Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E033205.524ON1190119049970.0
YDR420W (HKR1)5.524ON18022403564e-33
Skud_4.6945.524ON15042363466e-32
Suva_2.5975.524ON17972763342e-30
TDEL0A038805.524ON16966583305e-30
ZYRO0D12496g5.524ON23852663135e-28
KLTH0G03696g5.524ON20852512841e-24
Ecym_40605.524ON22012432822e-24
CAGL0F03003g5.524ON1185832544e-21
Smik_4.6955.524ON1555862392e-19
Kpol_363.145.524ON7612522346e-19
SAKL0G04862g5.524ON24441102251e-17
Kwal_47.177034.150ON1568912232e-17
KLLA0C17985g4.150ON908982194e-17
Kwal_47.186505.524ON2159912204e-17
KLTH0E08844g4.150ON1520912152e-16
TPHA0L003605.524ON1161862132e-16
ZYRO0G11242g4.150ON14871352062e-15
KNAG0C032605.524ON1530822043e-15
SAKL0H23188g4.150ON1262901981e-14
KAFR0F034704.150ON9491101972e-14
TDEL0D030104.150ON1123841927e-14
KLLA0A01826g5.524ON14642971911e-13
TPHA0K013904.150ON826871901e-13
AGR019C4.150ON1105951873e-13
YGR014W (MSB2)4.150ON1306851855e-13
TBLA0G012104.150ON18251301784e-12
NDAI0K025804.150ON9851001765e-12
Kpol_1062.374.150ON973841758e-12
Skud_7.2994.150ON1169851722e-11
NCAS0A052304.150ON785841667e-11
Suva_7.2964.150ON1135851651e-10
Ecym_73494.150ON1129961632e-10
KNAG0D035904.150ON994911533e-09
Smik_7.3024.150ON11891111499e-09
ADR200C5.524ON2338851435e-08
TBLA0G009505.524ON22531031338e-07
CAGL0F08833g4.150ON936891103e-04
CAGL0F02057gsingletonON84656736.8
Kpol_163.1singletonON26655727.0
NDAI0B046401.342ON737151737.5
NCAS0B073201.342ON722128737.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03320
         (1190 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...  1929   0.0  
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   141   4e-33
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   137   6e-32
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   133   2e-30
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   131   5e-30
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   125   5e-28
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   114   1e-24
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   113   2e-24
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   102   4e-21
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...    97   2e-19
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...    95   6e-19
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...    91   1e-17
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    91   2e-17
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    89   4e-17
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...    89   4e-17
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    87   2e-16
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...    87   2e-16
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    84   2e-15
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...    83   3e-15
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...    81   1e-14
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    80   2e-14
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    79   7e-14
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...    78   1e-13
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    78   1e-13
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    77   3e-13
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    76   5e-13
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    73   4e-12
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    72   5e-12
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    72   8e-12
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    71   2e-11
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    69   7e-11
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    68   1e-10
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    67   2e-10
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    64   3e-09
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    62   9e-09
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...    60   5e-08
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    56   8e-07
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    47   3e-04
CAGL0F02057g Chr6 complement(197149..199689) [2541 bp, 846 aa] {...    33   6.8  
Kpol_163.1 s163 (208..1008) [801 bp, 266 aa] {ON} (208..1008) [8...    32   7.0  
NDAI0B04640 Chr2 complement(1150965..1153178) [2214 bp, 737 aa] ...    33   7.5  
NCAS0B07320 Chr2 complement(1383781..1385949) [2169 bp, 722 aa] ...    33   7.5  

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score = 1929 bits (4997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 995/1190 (83%), Positives = 995/1190 (83%)

Query: 1    MQTFIITYMYFISSLLLCDARLTLEKKVYVNLTSGNDNILSDFSQNSHYTXXXXXXXXXX 60
            MQTFIITYMYFISSLLLCDARLTLEKKVYVNLTSGNDNILSDFSQNSHYT          
Sbjct: 1    MQTFIITYMYFISSLLLCDARLTLEKKVYVNLTSGNDNILSDFSQNSHYTSIAALASSVA 60

Query: 61   XXXXEDYNPLTKTDSSXXXXXXYLASSLDGNNNQQYSSTIQYSQLATTSTSLPIETVISS 120
                EDYNPLTKTDSS      YLASSLDGNNNQQYSSTIQYSQLATTSTSLPIETVISS
Sbjct: 61   AGSSEDYNPLTKTDSSNTNTNTYLASSLDGNNNQQYSSTIQYSQLATTSTSLPIETVISS 120

Query: 121  MDQQFQSNQPSLSGSKYTSLTFSVSKDSAIPSVAGTKTMPPAVSSMFVPTSTLSDTQGSV 180
            MDQQFQSNQPSLSGSKYTSLTFSVSKDSAIPSVAGTKTMPPAVSSMFVPTSTLSDTQGSV
Sbjct: 121  MDQQFQSNQPSLSGSKYTSLTFSVSKDSAIPSVAGTKTMPPAVSSMFVPTSTLSDTQGSV 180

Query: 181  SAESTPQYIALPSTLSSDRAKSKEKLDISSRMVEITSYPYSVSSSMPESEIKLAXXXXXX 240
            SAESTPQYIALPSTLSSDRAKSKEKLDISSRMVEITSYPYSVSSSMPESEIKLA      
Sbjct: 181  SAESTPQYIALPSTLSSDRAKSKEKLDISSRMVEITSYPYSVSSSMPESEIKLASSLSDS 240

Query: 241  XXETIYTVYPTEFTQLTLTFSIDSSAELADILTSQEXXXXXXXXXXXXXXXXXXXXXXXX 300
              ETIYTVYPTEFTQLTLTFSIDSSAELADILTSQE                        
Sbjct: 241  SSETIYTVYPTEFTQLTLTFSIDSSAELADILTSQESSTVSGTSIESSESSMMSSSSSLR 300

Query: 301  XXXXDIIDPSWIKFSATRXXXXXXXXXXXXXXXXXEKSSTTTSINSESLTNSTGKSGVPD 360
                DIIDPSWIKFSATR                 EKSSTTTSINSESLTNSTGKSGVPD
Sbjct: 301  LSTTDIIDPSWIKFSATRSALQSSQASSNVVSNAQEKSSTTTSINSESLTNSTGKSGVPD 360

Query: 361  LKSDTLSTAKESTTSSQQTEPHSISSQSAVSQTKVSENVLETPSQTLSASLKQTSTGSSS 420
            LKSDTLSTAKESTTSSQQTEPHSISSQSAVSQTKVSENVLETPSQTLSASLKQTSTGSSS
Sbjct: 361  LKSDTLSTAKESTTSSQQTEPHSISSQSAVSQTKVSENVLETPSQTLSASLKQTSTGSSS 420

Query: 421  DPPLVHTSTSPVVSQVHASTSMLDSTSSAKFAHSTLSTSLLQSNAASENRYTSSTLFSSK 480
            DPPLVHTSTSPVVSQVHASTSMLDSTSSAKFAHSTLSTSLLQSNAASENRYTSSTLFSSK
Sbjct: 421  DPPLVHTSTSPVVSQVHASTSMLDSTSSAKFAHSTLSTSLLQSNAASENRYTSSTLFSSK 480

Query: 481  YTPTGVKSTNTKIIGLTSSKSIIIEGSETSQNSRSPLRTVQTSSASTFNRDKTAKSQNLL 540
            YTPTGVKSTNTKIIGLTSSKSIIIEGSETSQNSRSPLRTVQTSSASTFNRDKTAKSQNLL
Sbjct: 481  YTPTGVKSTNTKIIGLTSSKSIIIEGSETSQNSRSPLRTVQTSSASTFNRDKTAKSQNLL 540

Query: 541  AATGTTEWDPHRGTFTLVLSQSSIPPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFA 600
            AATGTTEWDPHRGTFTLVLSQSSIPPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFA
Sbjct: 541  AATGTTEWDPHRGTFTLVLSQSSIPPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFA 600

Query: 601  SDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQ 660
            SDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQ
Sbjct: 601  SDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQ 660

Query: 661  IFEFLPLTLSYPFLLTQYNAXXXXXXXXXXXXXYYEDDGRTILTTHESTTVDSTQFVKKI 720
            IFEFLPLTLSYPFLLTQYNA             YYEDDGRTILTTHESTTVDSTQFVKKI
Sbjct: 661  IFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTTHESTTVDSTQFVKKI 720

Query: 721  MGPASNLLTAQLASSPSSSPTQRPHPREXXXXXXXXXXXXXXKHILPMISNQRDYIVSVA 780
            MGPASNLLTAQLASSPSSSPTQRPHPRE              KHILPMISNQRDYIVSVA
Sbjct: 721  MGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHILPMISNQRDYIVSVA 780

Query: 781  EVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLFXXXXXXXXXXXX 840
            EVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLF            
Sbjct: 781  EVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLFQQNGMNNQGNNQ 840

Query: 841  DGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKIKDRXXXXXXXXXXXX 900
            DGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKIKDR            
Sbjct: 841  DGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKIKDRLAIFTTVFLFVV 900

Query: 901  XXXXXXXXXXXKHWNKRIEXXXXXXXXXXXXXXXRFNRVDLVTLXXXXXXXXXXXXPNEK 960
                       KHWNKRIE               RFNRVDLVTL            PNEK
Sbjct: 901  FFWIWLFLVAFKHWNKRIENKKAKKLLNKTLPTARFNRVDLVTLSTASSMSSSSISPNEK 960

Query: 961  QTYSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFGNKELLDGTNTTTFTEY 1020
            QTYSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFGNKELLDGTNTTTFTEY
Sbjct: 961  QTYSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFGNKELLDGTNTTTFTEY 1020

Query: 1021 MYNDIEQGHSTYHDNDSAHKTKGKLTTINTFNKTXXXXXXXXXXGNISNMGPTIGNLSGN 1080
            MYNDIEQGHSTYHDNDSAHKTKGKLTTINTFNKT          GNISNMGPTIGNLSGN
Sbjct: 1021 MYNDIEQGHSTYHDNDSAHKTKGKLTTINTFNKTAEHNEEEAAAGNISNMGPTIGNLSGN 1080

Query: 1081 VEQDLCTTQVDKYVSNNYNENFMSDRKEDETRNPTLFFQDLPLDEEFENYLYKNEVDPTV 1140
            VEQDLCTTQVDKYVSNNYNENFMSDRKEDETRNPTLFFQDLPLDEEFENYLYKNEVDPTV
Sbjct: 1081 VEQDLCTTQVDKYVSNNYNENFMSDRKEDETRNPTLFFQDLPLDEEFENYLYKNEVDPTV 1140

Query: 1141 LXXXXXXXXXXXXXXXXXXXXXXXGELDGLDEELYKRMSSIMKLQRINKR 1190
            L                       GELDGLDEELYKRMSSIMKLQRINKR
Sbjct: 1141 LQFDQVDDLTIDDTDDDSVDDFQVGELDGLDEELYKRMSSIMKLQRINKR 1190

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  141 bits (356), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 588  NTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELN 647
            N+  WLP ++I  S ++  T +S NP IT +LP  I       +P N TL+TIGF   LN
Sbjct: 1206 NSYAWLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALN 1265

Query: 648  YIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNAXXXXXXXXXXXXXYYEDDGRTILTTHE 707
            Y+FL+ NPL+SAQIF FLPL L YPF  T                     +  T + ++ 
Sbjct: 1266 YVFLVQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSI------------GELSTFILSYR 1313

Query: 708  STTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPREXXXXXXXXXXXXXXKHILP 767
            S +  +T   K I   +            ++  T+  HP +              K I+P
Sbjct: 1314 SGSSTTTLSPKSISSLSVVKKKKNQQKKNATKSTEDLHPPQ------VDTSSIAVKKIVP 1367

Query: 768  MISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDL 827
            M+ + + YIVSVAEVYFPT+ +  LQ+ I   NS LYSNP TP  +L  LID  I L  L
Sbjct: 1368 MVDSSKAYIVSVAEVYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGL 1427

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 1166 ELDGLDEELYKRMSSIMKLQ 1185
            ELD LDEELYKRMS ++K Q
Sbjct: 1776 ELDALDEELYKRMSKVIKQQ 1795

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  137 bits (346), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 113/236 (47%), Gaps = 18/236 (7%)

Query: 592  WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFL 651
            WLP ++I    Q+ S+ +  NP IT +LP+ I       +P N TL+T+GF   LNY FL
Sbjct: 918  WLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFL 977

Query: 652  IDNPLASAQIFEFLPLTLSYPFLLTQYNAXXXXXXXXXXXXXYYEDDGRTILTTHESTTV 711
            + NPL+SAQIF FLPL L YPF  T+                Y      T L+     +V
Sbjct: 978  VQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGTSTTTLSPK---SV 1034

Query: 712  DSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPREXXXXXXXXXXXXXXKHILPMISN 771
             S   VKK         TA  A                             K I+PM+++
Sbjct: 1035 SSLSIVKKKKKGEKRNATASTA---------------DLYLPSIETSSIVVKQIVPMVNS 1079

Query: 772  QRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDL 827
             + Y+++VAEVYFPT+ +  LQK I   +SP+Y+NP TP  TL  LID  I L  L
Sbjct: 1080 SKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGL 1135

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 1166 ELDGLDEELYKRMSSIMKLQ 1185
            ELD LDEELYKRMS ++K Q
Sbjct: 1483 ELDALDEELYKRMSKVVKQQ 1502

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 129/276 (46%), Gaps = 56/276 (20%)

Query: 575  TSITQKPASTGTQ---NTND--WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEA 629
            TSIT  P +  T     +ND  WLP ++I    +SD++ +S NP ITA+LP  IA     
Sbjct: 1183 TSITAVPFTYATNPYTTSNDYAWLPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAV 1242

Query: 630  VQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNAXXXXXXXXX 689
             +P N TL+TIGF   LNY+FL+ NPL+SAQIF FLPL L YPF                
Sbjct: 1243 TEPANHTLITIGFTAGLNYVFLVQNPLSSAQIFNFLPLVLKYPF---------------- 1286

Query: 690  XXXXYYEDDGRTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSS----SPTQRPH 745
                       T     ES+T +        MG +S +L+ Q  SS ++    S +  P 
Sbjct: 1287 ---------SDTTSQQEESSTYE--------MGSSSFVLSYQSGSSTTTLSPESVSSIPI 1329

Query: 746  PREXXXXXXXXXXXXXXKHILPMISN--------------QRDYIVSVAEVYFPTDTLGI 791
             R+                 LP I N               R Y+++VAEVYFPT+ +  
Sbjct: 1330 VRKKKKKGGKNSVMSTANLDLPSIGNSSIVVKQIVPMIDSSRSYVIAVAEVYFPTEAISS 1389

Query: 792  LQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDL 827
            LQ+ I   NS LY+NP T   TL  LID  + L  L
Sbjct: 1390 LQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGL 1425

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%)

Query: 1166 ELDGLDEELYKRMSSIMKLQ 1185
            ELD LDEELYKRMS I+K Q
Sbjct: 1776 ELDALDEELYKRMSKIVKQQ 1795

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 957  PN-EKQTYSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYY 1002
            PN E +++ S+E    D   + + E  VY  ++G+ YTVD DG+ +Y
Sbjct: 1552 PNTESESFYSME----DDQYIPTGENTVYSATHGLHYTVDEDGDLFY 1594

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 164/658 (24%), Positives = 259/658 (39%), Gaps = 116/658 (17%)

Query: 592  WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFL 651
            WLP+S+   SD + S  SS +P +TATLP  IA PT    P N + +T+GFKK LNY FL
Sbjct: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128

Query: 652  IDNPLASAQIFEFLPLTLSYPFLLTQYNAXXXXXXXXXXXXXYYEDDGRTILTTHE---S 708
            + +   +AQIF FLP  LS+PF   + N               Y+  G  ++++ E   +
Sbjct: 1129 VSSSTTAAQIFHFLPFVLSFPF---EENGTKDFS---------YKRRGTLLVSSFEFNNT 1176

Query: 709  TTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPREXXXXXXXXXXXXXXKHILPM 768
            TT+   QF ++ +   S    ++   + S+                          I+PM
Sbjct: 1177 TTLMPAQFHQETVTGISKRSDSEFPFNASA---------------------VDVIQIMPM 1215

Query: 769  ISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLF 828
            I   R+Y+ S+A +YFP+  +  LQ  ++   S L++NP      L  LIDP I LT L 
Sbjct: 1216 IIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI 1275

Query: 829  XXXXXXXXXXXXDGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKIKDR 888
                         GSL+  + S  + + PS+   +++    S  L +   S  SS +K R
Sbjct: 1276 DGST---------GSLNGGNPSTQSHS-PSSPYKSQSSDDNSGSLGTATNSGLSSAVKKR 1325

Query: 889  XXXXXXXXXXXXXXXXXXXXXXXKH-WNKRIEXXXXXXXXXXXXXXXRFNRVDLVTLXXX 947
                                   KH +  R+                 +N  D+ ++   
Sbjct: 1326 LVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSA 1385

Query: 948  XXXXXXXXX---PNEKQTYSSLENPFK-DGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYF 1003
                        P EK   S+ ++ +      + + E  VY  S G+QY V  DG+FYY 
Sbjct: 1386 ETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYYA 1445

Query: 1004 GNKELLDGTNTTT---------FTEYMYN---------------DI------EQGHSTYH 1033
            G  +     N TT           +Y+Y+               DI      E+G+    
Sbjct: 1446 GPLQSTSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVVS 1505

Query: 1034 D---NDSAHKTKG---------------KLT-TINTFNKTXXXXXXXXXXGNISNMGPTI 1074
            D   N+  H+                  K+T T+N+   +          G IS+ G  +
Sbjct: 1506 DPSPNEEEHEITSSNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAG--M 1563

Query: 1075 GNLSGNVEQDLCTTQVDKYVSN-NYNENFMSDR-----KEDETRNPTLFFQDLPLDEEFE 1128
            G   GN +  L +T+ + ++S+ + +ENF           D++ N     Q LP +   +
Sbjct: 1564 GQ-EGNPDF-LSSTEQNWHISSPDESENFPGRSVFGFYGSDDSNN---IVQSLPAENCID 1618

Query: 1129 NYLYKNEVDPTVLXXXXXXXXXXXXXXXXXXXXXXXGELDGLDEELYKRMSSIMKLQR 1186
             YLY +  D ++L                        E   LDEE+YKR S +M  Q+
Sbjct: 1619 EYLYVSGDDDSLLDSPLGVRIEEIDDDAVDVHVDDLDE---LDEEMYKRRSKLMTQQQ 1673

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 127/266 (47%), Gaps = 44/266 (16%)

Query: 564  IPPSVVTR--SRKTSITQKPASTGTQNTNDWLPNSMIFASDQSDSTFSSLNPEITATLPA 621
            + PS +T   S   S T  P    T++  +WLP S+I  S  S S+  S NPE+TATLP 
Sbjct: 1622 VSPSTITNIGSSVPSATSAP----TESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPH 1677

Query: 622  EIAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNAX 681
             IA  T   +PPN++ +TIGFK++++Y FL++NPL+SAQIF FLP  L YPF    Y+  
Sbjct: 1678 AIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPF---NYDQN 1734

Query: 682  XXXXXXXXXXXXYYEDDGRTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPT 741
                        Y      T L  +    V + +  K  M   +N+   Q+         
Sbjct: 1735 IDKGTHTNESSHYKRK--TTTLQPYRDVMVRTNKKHKVQMISTANVSVIQI--------- 1783

Query: 742  QRPHPREXXXXXXXXXXXXXXKHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNS 801
                                    +PM+S  + Y+V+VAE+YFP   +  L+ ++   NS
Sbjct: 1784 ------------------------MPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNS 1819

Query: 802  PLYSNPSTPYSTLVHLIDPWISLTDL 827
             LY+N +     L  LIDP I LT +
Sbjct: 1820 MLYNNTNPTLFALADLIDPSIPLTGM 1845

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 967  ENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFGNKELLDGTNTTT--------FT 1018
            ++P  D   V + E  VY   +G++Y VD DG F+Y GN+++ D + TT         F 
Sbjct: 2005 QSPISDDLIV-TGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTTKDEHDEIDDFD 2063

Query: 1019 EYMYNDIEQ 1027
            +YMY   E+
Sbjct: 2064 KYMYAGSEE 2072

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  114 bits (284), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 122/251 (48%), Gaps = 21/251 (8%)

Query: 581  PASTGTQNTN--DWLPNSMIFAS-DQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTL 637
            P+ST ++ +   DWLP++++ AS   S  T SS + + TATLP  I  PT    PPN + 
Sbjct: 1215 PSSTNSEGSTSMDWLPSNIVTASYTGSAHTQSSFDADATATLPQAIMPPTPVTMPPNYSQ 1274

Query: 638  VTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNAXXXXXXXXXXXXXYYED 697
            +TIGFK+ LNY FLI+NPLASAQIF FLP  L YPF +    A                D
Sbjct: 1275 ITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPFSV---RASRSNSSTSSVKRDLVGD 1331

Query: 698  DGRTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPREXXXXXXXXX 757
             G  +L        +ST  + K+     N  T+ + S  S+    R              
Sbjct: 1332 SGNLLLD-------NSTLILDKL-----NWKTSIMNSLSSNVSVSR---NGSHNAFRANF 1376

Query: 758  XXXXXKHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHL 817
                   I+P+I +  DYI SVA VYFPT+ + +LQK I    S +Y NP      +  L
Sbjct: 1377 SGVAVSSIVPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGASRIYKNPDQSLRDMALL 1436

Query: 818  IDPWISLTDLF 828
            ID  I +T + 
Sbjct: 1437 IDSKIPITGII 1447

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 981  GVVYDQSNGMQYTVDYDGNFYYFG--NKELL 1009
            G+ + +S G+ Y VD +GNF+Y G  NK +L
Sbjct: 1605 GMFFSKSTGLTYHVDREGNFFYAGTANKAVL 1635

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  113 bits (282), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 113/243 (46%), Gaps = 19/243 (7%)

Query: 581  PASTGTQNTNDWLPNSMIFASDQSDSTFSS-LNPEITATLPAEIAAPTEAVQPPNTTLVT 639
            P+ST       WLP +++ AS Q+    S+ +    T TLP  I   T   +P N  L+T
Sbjct: 1316 PSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLIT 1375

Query: 640  IGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNAXXXXXXXXXXXXXYYEDDG 699
            IGF + LNY FL+ NP+ASAQIF FLP  L+YP++  +                +  +  
Sbjct: 1376 IGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENK----------EALLLRHINESN 1425

Query: 700  RTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPREXXXXXXXXXXX 759
              IL    S  V  + F   I G     L+ +   + S+ P +R    E           
Sbjct: 1426 NNILGNRGS--VSGSYF--NIYG----NLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQ 1477

Query: 760  XXXKHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLID 819
               K I+P +    DY  SVAEVYFP++ +  L+K +   NS LY NP    + L  L+D
Sbjct: 1478 IVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVD 1537

Query: 820  PWI 822
            P I
Sbjct: 1538 PRI 1540

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 963  YSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYY 1002
            + S+ + F D   + + E  VY  S G+ Y +D +GN+YY
Sbjct: 1682 HDSVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYY 1721

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
           similarities with uniprot|P32334 Saccharomyces
           cerevisiae YGR014w MSB2 or uniprot|P41809 Saccharomyces
           cerevisiae YDR420w HKR1
          Length = 1185

 Score =  102 bits (254), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%)

Query: 591 DWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIF 650
           +WLP+ +IF SD + +  SS NP  T +LP  IA P   V+ PNTTLVTIG K+ LNY F
Sbjct: 716 NWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQF 775

Query: 651 LIDNPLASAQIFEFLPLTLSYPF 673
           LIDNPL+SAQIF FLP  L+YPF
Sbjct: 776 LIDNPLSSAQIFNFLPSVLTYPF 798

 Score = 58.9 bits (141), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (57%)

Query: 765 ILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISL 824
           I+P++    ++ VSV EVYFP D L  L   I   NS LYSNP+   S L  LIDP I L
Sbjct: 835 IVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPL 894

Query: 825 TDLF 828
           T L 
Sbjct: 895 TGLI 898

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%)

Query: 588  NTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELN 647
            N+  WLP ++I  S ++D++ +  NP IT +LP  I     A +P N TL+T+GF   LN
Sbjct: 964  NSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALN 1023

Query: 648  YIFLIDNPLASAQIFEFLPLTLSYPF 673
            Y+FL+ NPL+SAQIF FLPL L YPF
Sbjct: 1024 YVFLVQNPLSSAQIFNFLPLVLKYPF 1049

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%)

Query: 763  KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
            K I+PM+ + + YI++VAEVYFPT+ +  LQ+ I   NS LY+NP +P  TL  LID  I
Sbjct: 1121 KQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSI 1180

Query: 823  SLTDL 827
             L  L
Sbjct: 1181 PLGSL 1185

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%)

Query: 1166 ELDGLDEELYKRMSSIMKLQRI 1187
            ELD LDEELYKR+S I K Q +
Sbjct: 1534 ELDALDEELYKRISKIAKQQNL 1555

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
           (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score = 94.7 bits (234), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 120/252 (47%), Gaps = 20/252 (7%)

Query: 575 TSITQKPASTGTQNTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPN 634
           T++    +S  T+++  WLP +++  S  +D T S      T+ LP  IA PT   QP +
Sbjct: 503 TAVAVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIA-PTAVTQPAD 561

Query: 635 TTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLT----QYNAXXXXXXXXXX 690
           + L++IGFK ELNY FLI    ASAQIF FLPL L+YPF       Q +           
Sbjct: 562 SILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSV 621

Query: 691 XXXYYEDDGRTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPREXX 750
               Y+D     + ++E+T  +    +   +   S+  T+ L +SP+ +   + + R+  
Sbjct: 622 ISTEYQDYSS--IFSYETTLSN----LGLTLYDLSDGETSVLEASPTVASMNK-YQRD-- 672

Query: 751 XXXXXXXXXXXXKHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTP 810
                       K I+P++     YI S+AE  FP + +  LQ +IN   S +Y NP   
Sbjct: 673 ------TSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPR 726

Query: 811 YSTLVHLIDPWI 822
              +  LID  I
Sbjct: 727 LKDMAALIDSTI 738

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 565  PPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFAS-DQSDSTFSSLNPEITATLPAEI 623
            P +V+  S   S    P  T T +T++WLP S+I  S D S  + ++++   T+TLP  I
Sbjct: 1447 PYTVLETSVTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAI 1506

Query: 624  AAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
              PT   QP   +L+TIGFK+ LNY FLI +PL+SAQIF FLP  L YPF
Sbjct: 1507 TPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPF 1556

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query: 763  KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
            K I+P++S+  +YIVSVAEVYFP  ++  LQ+ +   NS LY NP      L  LIDP +
Sbjct: 1653 KQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSV 1712

Query: 823  SLTDL 827
             LT L
Sbjct: 1713 PLTGL 1717

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 61/91 (67%), Gaps = 6/91 (6%)

Query: 589  TNDWLPNSMIFASD--QSDSTFSSLNP----EITATLPAEIAAPTEAVQPPNTTLVTIGF 642
            +++WLP +MI A+   +S S   S +P    + T TLP  I APTE VQP   TL+T+GF
Sbjct: 1221 SSNWLPTAMITANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTLITVGF 1280

Query: 643  KKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
            KK LNY F++ NP+ SAQIF FLP TL+ PF
Sbjct: 1281 KKALNYPFVVGNPVTSAQIFAFLPDTLNSPF 1311

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%)

Query: 764  HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
             + P+  + RDY+++VAEVYFP+  +  LQK I    S  Y    T  + +  L+D  I 
Sbjct: 1322 RLGPLKVSSRDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVNGTSRNVVASLVDATIP 1381

Query: 824  LTDLF 828
            LT L 
Sbjct: 1382 LTGLL 1386

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]
           {ON} some similarities with uniprot|P32334 Saccharomyces
           cerevisiae YGR014W MSB2 Mucin family member at the head
           of the Cdc42p- and MAP kinase-dependent filamentous
           growth signaling pathway also functions as an osmosensor
           in parallel to the Sho1p-mediated pathway potential
           Cdc28p substrate
          Length = 908

 Score = 89.0 bits (219), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 5/98 (5%)

Query: 578 TQKPASTGTQNTNDWLPNSMI--FASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNT 635
           T++P ST  Q    WLP +M+  F +  + ST ++ +   T TLP  I A TE VQP   
Sbjct: 524 TEQPVSTTQQV---WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGY 580

Query: 636 TLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           TL+T+GFKKELNY F ++NP+++AQIFEFLP  L+YPF
Sbjct: 581 TLITVGFKKELNYPFTVNNPVSNAQIFEFLPKVLNYPF 618

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            ++P+     DY+V+VA+VYFP D++  LQ  I   +S +Y+N  T    L   ID  I 
Sbjct: 631 ELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALKQLSSYIDASIP 690

Query: 824 LTDL 827
           LT L
Sbjct: 691 LTGL 694

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score = 89.4 bits (220), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 585  GTQNTNDWLPNSMIFASD-QSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFK 643
            G++ ++DWLP  ++ AS  +S +T SS +   TATLP  I   T    P N + +TIGF+
Sbjct: 1297 GSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQ 1356

Query: 644  KELNYIFLIDNPLASAQIFEFLPLTLSYPFL 674
            K LNY FLI NPLASAQIF FLP  L YPF+
Sbjct: 1357 KALNYPFLIKNPLASAQIFGFLPDVLRYPFV 1387

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (62%)

Query: 765  ILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISL 824
            I+P+I +  DYI SVA VYFPT  + +LQK I    S LYSNP +   +L  LIDP I +
Sbjct: 1464 IIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPI 1523

Query: 825  TDLF 828
            T L 
Sbjct: 1524 TGLV 1527

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 5/91 (5%)

Query: 588  NTNDWLPNSMIFASD-----QSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGF 642
            +T++WLP +++ AS      QS ST S+ +   T TLP  I APTE  QP   TL+TIGF
Sbjct: 1175 STSNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGF 1234

Query: 643  KKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
            K+ LNY F++ N + SAQIF +LP TL++PF
Sbjct: 1235 KQALNYPFVVTNAVTSAQIFAYLPETLNFPF 1265

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 763  KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
              + P+  + RDY++++AEVYFP+  +  LQ  I    S  Y+  +T  + L   +D  I
Sbjct: 1275 ARLGPLKVSNRDYLLTIAEVYFPSAQVENLQTLIQNDESKFYAKNAT-KNLLAAFVDATI 1333

Query: 823  SLTDLF 828
             LT L 
Sbjct: 1334 PLTGLV 1339

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 6/86 (6%)

Query: 591 DWLPNSMIFASDQSDSTFSSLNPEI---TATLPAEIAAPTEAVQPPNTTLVTIGFKKELN 647
           DWLP+ +     QSDST  S+ P     T+ LP  I APT    P NTTL+T+ FK+ELN
Sbjct: 515 DWLPSEIAI---QSDSTAESMEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAFKRELN 571

Query: 648 YIFLIDNPLASAQIFEFLPLTLSYPF 673
           Y FL++N  +SAQIF FLP+ + +PF
Sbjct: 572 YAFLVNNFYSSAQIFNFLPIIIKHPF 597

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 96/254 (37%), Gaps = 33/254 (12%)

Query: 764  HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
             I+P I     YI+S+AEVY P + +  LQ+ I  P S  Y++ S+   TL  LIDP I 
Sbjct: 704  RIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSESSSLKTLAFLIDPNIP 763

Query: 824  LTDLFXXXXXXXXXXXXDGSLSSNDSSF-NTKTNPSNLT-----STETERSGSLDLNSGY 877
            LT +              G LSS++ +  N+ T  S+ +     S++T + G+LD +S Y
Sbjct: 764  LTGMLDSNGNLIS-----GGLSSSNGNIQNSSTKHSHGSGISDISSQTLKLGTLD-SSAY 817

Query: 878  TSKFSSKIKDRXXXXXXXXXXXXXXXXXXXXXXXKHWNKRIEXXXXXXXXXXXXXXXRFN 937
                S+ +K R                           K++                   
Sbjct: 818  KG-LSTNLKKRLSIFIVCFTVGAVLYIQLSLFGLNFMYKKLSMKADPESDKSSLPQYHIT 876

Query: 938  RVDLVTLXXXXXXXXXXXXPNEKQTYSSLENPFKDG---------TTVNSKEGVVYDQSN 988
            R                      +++S+  NPF D           ++      VY++S 
Sbjct: 877  R-----------DSTSNIEGRSSKSFSTPSNPFSDKYQKSSSDSSKSITLPGKAVYNRSQ 925

Query: 989  GMQYTVDYDGNFYY 1002
             M Y VD  GNFYY
Sbjct: 926  DMTYLVDEQGNFYY 939

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 81/135 (60%), Gaps = 10/135 (7%)

Query: 539  LLAATGTTEWDPHRGTFTLVLSQSSIPPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMI 598
            ++ +T TT+   HR  +++  +QS  P S  T       T  P+S+ T N N W+P  +I
Sbjct: 1115 VIPSTATTQSTSHRHGYSM--TQSYWPVSGPT------TTLAPSSS-TTNDNWWVPTKII 1165

Query: 599  FASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLAS 658
                  ++T SS + + TATLP  IAA T+ V+P   +L+TIGFK  LNY FLI +PL+S
Sbjct: 1166 -TQPAPNTTASSTSSQATATLPQAIAAATQQVRPKGYSLLTIGFKSALNYNFLISSPLSS 1224

Query: 659  AQIFEFLPLTLSYPF 673
            AQIF FLP  L+ PF
Sbjct: 1225 AQIFAFLPSILNDPF 1239

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%)

Query: 764  HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
             I+P+ S   DY+ +VAEVYFPT  +  L   I    S LY++       L  LIDP I 
Sbjct: 1250 QIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAELIDPTIP 1309

Query: 824  LTDL 827
            LT L
Sbjct: 1310 LTGL 1313

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
           Anc_5.524 YDR420W
          Length = 1530

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 2/82 (2%)

Query: 592 WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFL 651
           WLP ++I AS+ +DST ++   E TA+LPA IA   E   PP+  L+TIGF   LNY FL
Sbjct: 888 WLPTNIIIASN-ADSTHTA-RAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFL 945

Query: 652 IDNPLASAQIFEFLPLTLSYPF 673
           + NPL+SAQ+F+FLP  L +P 
Sbjct: 946 VGNPLSSAQVFDFLPHVLFFPI 967

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 67/127 (52%), Gaps = 5/127 (3%)

Query: 763  KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
            K I+P++    DYI SVAEVYFPT  +  L   I+ PNS LYSNP   ++TL  LID  I
Sbjct: 1042 KQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAI 1101

Query: 823  SLTDLFXXXXXXXXXXXXDGSLSSNDSSFNTKTNPSNLTSTETER-SGSLDLNSGYTSKF 881
             LT L                ++SN+S+ +         + E  R SG++DL++   SK 
Sbjct: 1102 PLTSLRKNDGQSNTSTDSSSDVNSNESTGDDAFQ----NAEEYLRVSGAMDLSNIKVSKV 1157

Query: 882  SSKIKDR 888
            +  I++R
Sbjct: 1158 NHTIRNR 1164

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 980  EGVVYDQSNGMQYTVDYDGNFYYFGNKELLDG 1011
            E ++ D + G+QY VD +GN+YY GN  L +G
Sbjct: 1250 ENIIVDSAQGIQYKVDNEGNYYYNGN-HLAEG 1280

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1262

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 7/90 (7%)

Query: 591 DWLPNSMIFASDQSD-------STFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFK 643
           +WLP +M+  S  +D        + + ++   T TLP  IAA T+  QP   TL+TIGFK
Sbjct: 901 NWLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFK 960

Query: 644 KELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           K LNY F++ +P++SAQ+F +LP  L+YPF
Sbjct: 961 KSLNYPFVVSHPVSSAQLFSYLPNVLNYPF 990

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%)

Query: 764  HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
             ++P+ S+ RDY+++VA+VYFP++ + +LQK I+   + LY N +    +L  LIDP I 
Sbjct: 1001 QLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKSLASLIDPTIP 1060

Query: 824  LTDLF 828
            LT + 
Sbjct: 1061 LTGII 1065

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
           YGR014W
          Length = 949

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (60%)

Query: 564 IPPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEI 623
           +P S V  S   ++     +T   N N W+ + ++ AS+++ +T  +     T +LP  I
Sbjct: 563 LPASNVPVSSSITLVTSATTTSHSNPNWWVASDLMTASEEASTTTRASATTATGSLPQAI 622

Query: 624 AAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           AAPTE   P + +L+TIGFKK LNY F+++ P +SAQ+F +LP+ L+ PF
Sbjct: 623 AAPTEVTAPDDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPF 672

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            I+P++ +  +Y ++VAEVYFP   +  LQ+ I   +S L++       TLV LIDP I 
Sbjct: 683 QIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLIDPSIP 742

Query: 824 LTDLF 828
           L  L 
Sbjct: 743 LVGLL 747

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
           Anc_4.150 YGR014W
          Length = 1123

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 2/84 (2%)

Query: 590 NDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYI 649
           N W+P  ++  + Q+ S  S    + TATLP  IAA T+  +P   TL+T+GFK+ LNY 
Sbjct: 794 NWWVPTQIVTQTSQTTS--SGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYN 851

Query: 650 FLIDNPLASAQIFEFLPLTLSYPF 673
           F++ NP++SAQIF FLP  L  PF
Sbjct: 852 FVVSNPISSAQIFAFLPEMLRTPF 875

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%)

Query: 763 KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
           + ++P+ S    Y+ +VAEVYFPT  +  L K I+  +S LY++   P   L +LID  I
Sbjct: 885 QQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNLYTDVEGPAKYLAYLIDASI 944

Query: 823 SLTDLF 828
            LT L 
Sbjct: 945 PLTGLL 950

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa]
           {ON} some similarities with uniprot|P41809 Saccharomyces
           cerevisiae YDR420W HKR1 Serine/threonine rich cell
           surface protein that contains an EF hand motif involved
           in the regulation of cell wall beta-1 3 glucan synthesis
           and bud site selection overexpression confers resistance
           to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 148/297 (49%), Gaps = 26/297 (8%)

Query: 403 PSQTLSASLKQTSTGSSSDPPLVHTSTSPVVSQVHASTSMLD-STSSAKFAHST------ 455
           P  TLS ++  + TG++S+  L+  ST   V     ST ++D STSS      T      
Sbjct: 523 PFTTLSTNILPSETGTTSESLLILVST---VESTPESTIIMDVSTSSPDMVSPTSGEISS 579

Query: 456 ---LSTS-LLQSNAASENRYTSSTLFSSKY-TPTGVKSTNTKIIGLTSSKSIIIEGSETS 510
              +STS +LQ    S +  T   + SS+    + +   +T    +TS   I +E S TS
Sbjct: 580 IVPVSTSVILQDTDVSSSTSTEMVVISSEAPGASSILQESTTFTDITSGSDIQLERSTTS 639

Query: 511 QNSRSPLRTVQTSSAST-----FNRDKTAKSQNLLAATGTTEWDPHRGTFTLVLSQSSIP 565
             + S + +  T+S ST     F+  ++A + + LA++       + G     +S++  P
Sbjct: 640 IIASS-VTSGTTASESTNVFTVFSSTESASTHHSLASSSIITQTINSGASASFISETRQP 698

Query: 566 PSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFASDQSDSTFSSLNPEI--TATLPAEI 623
              +  S   ++     ++G  + N+WLP +++     + +T ++ + ++  T+TLP  I
Sbjct: 699 ---MATSVSATLDGSIVNSGLTSNNNWLPTTLVIEPTAAHATSAATSADLGATSTLPQAI 755

Query: 624 AAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNA 680
              ++   P   T++T+GFK+ LNY FLI NPLASAQIF FLP  L  PF LT   A
Sbjct: 756 NPASDVPLPDGYTVITVGFKEPLNYPFLIANPLASAQIFNFLPKVLVRPFQLTTTGA 812

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%)

Query: 763 KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
           K I+P++     YIVS+AEVYFPT+++  LQ+ +   +S LYSNP +  + L  LI+P I
Sbjct: 845 KSIVPLVIQNVSYIVSIAEVYFPTESVHTLQELVLDSSSILYSNPVSYLADLASLINPAI 904

Query: 823 SLTDL 827
            LT L
Sbjct: 905 PLTGL 909

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 970  FKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFG 1004
            + D   + + E  VY  S G+ Y VD DGNF++ G
Sbjct: 1061 YIDDDLIITGENTVYSISQGITYYVDEDGNFFFAG 1095

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
           Anc_4.150 YGR014W
          Length = 826

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 588 NTNDWLPNSMIFASDQSDSTFSSLNPEITATL-PAEIAAPTEAVQPPNTTLVTIGFKKEL 646
           ++N W+P  +I  SD++ ++ SS     T  + P  IAAPT    P   TL+TIGFK+ L
Sbjct: 484 SSNWWVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEAL 543

Query: 647 NYIFLIDNPLASAQIFEFLPLTLSYPF 673
           NY F++DNP++SAQIF FLP  L  PF
Sbjct: 544 NYDFVLDNPVSSAQIFAFLPEALDLPF 570

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 774 DYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLF 828
           +Y V VAEVYFP+D++  L   I   +SPLY+  +     LV+LID  I LT L 
Sbjct: 592 NYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNTGSRLALVNLIDQNIPLTGLV 646

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR014W
           (MSB2)
          Length = 1105

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 10/95 (10%)

Query: 589 TNDWLPNSMIFASDQSD-STFSSLN----PEITAT-----LPAEIAAPTEAVQPPNTTLV 638
           + +WLP  +I A++Q   ST S  N    P+ TAT     LP  IAAP       + TL+
Sbjct: 754 SGNWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLI 813

Query: 639 TIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           TIGFKK+LNY F+  NP A+AQIF++LP  L+YPF
Sbjct: 814 TIGFKKQLNYPFIAMNPFANAQIFDYLPGILNYPF 848

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            ++P+ +N +DYI ++A+VYFP++ +  L K +   NS LYS+          LIDP + 
Sbjct: 859 QLVPLKANSKDYIATIAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKVFASLIDPQLP 918

Query: 824 LTDL 827
           LT L
Sbjct: 919 LTGL 922

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 75.9 bits (185), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 590  NDWLPNSMIFASDQSDSTFSS-LNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNY 648
            N W+P  +I  + ++ ST SS +    T TLP  IAA T+  +P   TL+TIGFKK LNY
Sbjct: 959  NWWIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNY 1018

Query: 649  IFLIDNPLASAQIFEFLPLTLSYPF 673
             F++  P +SAQIF +LP  L+ PF
Sbjct: 1019 EFVVSEPKSSAQIFGYLPEALNTPF 1043

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%)

Query: 764  HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
             I+P+  +  +Y+VSVAEVYFPT  +  L   I   +S  Y++      ++  ++D  I 
Sbjct: 1054 QIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNSSSAFYTDGMGTAKSMAAMVDSSIP 1113

Query: 824  LTDLF 828
            LT L 
Sbjct: 1114 LTGLL 1118

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 13/130 (10%)

Query: 555  FTLVLSQSSIPPSVVTRSRKTSIT----------QKPASTGTQNTNDWLPNSMIFASDQS 604
            FT  ++++S+PPS +  S   S T            P+ST T+ +N W+P S+  AS  +
Sbjct: 1451 FTSSVAETSLPPSQLLPSDIESSTFTSSEIYFTSSAPSSTITRQSNWWIPTSLAVASTMN 1510

Query: 605  DSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEF 664
             +  S+L    T  +P  I +  +   P N +L+TIGFKKELNY F++ +P++ AQI  +
Sbjct: 1511 STDTSTLP---TQAIPQAIGSVEQPPAPENHSLITIGFKKELNYEFVVSHPMSGAQIINY 1567

Query: 665  LPLTLSYPFL 674
            LP TL   F 
Sbjct: 1568 LPNTLVNAFF 1577

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 764  HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            +++P    + DY++++A VYFPTD +  L++ I+  +S  Y+        L +L+DP I 
Sbjct: 1587 NLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLVDPSIP 1646

Query: 824  LTDL 827
            LT L
Sbjct: 1647 LTGL 1650

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
           Anc_4.150
          Length = 985

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 576 SITQKPAST-GTQNTNDWLPNSMIFASDQ-SDSTFSSLNPEITATLPAEIAAPTEAVQPP 633
           S+T  P  T  + +TN W+P  +I  S+Q S+S     +   T TLP  IA  T   +P 
Sbjct: 589 SVTTTPTQTRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIPEPE 648

Query: 634 NTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
             +L+TIGFKK LNY F++ NP +SAQIF FLP  L+ PF
Sbjct: 649 GYSLITIGFKKPLNYEFIVANPKSSAQIFSFLPDVLNAPF 688

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 12/72 (16%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYS-------TLVH 816
            ++P+ +   +Y+V+VA+VYFPTD +  L   I       Y+ PS  Y+       +L +
Sbjct: 699 QLVPLQNPSLNYLVTVAKVYFPTDMIDTLSSLIED-----YTTPSLIYTINQGAKGSLAN 753

Query: 817 LIDPWISLTDLF 828
           LI   I LT L 
Sbjct: 754 LISSDIPLTGLL 765

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
           complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 72.0 bits (175), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (60%)

Query: 590 NDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYI 649
           N W+P S+I  SD +DS  ++     T ++P  IAA T+   P   +LVTIGFK+ LNY 
Sbjct: 641 NWWVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQ 700

Query: 650 FLIDNPLASAQIFEFLPLTLSYPF 673
           F++ + +  AQIF FLP  L  PF
Sbjct: 701 FVLSSSVTVAQIFAFLPGGLIAPF 724

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%)

Query: 774 DYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDL 827
           +Y ++VAEVYFPT  +  L  F+    S LY N S     LV LIDP I +T L
Sbjct: 745 NYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEELVSLIDPRIPITGL 798

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
           (REAL)
          Length = 1169

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 590 NDWLPNSMIFASDQSDSTFSS-LNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNY 648
           N W+P  +I  + ++ ST SS +    T TLP  +AA T+  +    +L+T+GFKK LNY
Sbjct: 821 NWWIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNY 880

Query: 649 IFLIDNPLASAQIFEFLPLTLSYPF 673
            F++  P +SAQIF +LP  L+ PF
Sbjct: 881 EFVVSEPKSSAQIFGYLPAALNTPF 905

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            I+P+  +  +Y++SVAEVYFPT  +  L   I   +S  Y++ +    ++  ++DP I 
Sbjct: 916 QIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNTSSTFYTDGTGTAKSMAAMVDPSIP 975

Query: 824 LTDLF 828
           LT L 
Sbjct: 976 LTGLL 980

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON}
           Anc_4.150
          Length = 785

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 590 NDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYI 649
           N W+P  +I AS Q   + + ++   T TLP  I A T    P   T++TIGFK+ LNY 
Sbjct: 450 NWWIPTQLITASTQVTGS-AMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYE 508

Query: 650 FLIDNPLASAQIFEFLPLTLSYPF 673
           F++ +P +SAQIF FLP  L+ PF
Sbjct: 509 FIVSSPKSSAQIFSFLPYVLNTPF 532

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            ++P+      Y ++VAEV FP   +  L  +I   NS LY+       +L  LIDP I 
Sbjct: 543 RLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLALLIDPSIP 602

Query: 824 LTDLF 828
           LT L 
Sbjct: 603 LTGLV 607

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
           (REAL)
          Length = 1135

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 590 NDWLPNSMIFASDQSDSTFSSLNPEITAT-LPAEIAAPTEAVQPPNTTLVTIGFKKELNY 648
           N W+P  +I    ++ S+ S+         LP  IAA T+  +P   +L+TIGFKK LNY
Sbjct: 788 NWWIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNY 847

Query: 649 IFLIDNPLASAQIFEFLPLTLSYPF 673
            F++  P +SAQIF +LP  L+ PF
Sbjct: 848 EFVVSEPKSSAQIFAYLPEALNTPF 872

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            I+P+  +   Y+VSVAEVYFPT  +  L   I   +S  Y++      ++  ++D  I 
Sbjct: 883 QIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAAMVDASIP 942

Query: 824 LTDLF 828
           LT L 
Sbjct: 943 LTGLL 947

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
           similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 57/96 (59%), Gaps = 11/96 (11%)

Query: 589 TNDWLPNSMIFASDQ-SDSTFS----------SLNPEITATLPAEIAAPTEAVQPPNTTL 637
           T+ WLP +++  SD  S+ T +          S+      TLP  I++    +   N TL
Sbjct: 773 TSTWLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKIPEGNYTL 832

Query: 638 VTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           +T+GFK+ LNY F++ NP++SAQIF+FLP  L+YP+
Sbjct: 833 ITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPY 868

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            +LP+ S  RDY+V+VA V+FPT+ L  L + +    S LYS+      T+  LIDP I 
Sbjct: 879 RLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSLYSSYDETGKTMASLIDPMIP 938

Query: 824 LTDLF 828
           LT + 
Sbjct: 939 LTGII 943

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
           YGR014W
          Length = 994

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 3/91 (3%)

Query: 586 TQNTNDWLPNSMI---FASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGF 642
           T +++ W+P  ++    A + + +T S+L+P  T  +P  I AP +       TL+TIGF
Sbjct: 640 TTDSDWWIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGF 699

Query: 643 KKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           KK L+Y F++  P +SAQI  FLP  L+ P+
Sbjct: 700 KKPLHYEFVVTQPKSSAQIISFLPNLLNQPY 730

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            ++P+  +   Y V+VAEVYFPT  +  L + +   +S LY+  S    TL  +IDP I 
Sbjct: 741 QLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLADMIDPSIP 800

Query: 824 LTDLF 828
           +T L 
Sbjct: 801 ITGLV 805

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
           (REAL)
          Length = 1189

 Score = 62.0 bits (149), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 9/111 (8%)

Query: 572 SRKTSITQKPASTGTQN--------TNDWLPNSMIF-ASDQSDSTFSSLNPEITATLPAE 622
           +  T++ Q   + GT N         N W+P  +I  A + + +  S+ +   T TLP  
Sbjct: 814 AESTTVLQPSTTNGTDNYSSVTSSDNNWWIPTELITQAPEAASTASSTASGTQTMTLPHA 873

Query: 623 IAAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
           IAA T+       +L+T+GFK+ LNY F++  P +SAQIF +LP  L+ PF
Sbjct: 874 IAAATQIPASEGYSLITVGFKRALNYEFVVSEPKSSAQIFGYLPEALNTPF 924

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 764 HILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWIS 823
            I+P+  +   Y+VSVAEVYFPT  L  L   I   +S  Y++ +    ++  ++DP I 
Sbjct: 935 QIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVDPSIP 994

Query: 824 LTDLF 828
           LT L 
Sbjct: 995 LTGLL 999

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 591  DWLPNSMIFASDQSD--STFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNY 648
            DWLP ++I  S Q    +  S+     T  LPA I   +         L++IGF K LNY
Sbjct: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556

Query: 649  IFLIDNPLASAQIFEFLPLTLSYPF 673
            +F+    L+SAQIF FLP  L+YPF
Sbjct: 1557 VFVTSFALSSAQIFTFLPPVLTYPF 1581

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 763  KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
            K + P +S +R YI ++A VYFP+  +  LQ+ I    SPLY+NP         LIDP I
Sbjct: 1646 KQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTI 1705

Query: 823  SL 824
             +
Sbjct: 1706 KV 1707

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 980  EGVVYDQSNGMQYTVDYDGNFYYFG 1004
            E  VY  S G+ Y +D +GN+YY G
Sbjct: 1860 ENTVYSLSQGIAYHIDEEGNYYYAG 1884

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 6/103 (5%)

Query: 574  KTSITQKPASTGTQNTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPT--EAVQ 631
            K++ T K  S G+    +WLP++++  ++ S S     NP  T   P  I      E   
Sbjct: 1542 KSTFTTKSVSNGS----NWLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPA 1597

Query: 632  PPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFL 674
            P ++ L+ +   + LNY FLI+N ++SAQ+  ++P  LSY  +
Sbjct: 1598 PVDSQLILVALDRPLNYPFLIENLVSSAQVMNYIPFILSYSLI 1640

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 982  VVYDQSNGMQYTVDYDGNFYYFGNKELLDGTNTTTFTEYMYNDIEQGH 1029
            +VYD +NG+ YTVD +GN+YY  N  L  G +  TF   + +  ++GH
Sbjct: 2002 IVYDNNNGLAYTVDKEGNYYYHHN--LTTGKDFITFNTSLQDYRKEGH 2047

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%)

Query: 763  KHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWI 822
            K I+P++   RDY V+  +VY P + +  LQ +I   +S LY NP      L + ID  I
Sbjct: 1780 KQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFIDSSI 1839

Query: 823  SL 824
             +
Sbjct: 1840 PI 1841

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
           similar to uniprot|P32334 Saccharomyces cerevisiae
           YGR014w MSB2 multicopy suppressor of a CDC24 bud
           emergence defect
          Length = 936

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (59%), Gaps = 6/89 (6%)

Query: 590 NDWLPNSMIFA--SDQSDSTFSSLNPEIT-ATLPAEI--AAPTEAVQPPNTTLVTIGFKK 644
           N W+P S+I A    +S+ST +  N     ++LP  I  +A +E+V P   +++TIGFKK
Sbjct: 589 NAWIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESV-PEGYSVITIGFKK 647

Query: 645 ELNYIFLIDNPLASAQIFEFLPLTLSYPF 673
            LNY F++    +SAQI  +LP  L+  F
Sbjct: 648 PLNYPFVVSESKSSAQIMYYLPKLLNANF 676

>CAGL0F02057g Chr6 complement(197149..199689) [2541 bp, 846 aa] {ON}
           no similarity
          Length = 846

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 595 NSMIFASDQSDSTFS------SLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKK 644
           N  IF+SD  +S+ S        NP +   LP EI AP   V+ P TT   +  KK
Sbjct: 260 NGQIFSSDNKESSTSISPEGTPPNPTLVGKLPVEIQAPEVTVRRPRTTKAELQTKK 315

>Kpol_163.1 s163 (208..1008) [801 bp, 266 aa] {ON} (208..1008) [801
            nt, 267 aa]
          Length = 266

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 959  EKQTYSSLENPFKDGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFGNKELLDGTN 1013
            EK++ SSL    K+  TV SKE       + M + +D+ GN+YY G+++ ++  N
Sbjct: 37   EKKSASSLSGDTKEFETVYSKE-------HEMTFIIDHQGNYYYGGSQDTVNEVN 84

>NDAI0B04640 Chr2 complement(1150965..1153178) [2214 bp, 737 aa]
           {ON} Anc_1.342
          Length = 737

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 64/151 (42%), Gaps = 17/151 (11%)

Query: 91  NNNQQYSSTIQYSQLATTSTSLPIETVISSMDQQFQSNQPSLSGSKYTSLTFSVS----- 145
           N+NQQ  ST  +S +        + +  SS+DQ+FQS  P    ++  S++ +V      
Sbjct: 459 NSNQQLPSTPSHSGVNAVDR---VASNQSSVDQRFQSLDPGNQTARLPSMSTTVDSMATS 515

Query: 146 -KDSAIPSVAGTKTMPPAVSSMF----VPTSTLSDTQGSVSAESTPQYIALPSTLSSDRA 200
             D  I  +     MP  V++ F    VP  +L + +  +      Q I +  T   D  
Sbjct: 516 MSDRPISHIQADAAMPHGVNNNFKTFGVPLESLIEYEQDMVPAIVRQCIYVIDTYGLDLE 575

Query: 201 ----KSKEKLDISSRMVEITSYPYSVSSSMP 227
               KS   LD+S    +I   P +VS  +P
Sbjct: 576 GIYRKSANVLDVSKLREDIDKDPSNVSMILP 606

>NCAS0B07320 Chr2 complement(1383781..1385949) [2169 bp, 722 aa]
           {ON} Anc_1.342 YBR260C
          Length = 722

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 57/128 (44%), Gaps = 18/128 (14%)

Query: 125 FQSNQPSLSGSKYTSLTFSVSK---DSAIP--SVAGTKTMPPAVSSMF----VPTSTLSD 175
           F S  P    +++ SL+ +V++   DS+ P   +  T TMPP VS+ F    VP   L +
Sbjct: 476 FASLDPGNHATRFPSLSTTVTQSTGDSSRPVSHIQSTSTMPPGVSNNFKTFGVPLEVLIE 535

Query: 176 TQGSVSAESTPQYIALPST----LSSDRAKSKEKLDISSRMVEITSYPYSVSSSMP---- 227
            +  +      Q I +  T    L     KS   LD+S    EI   P +VS  +P    
Sbjct: 536 YEQDMVPAIVRQCIYVIDTYGLELEGIYRKSANVLDVSKLKEEIDKDPSNVSMILPPKNY 595

Query: 228 -ESEIKLA 234
            ES+I L 
Sbjct: 596 SESDIYLV 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.122    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,372,466
Number of extensions: 4265833
Number of successful extensions: 32428
Number of sequences better than 10.0: 1466
Number of HSP's gapped: 26571
Number of HSP's successfully gapped: 3964
Length of query: 1190
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1069
Effective length of database: 39,606,813
Effective search space: 42339683097
Effective search space used: 42339683097
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)