
           IGGWSNRE +     D +K+  F E +V+ MF+YGFDGIDLDWE+PEDDG EP  YLEI+
Sbjct: 210 IGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIV 269

Query: 204 RRIKHHMNKLESEIFKDTSATTS---------YFELSVATPAFKDKLEIFPLKEMDTVID 254
           +R++  M+KLE +IF+ +  +            FELSVATPAF +KL I P+KEM+  ID
Sbjct: 270 QRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKEMNKYID 329

Query: 255 YWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI-NQ 313
           YWNMMTYDYYG+WSE TGYH NLY+G    T          S  +GLN + A+ YM+ N 
Sbjct: 330 YWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNN 389

Query: 314 GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPI 373
            +   K++LG+AAYGRGFT V V          +I + FDGVGGAS GEPGMW Y+QLPI
Sbjct: 390 NVSSRKLVLGLAAYGRGFTKVKVNK----NDELFINKKFDGVGGASAGEPGMWLYNQLPI 445

Query: 374 PGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKN 433
             + E FDP YVS +C++P T TFVGYD +D+++VK +Y++ + + GGFWWESCGD HK+
Sbjct: 446 KNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKH 505

Query: 434 PERSLVNAYVKELGRDNIKKPES---IYKNLHCVSHYKQSFHGKGFLSKYL 481
           PERSL+NA+  +L   ++ K E    IY+    + +Y   F   GFLS + 
Sbjct: 506 PERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  427 bits (1097), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 299/474 (63%), Gaps = 24/474 (5%)

Query: 11  FVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERMHESRNRSFSCGLYYSNWSAY 70
             I +  L+++ + +   F     +  E          +  ++ N+ +  G+YYS+WS Y
Sbjct: 7   ITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPP---AQCPQNVNQKYVSGVYYSDWSPY 63

Query: 71  EPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILKNNKLVKGNVGELF 130
           EPR+HFP  I+   I+H+YY+FFLVD  +  L  GD W+D + P+ KN  ++KG +G L 
Sbjct: 64  EPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNT-VLKGCIGALN 122

Query: 131 DLK-MKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYP 189
            L+  K   K IM +GGWSN++A+ +       +E   +  V+ MF+YGFDGIDLDWEYP
Sbjct: 123 SLRDEKPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYP 182

Query: 190 EDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEM 249
           +DDG EP++YLE+MR+I+ HMN+LE  I+ D       F LSVATPAF DKLE FP+KEM
Sbjct: 183 KDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRR---FHLSVATPAFYDKLETFPIKEM 239

Query: 250 DTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKY 309
           D  IDYWNMMTYDYYGEWS  TG+HSNLYDG+           +  SE   L  D A++Y
Sbjct: 240 DQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGT-----------NKFSE-HSLCADGAIRY 287

Query: 310 MINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRY 368
           M N+ GI   K++LGMA YGRGFTNV    P+  ++   I R F GVGG SEGEPGMW Y
Sbjct: 288 MTNKIGINSRKVVLGMALYGRGFTNVKEGDPK--KTSGLINRKFKGVGGESEGEPGMWLY 345

Query: 369 DQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCG 428
           +QLPI GT E FD +Y S YCF+P T T VGYD +DS R K QY++  ++ GGFWWESCG
Sbjct: 346 NQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCG 405

Query: 429 DTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLK 482
           +   N ++SLV+ + +++ R + +   ++Y++     HY Q F   GFL+   K
Sbjct: 406 NKWDNVQQSLVHVFNEDIERLD-RNETNLYQDPKLREHYLQIFAKSGFLAATFK 458

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  421 bits (1082), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/522 (41%), Positives = 318/522 (60%), Gaps = 57/522 (10%)

Query: 7   LIKYFVILSTILIALDLFMCQMFPMFRRRGEEDRRGVTLDDERM------HESRNRSFSC 60
           L   FVI+S   I ++ F+ Q F   +   +E+    ++++ ++        + +  +  
Sbjct: 12  LALLFVIIS---IMVESFLYQKF--LKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDV 66

Query: 61  GLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK--- 117
           G+YYSNWS Y PRLH PH+++F  ++HVYYAFF+VD K G L + D W+DF+    K   
Sbjct: 67  GVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLA 126

Query: 118 ----------------NNKLVKGNVGELFDLKMKN--------RVKCIMCIGGWSNREAW 153
                            N L  G +GELF L+           + K IM +GGWSNREA+
Sbjct: 127 MKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAF 186

Query: 154 HIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKL 213
                D  K+++F    ++ MF YGFDGI+LDWE+P+DD +EP++YLE+++++K   N+L
Sbjct: 187 PRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNEL 246

Query: 214 ESEIFKDTS----ATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSE 269
           E +IF ++     +    F LS+A PAFK+KL+I  ++EMD  +D WNMMTYDY+GEWSE
Sbjct: 247 EQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSE 306

Query: 270 RTGYHSNLYDGSKGSTTIESVLRHGMSEV---------EGLNGDYAVKYMINQ-GIKKDK 319
           +TGYHSNLY   +     +                     LNGDYA+ Y+I +  I   K
Sbjct: 307 KTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKK 366

Query: 320 IILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQ 379
           I LGMAAYGRGFT V+  +    +  R+I + + GVGGASEGEPGMW Y+QLPI  ++E+
Sbjct: 367 INLGMAAYGRGFTKVNASS----QDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEE 422

Query: 380 FDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLV 439
           FDP YVS +C++  + TFVGYD  DS++VK QY+K  ++ GGFWWESCGD HKNPE+SL+
Sbjct: 423 FDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLL 482

Query: 440 NAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481
           NA+  E+G    +K E+++ N+  + +Y ++    GFLS ++
Sbjct: 483 NAFTDEIG-SVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFI 523

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  402 bits (1033), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 223/495 (45%), Positives = 306/495 (61%), Gaps = 40/495 (8%)

Query: 8   IKYFVILSTILIALDLFMCQMFPMF----RRRGEEDRRGVT-LD-DERMHESRNRSFSCG 61
           +K+++I+  I++A  + MC +  +F    ++ G   RR  T +D D R+       FS  
Sbjct: 12  LKFWIII--IVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVA 69

Query: 62  LYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILKNNKL 121
            YYSNWS Y  R H P +I    ++HVYYAFF+VD K+G + S D W+DF+ P+      
Sbjct: 70  TYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPLSVG--- 126

Query: 122 VKGNVGELFDLKM--KNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGF 179
           VKG + EL  +K+  K+  K I+C+GGWSNREA+   +    K++ F E AV  MF YGF
Sbjct: 127 VKGCIKELQKIKLESKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGF 186

Query: 180 DGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSY--FELSVATPAF 237
           DGIDLDWE+PE+D  EP +YLE+MR I+  M++LE +IF   +    +  F+LSVATPAF
Sbjct: 187 DGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAF 246

Query: 238 KDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLY-DGSKGSTTIESVLRHGMS 296
            +KL I P+ EM   +D WNMM YD++GEWS+ TGYHSNLY  G     ++ + + +   
Sbjct: 247 AEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLSNRISN--- 303

Query: 297 EVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGV 355
               L+ D AVK M ++  I   +I LGMAAYGRGFTNV+           Y+G+ + GV
Sbjct: 304 --SSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVET------NDDNYLGKKYHGV 355

Query: 356 GGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKM 415
           GG SEGEPG+W Y+QLPI G+ EQFD   VS YCF+P + TFVGYD + S+ +K +YIK 
Sbjct: 356 GGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKK 415

Query: 416 KDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKG 475
           K++ GGFWWESCGD+ K+P +SLVNA+ KE+G                VS +K     + 
Sbjct: 416 KNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLSE-----------GFVSLFKSDKVKQF 463

Query: 476 FLSKYLKEYEKNEFQ 490
            L KY K+Y  + FQ
Sbjct: 464 HLQKYPKDYISSLFQ 478

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  398 bits (1022), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 292/471 (61%), Gaps = 44/471 (9%)

Query: 46  DDERMHESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSG 105
           + E+ + + N  +S G+YYSNWS Y PRL FPH+I+   +SHVYY+F LVDG  G + S 
Sbjct: 66  NSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSS 125

Query: 106 DKWADFQ----RPI-----------------LKNNKLVKGNVGELFDLKMKNRV------ 138
           D W+DFQ    +P+                 +K   L  G +GE F L+   R+      
Sbjct: 126 DTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLR-NTRIPIHGPK 184

Query: 139 ----KCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGI 194
               K  M +GGWSNREA+     DP K++ F    +  MF YGFDGIDLDWE+PEDDG 
Sbjct: 185 STDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGF 244

Query: 195 EPQLYLEIMRRIKHHMNKLESEIFKDT-SATTSY--FELSVATPAFKDKLEIFPLKEMDT 251
           EP +YL+I++R+K  M +LE+ I+KD  S  TSY  FELS+A PAF +KL I P+++MD 
Sbjct: 245 EPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDK 304

Query: 252 VIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI 311
            +D WNMMTYDY GEWS+ TGYHSNL+     S ++  + R   +  E L GD AVKYM 
Sbjct: 305 FVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSV--MKRSQSNSNETLCGDNAVKYMK 362

Query: 312 -NQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQ 370
            N  I   KIILGMAAYGRGF+ V     +   + +  G+ F+GV G+S  EPG+W Y++
Sbjct: 363 DNLKISSRKIILGMAAYGRGFSGVS----KSKTNGKLTGKKFNGVSGSSPDEPGVWLYNK 418

Query: 371 LPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDT 430
           LPI G+ E+FD   VS YC++P +  FV YD   S+ +K++Y++  ++GGGF WE+CG+ 
Sbjct: 419 LPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEK 478

Query: 431 HKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481
             NP+ SL+N++  ++  +NI K +S++ N   + +Y   +  +GFLS Y+
Sbjct: 479 LNNPKLSLINSFTFDM--NNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  394 bits (1011), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 213/515 (41%), Positives = 296/515 (57%), Gaps = 50/515 (9%)

Query: 12  VILSTILIALDLFMCQMFPMFRRRGEED------RRGVTLDDERMHESRNRSFS------ 59
           V+ +  ++ L L MC     F+++  +D      R G   + + +    N++ S      
Sbjct: 15  VLFALAIVVLVLQMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGY 74

Query: 60  -CGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK- 117
             GLYYS+WS Y+PR HFPH+I+   +SH+YYAFFLVD K GKL   D+W+D Q  + K 
Sbjct: 75  LSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKP 134

Query: 118 ---------------------NNKLVKGNVGELFDLKMK------NRVKCIMCIGGWSNR 150
                                  KL  G +GELF LK        +  K I+ IGGWSNR
Sbjct: 135 LSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNR 194

Query: 151 EAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHM 210
           + +     D  K E+F + AV+ MF YGFDGIDLDWE+P+DDG+EP  YLE++ +++  M
Sbjct: 195 DRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKM 254

Query: 211 NKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSER 270
           + LE EIF +T      F+LSVATPAF  KL I P+ +MD  +DYWNMMTYDYYG WSE 
Sbjct: 255 DDLELEIFGETKDHPK-FQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEA 313

Query: 271 TGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGR 329
           TGYH NL++G  GS           +   GLN + A+ +MI    +   K++LGMAAYGR
Sbjct: 314 TGYHCNLFNGD-GSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGR 372

Query: 330 GFTNVDVPTPRPNESPRYIGRTFDGVGGASEG-EPGMWRYDQLPIPGTVEQFDPRYVSGY 388
            F +V             I + F GVG    G EPGMW Y+QLP+ GTVE +DP Y + +
Sbjct: 373 EFKHV----KSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAF 428

Query: 389 CFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGR 448
           C++  + TF+GYD +DSV++K QY++ +++GGGFWWESCGD H N  RSL+  +  E+  
Sbjct: 429 CYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTE 488

Query: 449 -DNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLK 482
                  + I++   C+++Y   +   GFLS  L+
Sbjct: 489 IRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 301/476 (63%), Gaps = 18/476 (3%)

Query: 11  FVILSTILIALDLFMCQMFPMFRR-RGEEDRRGV-TLDDERMHESRNRSFSCGLYYSNWS 68
            V+L  I++ +      M   F++ R + +R  + T+        ++  ++ G+YY++WS
Sbjct: 14  LVLLVAIILEMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHGKYAVGVYYTSWS 73

Query: 69  AYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILKNN--KLVKGNV 126
            YEPRLHFPH+I+F  +++V YAFF+VD K GK+   D W+D + P       + V G +
Sbjct: 74  PYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVTGMI 133

Query: 127 GELFDLKMKNRV--KCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDL 184
           GEL  LK++     +  M +GGWSNREA+        K+++F    +  MFEYGFDGIDL
Sbjct: 134 GELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDL 193

Query: 185 DWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIF 244
           DWE+P+DDG EP +YLE+  R++  M+KLE EI+   +     FELSVATPAF   L+I 
Sbjct: 194 DWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKIL 253

Query: 245 PLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGM--SEVEGLN 302
           P+ EM+  +  WNMMTYD++G WS+RTGYHSNLYDG+K +  ++     GM   + EGLN
Sbjct: 254 PIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLN 313

Query: 303 GDYAVKYMI-NQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEG 361
            D A+K M+ N  +   K+ LGM AYGRGFTNV     +  +    + + + GVGG SEG
Sbjct: 314 ADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNV-----QTKDDDDLLNKKYSGVGGGSEG 368

Query: 362 EPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGG 421
           EPG+W Y+QLP+  T E+FD R+VS YCF+    TFVGYD I S+ VK+ Y+K K + GG
Sbjct: 369 EPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGG 428

Query: 422 FWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFL 477
           F+WESCGDTH +P+R+LV A+ +EL    I    +I+K+   +++Y +    KGFL
Sbjct: 429 FFWESCGDTHNDPKRNLVRAFSQELSEMRI---PTIFKDPRAIAYYLKH-RQKGFL 480

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  379 bits (973), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 198/485 (40%), Positives = 293/485 (60%), Gaps = 52/485 (10%)

Query: 32  FRRRGEEDRRGVTLDDERMHESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYA 91
           FR  G  D+    + +++ H+   + +  G+YYSNWS Y PR HFPH+IN   +SHVYYA
Sbjct: 50  FRNGG--DQVPSMVQNQKPHDG-GKGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYA 106

Query: 92  FFLVDGKNGKLVSGDKWADFQ----RPI-LKNNKLVKGN-------------VGELFDLK 133
           FF ++ K G + S D W+D +    +P+ +K+++LV+ N             VGELF LK
Sbjct: 107 FFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLGCVGELFYLK 166

Query: 134 ---MKNRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPE 190
               + + K IM IGGWS+ E +     D   +++F + +V+ MF+ GFDGID+DWE+PE
Sbjct: 167 NACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPE 226

Query: 191 DDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMD 250
           ++ IEPQ YL++++ ++  +N LES+IF ++     +F++S+A PAFKDKL   P+ E+D
Sbjct: 227 NNKIEPQGYLKLVKMLRLKLNNLESQIFGES--IEDHFQISIAAPAFKDKLFFLPISEID 284

Query: 251 TVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYM 310
             IDYWNMMTYDYYG WSE TGYHSNL+                 SE E L+G++A+ YM
Sbjct: 285 QYIDYWNMMTYDYYGSWSETTGYHSNLF-----------------SETE-LSGNFAMHYM 326

Query: 311 INQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVG------GASEGEP 363
           I++  +   K++LGMAAYGR F   D       ++   I + F GVG        ++G+ 
Sbjct: 327 IDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKE 386

Query: 364 GMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFW 423
           G+W Y  LP  GT+EQ+DP+YVS YCF+     F+ YD   S + K +Y+    +GGGFW
Sbjct: 387 GIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFW 446

Query: 424 WESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLKE 483
           WESCG+ H N  RSL+NA+ + + R N+    S+++++  +  Y   +   GFLS YLK 
Sbjct: 447 WESCGEAHTNKSRSLINAFNEGI-RFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKH 505

Query: 484 YEKNE 488
            E ++
Sbjct: 506 LESSK 510

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  379 bits (972), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 196/460 (42%), Positives = 281/460 (61%), Gaps = 49/460 (10%)

Query: 54  RNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQR 113
           R+ +F  G+YYSNWS Y+PR HFPH+IN   +SH+YYAFF ++ + G + + D W+D + 
Sbjct: 69  RDEAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEM 128

Query: 114 PI-----LKNNKLVK-------------GNVGELFDLK---MKNRVKCIMCIGGWSNREA 152
            +     +KN++L+K             G +GELF LK      + K IM IGGWS+ E 
Sbjct: 129 NLYKSLAIKNSELIKESSNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSIGGWSDSEN 188

Query: 153 WHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNK 212
           + I   D   +++F + +V+ MF  GFDGIDLDWE+P ++  EP+ YL+++R ++  +N 
Sbjct: 189 FKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNS 248

Query: 213 LESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTG 272
           LES+IF     T  +F+LS+A PAFKDKL   P+ E+D  +DYWNMMTYDYYG WSE TG
Sbjct: 249 LESQIF--GKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTG 306

Query: 273 YHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGF 331
           YHSNL+                 SE E LNG++A+ YMI++ G+   K++LGMAAYGR F
Sbjct: 307 YHSNLF-----------------SETE-LNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF 348

Query: 332 TNVDVPTPRPNESPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYV 385
              D      N++   I + F GVG        ++G+ G+W Y  LP  GT+EQ+DP+YV
Sbjct: 349 HIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYV 408

Query: 386 SGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKE 445
           S YCF+     F+ YD   SV+ K +Y+   ++GGGFWWESCG+ + N  RSL+NA+ + 
Sbjct: 409 SAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEG 468

Query: 446 LGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLKEYE 485
           L  +   KP SI++++    +Y   +   GFLS YLK  +
Sbjct: 469 LHFNVSSKP-SIFQDVRVKKYYLNKYGDGGFLSPYLKHLD 507

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  377 bits (969), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 194/453 (42%), Positives = 281/453 (62%), Gaps = 49/453 (10%)

Query: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ----R 113
           F  G+YYSNWS Y+PR HFPH+IN   +SHVYYAFF ++ + G + S D W+D +    +
Sbjct: 73  FVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYK 132

Query: 114 PI-LKNNKLVKGN-------------VGELFDLKMK---NRVKCIMCIGGWSNREAWHIF 156
           P+ +K+++L+ GN             +GELF LK      + K IM IGGWS+ E + + 
Sbjct: 133 PLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVI 192

Query: 157 STDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESE 216
             + + +++F + +V+ MF+ GFDGIDLDWE+PE++  EPQ YL+++R ++  +N LES+
Sbjct: 193 IKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQ 252

Query: 217 IFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSN 276
           IF +      +F+LS+A PAFKDKL   P+ E+D  IDYWNMMTYDYYG WSE TGYHSN
Sbjct: 253 IFGE--GVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSN 310

Query: 277 LYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVD 335
           L+                 SE E L+G++A+ YMI++ GI   K++LGMAAYGR F    
Sbjct: 311 LF-----------------SETE-LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKG 352

Query: 336 VPTPRPNESPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYC 389
                  ++   I ++F GVG        ++G+ G+W Y  LP  GT+E++DP+YVS YC
Sbjct: 353 SGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYC 412

Query: 390 FEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRD 449
           F+     F+ YD   SV+ K +Y+    +GGGFWWESCG+T+ N  RSL++A+ + L R 
Sbjct: 413 FDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGL-RS 471

Query: 450 NIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLK 482
           N+    S+++N   V+ Y   +   GFL+ YLK
Sbjct: 472 NVSTKPSMFENERVVNFYLNKYGNNGFLTPYLK 504

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/499 (40%), Positives = 292/499 (58%), Gaps = 59/499 (11%)

Query: 25  MCQMFPMFRRRGEEDRRG---------VTLDDERMHESRNRSFSCGLYYSNWSAYEPRLH 75
           MC    +F+ +  ED R            +   +     +  +  G+YYSNWS Y+PR H
Sbjct: 31  MCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFH 90

Query: 76  FPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ----RPI-LKNNKLVKGN----- 125
           FPH+IN + +SHVYYAFF +D K G + S D W+D +    +P+ +K ++LV  N     
Sbjct: 91  FPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDNN 150

Query: 126 ---------VGELFDLKMK---NRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKM 173
                    +GELF LK      + K IM IGGWS+ E +     +   +++F + +V+ 
Sbjct: 151 MQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVET 210

Query: 174 MFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVA 233
           MF+ GFDGID+DWE+PE++ +EPQ YL+++R ++  +N LES+IF    +T  +FELS+A
Sbjct: 211 MFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIF--GGSTKDHFELSIA 268

Query: 234 TPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRH 293
            PAFKDKL   P+ E+D  ID+WNMMTYDYYG WSE TGYHSNL+               
Sbjct: 269 APAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLF--------------- 313

Query: 294 GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTF 352
             SE E L+G++A+ YMI + G+   K++LGMAAYGR F   D       ++   I + F
Sbjct: 314 --SETE-LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQF 370

Query: 353 DGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSV 406
            GVG        ++G+ G+W Y  LP  GT EQ+DP+YVS YCF+     F+GYD  +S+
Sbjct: 371 KGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDNTESI 430

Query: 407 RVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSH 466
           + K  Y+   ++GGGFWWESCG+ + +  RSL+NA+ + L  +   KP S++++   + +
Sbjct: 431 KTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKP-SMFQDKRVMKY 489

Query: 467 YKQSFHGKGFLSKYLKEYE 485
           Y   +   GFL+ YLK  E
Sbjct: 490 YLSKYGDGGFLAPYLKHLE 508

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  354 bits (909), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/429 (45%), Positives = 270/429 (62%), Gaps = 19/429 (4%)

Query: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRP--I 115
           ++ G+YYS+WS Y+PRLH+P  I+F  ++HVYYAFF+VD K GK+ S DKW+D + P  +
Sbjct: 63  YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNL 122

Query: 116 LKNNKLVKGNVGELFDLKMK--NRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKM 173
               + + G +GEL  LK +     K +M +GGWSNRE +H    D  K  +F + A+  
Sbjct: 123 TGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDA 182

Query: 174 MFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVA 233
           MFEYGFDGIDLDWE+P+DDG EPQ+YLE+  R++H M++LE  I+     T   F LS+A
Sbjct: 183 MFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMA 242

Query: 234 TPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRH 293
            PAF   L IFP++EM+  +  WNMMTYDY+G WSERTGYHSNLY+ +          R 
Sbjct: 243 APAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRR 302

Query: 294 ----GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYI 348
               G+   + LN   A+  M  Q  +   KI LGMAAYGRGFTNV        +  + I
Sbjct: 303 YEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR------GDGEQLI 356

Query: 349 GRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRV 408
           G+ + GVGG SEGEPGMW Y+QLP+    E+FD  +VS Y ++P T T V YD +DS+++
Sbjct: 357 GQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKI 416

Query: 409 KTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYK 468
           K +Y+K K + G F WESCGD  K+ +R+LV A+ + +      +  + YK+   + +Y 
Sbjct: 417 KKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENM---KGARKATAYKDSKLIQYYL 473

Query: 469 QSFHGKGFL 477
           ++   +GFL
Sbjct: 474 RT-RPEGFL 481

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  322 bits (825), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/521 (36%), Positives = 274/521 (52%), Gaps = 62/521 (11%)

Query: 9   KYFVILSTILIALD-LFMCQMFPMFR-----------RRGEEDRRGVTLDDERMHESRNR 56
           K+ V+   ++I L+ ++  ++    R            R E+ +  V   D  +  S  R
Sbjct: 10  KFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSER 69

Query: 57  SFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPIL 116
             + G+YYSNWS Y+ R HFPH+I+F  ++ V+Y+F +V+G+ G+    D+W+D Q  + 
Sbjct: 70  GLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLY 129

Query: 117 KN-------------------NKLVKGNVGELFDLKMKN------------RVKCIMCIG 145
           K                    N L  G +GELF LK  +              K IM +G
Sbjct: 130 KQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVG 189

Query: 146 GWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRR 205
           GWSNREA+      P+K++ F    V  MF+YGFDGID+DWE+P++D  EP+ YL++MR 
Sbjct: 190 GWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRS 249

Query: 206 IKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYG 265
           ++  ++ LES+IF  T   T +F L+ A  A    LE  PL E+D  +D WN+M YD+ G
Sbjct: 250 LRKKLDDLESDIF-GTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSG 308

Query: 266 EWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGM 324
            WS  T Y SNLY          S L       EG + D AV+ ++N+  +   KI+LGM
Sbjct: 309 AWSRHTAYQSNLYS--------RSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGM 360

Query: 325 AAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRY 384
            AYGRGF  V VP    +     IG++F  V G SEGE G+  Y+QLP+ G  E FD   
Sbjct: 361 PAYGRGFKGVSVPH---HSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDA 417

Query: 385 VSGYCFEPTT----GTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVN 440
           VS Y  +  +       V YD + S+++K QY+   ++GGGFWWESCG+ + +  RSL  
Sbjct: 418 VSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTR 477

Query: 441 AYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481
           A+ +E+   N   P +IY  L  V  Y    +  GFL+  +
Sbjct: 478 AFTQEIKYLNKTVP-TIYA-LPQVGEYYHKKYPDGFLASII 516

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  321 bits (822), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/473 (38%), Positives = 263/473 (55%), Gaps = 60/473 (12%)

Query: 42  GVTLDDERMHESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGK 101
           G++ D+E         F  G+YYSNWS Y  R HFPH+I+F  ++HVYYAF +V+ + G+
Sbjct: 62  GLSADNES-------GFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGE 114

Query: 102 LVSGDKWADFQRPILKN-------------------NKLVKGNVGELFDLKMKN------ 136
               D+W+D Q  + K                    +KL  G +GELF LK  N      
Sbjct: 115 CQLSDEWSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNG 174

Query: 137 ------RVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPE 190
                   K IM +GGWSNREA+      P+K+E F +  V  MFEYGFDGID+DWE+P+
Sbjct: 175 GSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPK 234

Query: 191 DDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMD 250
           +D  EP++YL++++ ++  ++ LES+IF  +     +F L+ A  A ++ L+  PL+E D
Sbjct: 235 NDAKEPKVYLQMLKALRERLDTLESQIF-GSKDHKHHFALTSAISADEECLKYLPLQEAD 293

Query: 251 TVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYM 310
             +DYWN+M YD+ G WS +T Y SNLY  +K  T   S    G       + D AV+++
Sbjct: 294 RYVDYWNLMAYDFSGAWSAQTAYQSNLYTPAK--TNKRSTNGRG-------SADKAVRFL 344

Query: 311 INQG-IKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYD 369
            ++  +   KI+LGM AYGRGF  V+V           IG+ F  V G+SEGE G+  Y 
Sbjct: 345 TDKSKLASKKIVLGMPAYGRGFKGVEVSH---KSIENVIGKPFQDVSGSSEGEEGISLYK 401

Query: 370 QLPIPGTVEQFDPRYVSGYCFEPT----TGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWE 425
           QLP+ G +E FD   VS YC + +        + YD +DS+  K  Y++   +GGGFWWE
Sbjct: 402 QLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWE 461

Query: 426 SCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLS 478
           SCG+ +K   +SLV A+ KE+   N  +P +IY     V HY +  H  GFL+
Sbjct: 462 SCGEDYKG--KSLVGAFTKEIKCLNKTEP-TIYSLPEVVQHYLK-LHPGGFLA 510

>TBLA0C04190 Chr3 complement(1012769..1013140) [372 bp, 123 aa] {ON}
           Anc_4.88 YGL029W
          Length = 123

 Score = 32.0 bits (71), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 94  LVDGKNGKLVSGDKWADFQRPILKNNKLVKGNVGELFDLKMKNRVK 139
           L     GKLVSG  W   + P+  ++++VK      +DL+ K R++
Sbjct: 11  LASKTQGKLVSGRIWKHTKEPLRASSRVVKNKTLTSWDLRQKKRLE 56

>CAGL0F08965g Chr6 complement(880296..882215) [1920 bp, 639 aa] {ON}
           highly similar to uniprot|P38694 Saccharomyces
           cerevisiae YHR039c
          Length = 639

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 18/125 (14%)

Query: 310 MINQGIKKD-KIILGMAAYGRGFT-NVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWR 367
           +IN+ +  D +I++G +     FT  V       +   +Y  R F+ V    E +P  W+
Sbjct: 32  IINEDVVADPRIVMGTSMVATIFTLYVGYKLLLCSSGYKYKARKFN-VSTPEEVQPN-WK 89

Query: 368 YDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVG------YDTIDSVRVKTQYIKMKDIGGG 421
             +L  P  V+   PR++  YC  P TG ++G       D ID +       +MK     
Sbjct: 90  GKRLNPPKLVDDSKPRHIQSYC--PATGQYLGEFKSMTADEIDELVGNANAAQMK----- 142

Query: 422 FWWES 426
            W ES
Sbjct: 143 -WAES 146

>Kwal_33.13082 s33 complement(68025..69368) [1344 bp, 447 aa] {ON}
           YDR527W - Protein required for cell viability [contig
           123] FULL
          Length = 447

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 187 EYPEDDGIEPQLYLEIMRRIKHHMNK--LESEIFKDTSATTSYFE-LSVATPAFKDKL-- 241
           E P+DD + PQ Y +  +++ H  N+  L+   F   + T   FE L +  PAF DKL  
Sbjct: 202 ELPDDDDVAPQEY-QFAQQMDHMKNEDLLQDVHFMRLNQTQQEFETLDINDPAFDDKLHS 260

Query: 242 EIFP--LKEMDTVIDYWNMMTYDYYGEWSE----RTGYHSNLYDGSKGSTTIESVLRHGM 295
           + FP   KE D +     ++T    G   +    R  +  NL    +   T +  L H  
Sbjct: 261 KYFPDLPKESDKMAWMKPVLTTKPTGVIDDVSQCRFDFKGNLVPPDRPIETTKDGLHH-H 319

Query: 296 SEVEGLNG 303
           SE  GL G
Sbjct: 320 SEDPGLAG 327

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,799,045
Number of extensions: 2802374
Number of successful extensions: 6156
Number of sequences better than 10.0: 32
Number of HSP's gapped: 6211
Number of HSP's successfully gapped: 32
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)