Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E033005.527ON46646619630.0
KNAG0C032305.527ON5614317211e-88
NCAS0F010905.527ON7873586024e-69
Smik_4.6975.527ON8173496035e-69
NDAI0H016005.527ON8423546036e-69
Suva_2.5995.527ON8273465941e-67
Skud_4.6965.527ON8113485886e-67
YDR422C (SIP1)5.527ON8153495823e-66
ADR194C5.527ON6373395306e-60
KLTH0G03762g5.527ON7093535251e-58
Kwal_47.186425.527ON3093044902e-57
TBLA0D016505.527ON10163475224e-57
ZYRO0D12562g5.527ON8183754902e-53
Kpol_1004.215.527ON7553644382e-46
Ecym_40655.527ON7213213801e-38
TDEL0A039105.527ON7491533351e-32
CAGL0F03047g5.527ON7441493341e-32
SAKL0G04928g5.527ON8923753129e-30
TPHA0K005305.527ON6463422843e-26
Kpol_1023.985.527ON6671652711e-24
Suva_5.1233.517ON4232461961e-15
ZYRO0E08404g3.517ON3482441871e-14
TDEL0D058503.517ON4042471881e-14
CAGL0A03696g3.517ON4152461872e-14
YER027C (GAL83)3.517ON4172461854e-14
Smik_5.1503.517ON4172541854e-14
Skud_5.1363.517ON4182431837e-14
Smik_7.553.517ON4152721837e-14
YGL208W (SIP2)3.517ON4152741811e-13
KNAG0B036905.527ON3263001711e-12
NCAS0E006203.517ON500681581e-10
TBLA0I032703.517ON433681552e-10
Skud_7.603.517ON441691509e-10
KAFR0I023803.517ON409691435e-09
Suva_7.533.517ON414691428e-09
Ecym_12103.517ON450691411e-08
AER361C3.517ON475691402e-08
KNAG0B006003.517ON389721392e-08
KNAG0E015903.517ON423691392e-08
NCAS0F037303.517ON432691392e-08
Kpol_195.23.517ON435711356e-08
SAKL0F02002g3.517ON503661358e-08
Kwal_47.190403.517ON429721312e-07
NDAI0B060103.517ON503371322e-07
KLLA0B00583g3.517ON486371293e-07
NDAI0I028903.517ON582371294e-07
KLTH0G01848g3.517ON416721284e-07
CAGL0K09350g3.517ON432701284e-07
TPHA0A058103.517ON424371284e-07
KAFR0F041403.517ON348371142e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E03300
         (466 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   760   0.0  
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   282   1e-88
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   236   4e-69
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   236   5e-69
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   236   6e-69
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   233   1e-67
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   231   6e-67
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   228   3e-66
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   208   6e-60
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   206   1e-58
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   193   2e-57
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   205   4e-57
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   193   2e-53
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   173   2e-46
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   150   1e-38
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   133   1e-32
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   133   1e-32
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   124   9e-30
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   114   3e-26
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   108   1e-24
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    80   1e-15
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    77   1e-14
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    77   1e-14
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    77   2e-14
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    76   4e-14
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    76   4e-14
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    75   7e-14
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    75   7e-14
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    74   1e-13
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    70   1e-12
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     65   1e-10
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    64   2e-10
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    62   9e-10
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    60   5e-09
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    59   8e-09
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    59   1e-08
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    59   2e-08
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    58   2e-08
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    58   2e-08
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    58   2e-08
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    57   6e-08
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    57   8e-08
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    55   2e-07
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    55   2e-07
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    54   3e-07
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    54   4e-07
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    54   4e-07
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    54   4e-07
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    54   4e-07
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    49   2e-05

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/466 (84%), Positives = 394/466 (84%)

Query: 1   MSRNXXXXXXXXXXXXIINQDMANLSLEXXXXXXXXXXXXXXXXXXXXKHVLTPPDDSSN 60
           MSRN            IINQDMANLSLE                    KHVLTPPDDSSN
Sbjct: 1   MSRNSSDFDGYYDDDSIINQDMANLSLESSNTDDDGLLSSGLPSLTTTKHVLTPPDDSSN 60

Query: 61  TESVMSSANLRSTLTDDYDSINQSTLQNVMKRKRSEQPMSQTAKTMLKLYGNSAEREREQ 120
           TESVMSSANLRSTLTDDYDSINQSTLQNVMKRKRSEQPMSQTAKTMLKLYGNSAEREREQ
Sbjct: 61  TESVMSSANLRSTLTDDYDSINQSTLQNVMKRKRSEQPMSQTAKTMLKLYGNSAEREREQ 120

Query: 121 EAKNASLLSLPNTKKFKNESAGTXXXXXXXXXXXXXILKWREPIDHNSAVAIVSKDIVST 180
           EAKNASLLSLPNTKKFKNESAGT             ILKWREPIDHNSAVAIVSKDIVST
Sbjct: 121 EAKNASLLSLPNTKKFKNESAGTDSDVDDDNDDVEVILKWREPIDHNSAVAIVSKDIVST 180

Query: 181 LLTIAKTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSN 240
           LLTIAKTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSN
Sbjct: 181 LLTIAKTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSN 240

Query: 241 YLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHREKSTANESISSNSLTDYAGXXXX 300
           YLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHREKSTANESISSNSLTDYAG    
Sbjct: 241 YLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHREKSTANESISSNSLTDYAGISRS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMSLSKVI 360
                                  DDEIKYTNEIPEIFKFDSTANSNVNNQAFDMSLSKVI
Sbjct: 301 SSIVSNKSSLISSSLKLTNLNLNDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMSLSKVI 360

Query: 361 DLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNT 420
           DLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNT
Sbjct: 361 DLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNT 420

Query: 421 VPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAPSSPTQSD 466
           VPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAPSSPTQSD
Sbjct: 421 VPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAPSSPTQSD 466

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  282 bits (721), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 173/431 (40%), Positives = 225/431 (52%), Gaps = 77/431 (17%)

Query: 99  MSQTAKTMLKLYGNSAE--------REREQEAKNASLLSLPNTKKFKN-------ESAGT 143
           MS TA  MLKLYG+  +        RE  +    AS + LP  KK K        E   T
Sbjct: 136 MSATAAIMLKLYGDKNQLAHEVHEAREVHEVKSAASNVRLPEVKKIKKPLPEKETEKVRT 195

Query: 144 XXXXXXXX---------XXXXXILKWREP---IDHNSAVAIVSKDIVSTLLTIAKTHKSS 191
                                 ILKWR+P       +  AI S DI STL  I    KS 
Sbjct: 196 QVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAI----KSE 251

Query: 192 IIT-FIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANG 250
           +IT   E K+  + L YD    +W++P+L+LPPGIY+L+FLING L+HSN+LPTAT+A G
Sbjct: 252 LITPERENKEDLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAG 311

Query: 251 NIVNWFEVICGYKTIEPYRDEERIIHREKSTANESISSNS-LTDYAG------------- 296
            IVNWFEV+ GY+TIEPYRDE  I   ++S  ++   S + +TDYAG             
Sbjct: 312 TIVNWFEVLPGYETIEPYRDESMIGQDDESIDSQPYKSTTDVTDYAGISRSSSVVSKHSK 371

Query: 297 ----------XXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTANSN 346
                                                + + +Y+ EIPE+F+FD      
Sbjct: 372 SNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRK 431

Query: 347 VN----------------NQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRF 390
            N                N  FD +L++V++ NQD +FAS+QKI +M T+EAE YFL +F
Sbjct: 432 TNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKF 491

Query: 391 KIHDLPIYLNSNFLNKIFIRDNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           K+ DLPIYLNS +LNK F     +   N+ +PHVNL HLLTTSIK+D +CV CTTRY GK
Sbjct: 492 KVSDLPIYLNSTYLNKNF-----SGEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGK 546

Query: 451 FITQIMYAPSS 461
           FITQ++YAP S
Sbjct: 547 FITQVIYAPCS 557

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  236 bits (602), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 199/358 (55%), Gaps = 67/358 (18%)

Query: 157 ILKWREPIDH--NSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214
           +LKWR+ ID+  +  ++IVS DI            SS I     K  K+ +L++ +  EW
Sbjct: 431 VLKWRDQIDNPKHCKISIVSDDI------------SSAIPAKATKAGKLPMLFNPMIKEW 478

Query: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE--E 272
           Y+PNL LPPGIY+L+F ING+L HSN+LPTAT++ GNIVNWFEV+ GY T+EPYRDE  E
Sbjct: 479 YVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDEIIE 538

Query: 273 RIIHREKS---------------------TANESISS-NSLTDYAGXXXXXXXXXXXXXX 310
              H   S                     +AN  ++S    +DY G              
Sbjct: 539 TTFHTNGSQGTLRDNNPTTIRSRRSSSFVSANGDLASMTPYSDYTGISRSNSALNSKRTS 598

Query: 311 XXXXXXXXX----XXXXDDEIKYTNEIPEIFKFDSTANSNVNNQ---AFDMSLS------ 357
                              +I+Y+NEIPE+FK  ++     +++     + +LS      
Sbjct: 599 LVSLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSIEDEDDDEGDYGHNETLSPFEEPS 658

Query: 358 ---KVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIR---- 410
              +V+D NQD +F+ LQK   ++ + AE  FLN++++ DLPIYLNS++LNKIF++    
Sbjct: 659 FTNRVVDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQ 718

Query: 411 DNNNETTNNT---------VPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
            N+   + NT         +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ+MYAP
Sbjct: 719 HNDPTPSANTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAP 776

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 21/67 (31%)

Query: 81  INQSTLQNVMKR----KRSE-----------------QPMSQTAKTMLKLYGNSAERERE 119
           +NQS L++ MKR    KR++                 +P+S TA  MLKLYG+  + E+E
Sbjct: 283 LNQSFLKDAMKRDMKRKRTDTGASTATPDIEKPTEKKKPISATAAMMLKLYGDKNQMEKE 342

Query: 120 QEAKNAS 126
           ++  + S
Sbjct: 343 EKKSSGS 349

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  236 bits (603), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 186/349 (53%), Gaps = 46/349 (13%)

Query: 157 ILKWR--EPIDHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF--KINLLYDIVTN 212
           ILKW+    +   + V+IVS DI S L    +       +    K+   +I ++YD V  
Sbjct: 455 ILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHK 514

Query: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE- 271
           EW+ P+LFLPPGIY+LQF ING L HSNYLPTAT++ GN VNWFEV+ GY TIEP+R+E 
Sbjct: 515 EWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEA 574

Query: 272 ------ERIIHREKSTANE-------------------SISSNSLTDYAGXXXXXXXXXX 306
                 E ++  E     E                      S   +DY G          
Sbjct: 575 DLGSQVEPVLEEESPIRPELKRFSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSSSVNMR 634

Query: 307 XXXXXXXXXXXXXXXXXDDE-IKYTNEIPEIFKFDSTANSNVNNQAFDMSLS-------K 358
                              E ++Y+NEIP +F       ++V  ++ D S         K
Sbjct: 635 DSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYK 694

Query: 359 VIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNE--- 415
           V+D NQD +FA+LQ+   ++ + AE  FL+R+ I DLPIYLNS++LNKI  + N N    
Sbjct: 695 VVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPH 754

Query: 416 -----TTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
                  N+ +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ++YAP
Sbjct: 755 DRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 803

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  236 bits (603), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 190/354 (53%), Gaps = 54/354 (15%)

Query: 157 ILKWREPIDH--NSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214
           +LKWR+ ID+     +AI+S DIV+ L + +   KS+           + ++++ +  EW
Sbjct: 480 VLKWRDQIDNPKKCKIAIISDDIVNALESSSSKRKSNTNN---NDNNTLPMVFNPMIKEW 536

Query: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE--E 272
           Y+PNL LPPGIY+L+F IN ++ HSN+LPTAT++ GNIVNWFEV+ GY  +EPYRDE  E
Sbjct: 537 YMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIE 596

Query: 273 RIIHREKSTANESI----------------------SSNSLTDYAGXXXXXXXXXXXXXX 310
              H   S    S+                      S    +DYAG              
Sbjct: 597 TTFHTAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKK 656

Query: 311 XXXXXXXXX------XXXXDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMS--------L 356
                                +I Y+ EIPE+FK  ++ ++N      D S         
Sbjct: 657 ASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFT 716

Query: 357 SKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIF--IRDNNN 414
            KVID NQD +FA LQ+   ++ + AE  FLNR+ I DLPIYLNS +LNKIF   +  +N
Sbjct: 717 HKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHN 776

Query: 415 ETT---------NNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           + T          + +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ+MYAP
Sbjct: 777 DPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAP 830

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 33/72 (45%)

Query: 81  INQSTLQNV----MKRKRS----------------------------EQP-MSQTAKTML 107
           +NQSTLQN     MKRKR+                            E+P MS TA  ML
Sbjct: 293 VNQSTLQNALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMML 352

Query: 108 KLYGNSAERERE 119
           KLYG++  +E+E
Sbjct: 353 KLYGDTTLKEKE 364

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  233 bits (594), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 186/346 (53%), Gaps = 43/346 (12%)

Query: 157 ILKWR--EPIDHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF--KINLLYDIVTN 212
           ILKW+    +   + V+I+S DI STL    + +     +    K+   +I ++YD V  
Sbjct: 470 ILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHK 529

Query: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE- 271
           EW++P LFLPPGIY+LQF ING L HSN+LPTAT++ G  VNWFEV+ GY TIEP+RDE 
Sbjct: 530 EWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEA 589

Query: 272 ------------ERIIHREKSTANESIS-------------SNSLTDYAGXXXXXXXXXX 306
                       E  I  E    + S               S   +DY G          
Sbjct: 590 DTESQVGSTIDVEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSNSANLR 649

Query: 307 XXXXXXXXXXXXXXXXXDDEI-KYTNEIPEIFKFDSTANSNVNNQAFDMSLS----KVID 361
                              EI +Y+NEIP +F   + + + +        L     KV+D
Sbjct: 650 DSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVD 709

Query: 362 LNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETT---- 417
            NQD +FA+LQ+   ++ + AE  FL+R+ I DLPIYLNS++LNKI  + N N  +    
Sbjct: 710 CNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKD 769

Query: 418 ----NNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
               N+ +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ++YAP
Sbjct: 770 EGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 815

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 95  SEQPMSQTAKTMLKLYGNSAERERE-QEAKNASLLSLPNTK 134
           S  P+S TAK M+KLYG+    ER+  + +N SL  + N K
Sbjct: 349 SGAPISATAKMMMKLYGDKTLMERDLNKHQNKSLKKVQNKK 389

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  231 bits (588), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 130/348 (37%), Positives = 184/348 (52%), Gaps = 45/348 (12%)

Query: 157 ILKWREPIDHNSA--VAIVSKDIVSTLLTIAKTHKSSIITFIERKKF--KINLLYDIVTN 212
           +LKW+   +  +   V+IVS DI S L    + +     +    K    +I ++YD V  
Sbjct: 452 VLKWKSDTNMTATTEVSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDSVHR 511

Query: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEE 272
           EW++P+LFLP GIY+LQF ING L HSN+LPTAT++ GN VNWFEV+ GY TIEP+RDE 
Sbjct: 512 EWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRDEA 571

Query: 273 RIIHREKSTANESIS-------------------------SNSLTDYAGXXXXXXXXXXX 307
            +  + +ST +E                                +DY G           
Sbjct: 572 DMDFQMRSTLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSDYRGLSRSNSVFLRG 631

Query: 308 XXXXXXXXXXXXXXXXDDE-IKYTNEIPEIFKFDSTANSNVNNQAFDMS-------LSKV 359
                             E ++Y+NEIP +F     + +   +    +S         KV
Sbjct: 632 SFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKDHFERLSPQDRPSFTHKV 691

Query: 360 IDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIF--------IRD 411
           +D NQD +FA+LQ+   ++ + AE  FL+R+ I DLPIYLNS++LN+I           D
Sbjct: 692 VDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSYLNRILNQSNPNSEFHD 751

Query: 412 NNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
            +    N+ +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ++YAP
Sbjct: 752 GDEGGINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 799

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 187/349 (53%), Gaps = 46/349 (13%)

Query: 157 ILKWRE--PIDHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF--KINLLYDIVTN 212
           +LKW++   +   + V IVS DI S L    +       +    K+   +I ++YD V  
Sbjct: 455 VLKWKDDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVHK 514

Query: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEE 272
           EW++P+LFLP GIY+LQF ING L HSN+LPTAT++ GN VNWFEV+ GY TIEP+R+E 
Sbjct: 515 EWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRNEA 574

Query: 273 RIIHREKSTANESIS--------------------------SNSLTDYAGXXXXXXXXXX 306
            I  + + T +E +                           S   +DY G          
Sbjct: 575 DIDSQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDYRGLSRSSSINMR 634

Query: 307 XXXXXXXXXXXXXXXXXDDE-IKYTNEIPEIFKFDSTANSNVNNQAFDMS-------LSK 358
                              E + Y+NEIP +F     +  +V   + D+          +
Sbjct: 635 DSFVRLKASSLDLMAEVKPERLVYSNEIPNLFNIGDGSTISVKGDSDDVHPQEPPSFTHR 694

Query: 359 VIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETT- 417
           V+D NQD +FA+LQ+   ++ + AE  FL+R+ + DLPIYLNS++LN+I  + N N  + 
Sbjct: 695 VVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLPIYLNSSYLNRILNQSNQNSESH 754

Query: 418 -------NNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
                  N+ +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ++YAP
Sbjct: 755 ERDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVVYAP 803

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  208 bits (530), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 182/339 (53%), Gaps = 54/339 (15%)

Query: 157 ILKWREPI--DHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214
           I+KWR+ +     + ++IVS DI S +      HK+S        K K+ +++      W
Sbjct: 309 IIKWRDCLLDPQRTKLSIVSPDIASVI------HKNS--------KRKVAMVFSKDEQFW 354

Query: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRD---E 271
             P+L LPPGIYKLQFLING L HSN+LPTAT+++ NIVNWFEV+  Y   EPYRD   E
Sbjct: 355 VAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDPAPE 414

Query: 272 E------------------RIIHREKSTANESI----SSNSLTDYAGXXXXXXXXXXXXX 309
           E                   ++ R  S+++ +     S+  ++DY G             
Sbjct: 415 EVAMPPESPQLTAPAAGRPPLLKRGTSSSSRARVVERSNTPISDYTGISRSGSARPLLAH 474

Query: 310 XXXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTA-NSNVNNQAFDMSLSKVIDLNQDHVF 368
                            ++Y+ EIPE+FK +    + N    +F+ ++    D NQD +F
Sbjct: 475 HKSANSIELSPIPRC-VLQYSTEIPELFKPEGCPPDPNTAPGSFNENIQ---DCNQDELF 530

Query: 369 ASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNT-------- 420
             LQ+  +M+  EAE   + ++ + DLP+YLNS++LN+IF +   +  T +         
Sbjct: 531 RFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQRSSVTGDVKRSSFTHI 590

Query: 421 VPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           +PHVNLNHLLT+SI+D+ + V CTTRY GKFITQIMYAP
Sbjct: 591 IPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYAP 629

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  206 bits (525), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 184/353 (52%), Gaps = 67/353 (18%)

Query: 157 ILKWREPI--DHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF-KINLLYDIVTNE 213
           IL W++ I       ++IVSKDI STL      HK          KF KI +++D+  N 
Sbjct: 364 ILNWKDNIVDPKTCKMSIVSKDISSTL----NPHK----------KFSKIPMVFDMERNC 409

Query: 214 WYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRD--- 270
           W   +L+LP G+YK QFLING L HS+YLPTAT++ GN VNWFEV+ G+ +IEP RD   
Sbjct: 410 WTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVIS 469

Query: 271 -------EERIIHREKSTANESISSNS-------------------LTDYAGXXXXXXXX 304
                  +++I   + +    ++ S+                     +DY G        
Sbjct: 470 SEDVKLSKDQIAVEQPAPERPALGSDGSSSSNWKGSSRHVERSGTPFSDYTGLCSRSELT 529

Query: 305 XXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFK--FDS------------TANSNVNNQ 350
                                + +YT+EIPE+FK  FD             T + +    
Sbjct: 530 KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPP 589

Query: 351 AFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIF-- 408
           +F   L +V D NQD +FA LQ+  ++++  AE  FL ++   DLP+YL+S+FLN +F  
Sbjct: 590 SF---LHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSG 646

Query: 409 IRDNNNETT--NNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
            +D  +  T  N+ VPHVNLNHLLT+SI+D+ + V CTTRY GKFITQI+Y P
Sbjct: 647 FQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTP 699

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  193 bits (490), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 157/304 (51%), Gaps = 54/304 (17%)

Query: 205 LLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKT 264
           +++D+ +N W  P+L+LP G+YK QFLING L HS +LPTAT++ GN VNWFEV+ G+K 
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 265 IEPYRDEERIIHREKSTANESISSN--------------------------------SLT 292
           IEP RD   +I  + +    +IS+N                                  +
Sbjct: 61  IEPSRD---VISNDFTENQVAISANDPSASPRPPILSGSSSFSNWKNSAKHIERSGTPYS 117

Query: 293 DYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTANSN------ 346
           DY G                               +Y+NEIPE+FK +   +S       
Sbjct: 118 DYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQE 177

Query: 347 -------VNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYL 399
                  V NQ     L +V D NQD +FA LQK   +++  AE  FL ++   DLP+YL
Sbjct: 178 SVPSQNPVKNQP--SFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYL 235

Query: 400 NSNFLNKIFI----RDNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQI 455
           +S+FLN +F     +++     N+ VPHVNLNHLLT+SI+D+ + V CTTRY GKFITQI
Sbjct: 236 DSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQI 295

Query: 456 MYAP 459
           +Y P
Sbjct: 296 IYTP 299

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  205 bits (522), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 182/347 (52%), Gaps = 54/347 (15%)

Query: 157  ILKWREPIDHN----SAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTN 212
            I+K+R+P++ +    + + ++SKDI +TL      H  +     E  K +  L+Y+    
Sbjct: 665  IIKYRDPMEESEIPETKIQLISKDINTTL------HYDTTDLLTENNKME--LVYNKDEK 716

Query: 213  EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEE 272
             W LPNL LPPGIY++QFL+N +L HS++LPTAT+  GNIVNWFEV+ GY  IEP+RDE 
Sbjct: 717  AWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDEN 776

Query: 273  --------------------RIIHREKSTANESISSNSLTDYAGXXXXXXXXXXXXXXXX 312
                                + I   K   N S  S   ++Y G                
Sbjct: 777  ISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTGVSRSNSLSASSSSSVW 836

Query: 313  XXXXXXXXXXXD-DEIKYTNEIPEIFKFDSTANSNVNNQAFDMS--------LSKVIDLN 363
                       + ++++Y+ EIPEIFK  +T  +N +N              L  V+D +
Sbjct: 837  KSVNVNLFTPLEPNKVEYSTEIPEIFK--NTTENNTSNAPMQYHPERKRPGLLHNVVDCS 894

Query: 364  QDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDN----------- 412
            Q+ +F  L     M+T+ AE  FL+++ + +LPIYLNS ++ +I    N           
Sbjct: 895  QEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSL 954

Query: 413  NNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
            NN   N+ +PHVNL HLLT+SI+++ + VACTTRY GKF+TQI+Y P
Sbjct: 955  NNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  193 bits (490), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 182/375 (48%), Gaps = 82/375 (21%)

Query: 158 LKWRE--PIDHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEWY 215
           +KWR+  P+D  + +++VS+DI STL    + H +       R  F   + Y+  T EW 
Sbjct: 443 IKWRDHLPVDGTNRMSMVSEDIASTLSFERQKHGA-------RNTFP--MRYEEETKEWV 493

Query: 216 LPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNW------FEVICGYKT----- 264
           +P+L LP G+Y+LQFLING L HSNYLPTAT++ GN VNW      +E +  Y+      
Sbjct: 494 VPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRDEVELD 553

Query: 265 -----------------------------IEPYRDEERI---IHREKSTANESISSNS-L 291
                                        +EP   +  +   +     ++N  I SN+  
Sbjct: 554 SGQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNRVIRSNTPY 613

Query: 292 TDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTANSNVNNQA 351
           +DY G                             + KY+NEIPE+FK      +N  N+ 
Sbjct: 614 SDYTGISRSSSALRKSPINCTTSSLDLHTALQPKKYKYSNEIPELFKTAPITKANDENED 673

Query: 352 FDMS--------------------LSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFK 391
           F                        ++V+D NQD +F  LQ+   ++ + AE  FL ++ 
Sbjct: 674 FTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELFTELQQGGLLDAETAEQLFLEKYP 733

Query: 392 IHDLPIYLNSNFLNKI---FIRDN----NNETTNNTVPHVNLNHLLTTSIKDDTLCVACT 444
           + DLPIYLNS +LN+I   F ++N     +   N+ +PHVNLNHLLT+SI+D+ + V CT
Sbjct: 734 VPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHIIPHVNLNHLLTSSIRDEMISVGCT 793

Query: 445 TRYVGKFITQIMYAP 459
           TRY GKFITQ++YAP
Sbjct: 794 TRYEGKFITQVIYAP 808

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 175/364 (48%), Gaps = 69/364 (18%)

Query: 157 ILKWREPID--HNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214
            LKWR+ ID   N+ ++IVS +I+S +       ++S             ++Y   T+EW
Sbjct: 397 FLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSD---------SARMVYYPDTSEW 447

Query: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERI 274
               LFLPPGIYKLQF +NG+L HS+YLPTAT+  GNIVNWFEV  GY++IEP+RD +  
Sbjct: 448 VTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDND-Y 506

Query: 275 IHREKSTA-----------------------NESISSNSLTDYAGXXXXXX---XXXXXX 308
           +  E S                         + S  +   +D+AG               
Sbjct: 507 VKNEISGGILQPIPNTLGIPSVSSQLSSFSFHASRPTTPYSDFAGINRSSPLPLREKSPD 566

Query: 309 XXXXXXXXXXXXXXXDDEIKYTNEIPEIFK---FDSTANSNVNNQAFDMSLSK------- 358
                          + +  YT EIPEI+K    D T          D  ++K       
Sbjct: 567 VKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKATETTTDDEDITKPPLYLGT 626

Query: 359 --------VIDLNQDHVFASLQK--IARMNTDEAENYFLNRFKIHDLPIYLNSNFLNK-- 406
                   VI  +Q  +F  L K     +NTDE E  FL ++ I DLPIYLN++++NK  
Sbjct: 627 GGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNKAL 686

Query: 407 ------IFIRDNNNE---TTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMY 457
                 + + D   E     N+ VPHVN+ HLLT +I+D  + VACT RY GKFITQ++Y
Sbjct: 687 EQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQDSVIAVACTVRYGGKFITQVVY 746

Query: 458 APSS 461
           +P S
Sbjct: 747 SPCS 750

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  150 bits (380), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 150/321 (46%), Gaps = 60/321 (18%)

Query: 198 RKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGN------ 251
           RK+ KI ++Y      W   +L LP GIYKL F ING + HSNYLPTAT++  N      
Sbjct: 395 RKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFE 454

Query: 252 IVNWFEVICGYK------------------------TIEPYRDEERIIHREKSTANESI- 286
           +V  ++ I  Y+                        T  P      +I+R  S+++ +  
Sbjct: 455 VVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARV 514

Query: 287 ---SSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDE-IKYTNEIPEIFKFDST 342
              ++  ++DY G                               + Y++++PE+FK    
Sbjct: 515 IERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKV-GN 573

Query: 343 ANSNVNNQAFDMS---------------LSKVIDLNQDHVFASLQKIARMNTDEAENYFL 387
           A++  + Q  D +               +  V D NQD +F  LQ+   MN  EAE  FL
Sbjct: 574 ASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFL 633

Query: 388 NRFKIHDLPIYLNSNFLNKIFIRDNNNETTNN---------TVPHVNLNHLLTTSIKDDT 438
            ++ + DLPIYLNS  LN+IF +   N    +          +PHVNLNHLLT++I+D+ 
Sbjct: 634 EKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEI 693

Query: 439 LCVACTTRYVGKFITQIMYAP 459
           + V CTTRY GKFITQIMYAP
Sbjct: 694 ISVGCTTRYEGKFITQIMYAP 714

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 96/153 (62%), Gaps = 21/153 (13%)

Query: 328 KYTNEIPEIFKFDSTANSNVNNQ------------AFDMS--LSKVIDLNQDHVFASLQK 373
           +Y+NEIPE+FK  +    +  NQ            ++D    L  V+D NQD++F SLQ+
Sbjct: 584 EYSNEIPELFKAGNVLGQSDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQ 643

Query: 374 IARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIR-------DNNNETTNNTVPHVNL 426
              ++ + AE  FL ++ + DLP+YLNS +LNKIF          +N+   N+ +PHVNL
Sbjct: 644 GGLLDAETAEQLFLEKYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSGLNHIIPHVNL 703

Query: 427 NHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           NHLLT+SI+D+ + V CTTRY GKFITQ++YAP
Sbjct: 704 NHLLTSSIRDEMISVGCTTRYEGKFITQVVYAP 736

 Score =  114 bits (286), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (66%), Gaps = 11/117 (9%)

Query: 157 ILKWREPIDHNSA--VAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214
           ILKWR+ I+  S   + I+S DI S L     + KS   TF        ++ YD   N +
Sbjct: 377 ILKWRDQIEDPSKCKITIISTDIASAL-NFDPSDKSFHGTF--------SMKYDEKENNF 427

Query: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE 271
           Y+PNL LPPGIYK QF+ING + HSN LP+AT++ GNIVNWFEVI GY+++EP+R+E
Sbjct: 428 YVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNE 484

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 17/149 (11%)

Query: 328 KYTNEIPEIFKF-------DSTANSNVNNQAFDMSLS---KVIDLNQDHVFASLQKIARM 377
           +Y+N IP +F+        D    +  N +AF    S   +V+D NQD +F  LQK  +M
Sbjct: 586 EYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKM 645

Query: 378 NTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIR-------DNNNETTNNTVPHVNLNHLL 430
           + +EAEN FL ++++ DLP+YLNS +LNKIF            + + N+ +PHVNL HLL
Sbjct: 646 DAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLL 705

Query: 431 TTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           T+SI+D  + VACTTRY GKFITQ++YAP
Sbjct: 706 TSSIRDGIVSVACTTRYAGKFITQVIYAP 734

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 83/123 (67%), Gaps = 5/123 (4%)

Query: 157 ILKWREPIDHNS----AVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF-KINLLYDIVT 211
           ILKWR+  + ++     V +VS +I ++L    K      +   +  +F KI L YD   
Sbjct: 353 ILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHN 412

Query: 212 NEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE 271
           NEWY+P+L+LP GIY+LQFL+NGNL+HS++LPTAT+  GNI+NWFEV+ GY  IEPYRDE
Sbjct: 413 NEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDE 472

Query: 272 ERI 274
             I
Sbjct: 473 SEI 475

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  124 bits (312), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 163/375 (43%), Gaps = 96/375 (25%)

Query: 157 ILKWREPI--DHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214
           +LKWR+ I       ++++S DI            S+++     KK  I + Y+     W
Sbjct: 529 VLKWRDCIVDPKTCKISVISSDI------------SAVLALQSSKK--IPMEYETTEKSW 574

Query: 215 YLPNL---------------------FLP----------------PGIYKLQFLINGNLI 237
           ++PNL                     FLP                PG Y+++ L +  + 
Sbjct: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVD 634

Query: 238 HSNY---LPTATNANGNIVNWFEV--------ICGYKTIEPYRDEERIIHREKSTANESI 286
             NY   L  +   + N  + F +        +    T   YR  + I   E+ST     
Sbjct: 635 SMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYI---ERSTT---- 687

Query: 287 SSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFKF------- 339
                +DY G                             + +Y+ +IPE+FK        
Sbjct: 688 ---PYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNDEEDHD 744

Query: 340 -----DSTANSNV--NNQAFDMSL-SKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFK 391
                D  + S++   ++A   S   +V D NQD +F+ LQ+  R++   AE +FL ++ 
Sbjct: 745 HDIPEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYP 804

Query: 392 IHDLPIYLNSNFLNKIF---IRDNNNETT----NNTVPHVNLNHLLTTSIKDDTLCVACT 444
           + DLPIYLNS++LNK+F    +DNN   T    N  +PHVNLNHLLT+SI+++ + V CT
Sbjct: 805 VPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCT 864

Query: 445 TRYVGKFITQIMYAP 459
           TRY GKFIT ++YAP
Sbjct: 865 TRYEGKFITHVVYAP 879

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  114 bits (284), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 157/342 (45%), Gaps = 74/342 (21%)

Query: 169 AVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLL---YDIVTNEWYLPNLFLPPGI 225
           +V+I+S+DI+             +I F      KI  L   YD +T+EW + +LFLP G 
Sbjct: 330 SVSIISEDIID------------VINFYRSNNDKIKRLPLKYDSLTHEWKISDLFLPAGY 377

Query: 226 YKLQFLIN-GNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYR-----------DEER 273
           Y+  FLIN  ++ HS ++ T  +  G  VN+FEV    +T EP +           D+ R
Sbjct: 378 YEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQLSSALYTVTQADDRR 437

Query: 274 IIHREKSTANESISSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEI 333
            I   K T++E +  N L +Y                              +  KYTN+I
Sbjct: 438 HIECSK-TSSEFL--NLLDNY--------DIRTRYNANFYSHNESGTGNNFNNNKYTNQI 486

Query: 334 PEIFKFDSTANSNVNNQAFDMSLS--------------KVIDLNQDHVFASLQKIARMNT 379
           PE+FKF   +  N+   + +  ++               ++D +Q+ +F SLQ+   +++
Sbjct: 487 PELFKF---SEKNIRELSTETEITFLEPPSYGEPSFYNNIVDCSQEKLFLSLQQNGAVDS 543

Query: 380 DEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNN----------------NETTNNTV-- 421
             AE   L R+ + +LPI+  +  + K+   +NN                NE+ N T   
Sbjct: 544 YVAEQVILQRYPVSELPIFFENISMEKLASHNNNLNKSHTNKHWLEGLTPNESDNITPKE 603

Query: 422 -PHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAPSSP 462
            PHV LNHL+T  I  + + VA TTRY  K+ITQI+Y+P  P
Sbjct: 604 PPHVILNHLVTQKISRNVVSVAVTTRYKQKYITQILYSPIKP 645

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 93/165 (56%), Gaps = 28/165 (16%)

Query: 326 EIKYTNEIPEIFKF---DSTANSNVNNQAFDMSLS--------KVIDLNQDHVFASLQKI 374
           E+ YTNEIP++FK    +   N N     F    S        +VID NQD +FA+ Q+ 
Sbjct: 502 EVTYTNEIPQLFKITDNNCIVNENYERYGFVEPPSYGEPGLENRVIDCNQDILFATFQQN 561

Query: 375 ARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTN---------------N 419
             ++ + AE  FL ++ + DLP++L+S+F  K+F  DNN+ + N                
Sbjct: 562 GAVDVELAEQLFLEKYPVPDLPVFLDSHFSEKLF--DNNDSSKNLNDMNGEDIQIKNNGQ 619

Query: 420 TVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAPSSPTQ 464
            +PHVNLNH+LT  I +  + VACTTRY  KF+T I+Y+PS+ ++
Sbjct: 620 DIPHVNLNHVLTNKISNGMISVACTTRYKRKFVTHILYSPSTHSE 664

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 72/126 (57%), Gaps = 13/126 (10%)

Query: 157 ILKWREPIDHNS---AVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNE 213
           +L+WR+    N    +V+I+S+DI    LT  +   S ++          ++ YD   N 
Sbjct: 313 VLRWRDSYIQNETCKSVSIISEDI----LTSVQAQNSGVLLIS-----NFSMTYDKNENN 363

Query: 214 WYLPNLFLPPGIYKLQFLING-NLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEE 272
           W LP+LFLPPG Y+L+FLI+  +  +SNYLP   +  G I+N  E++ GYK++EP+    
Sbjct: 364 WVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNN 423

Query: 273 RIIHRE 278
            I+ +E
Sbjct: 424 HIMIQE 429

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 110/246 (44%), Gaps = 36/246 (14%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHRE 278
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ EV     T  P    E      
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV-----TAPPDWSNEPQQQAS 261

Query: 279 KSTANESISSNSLTD--YAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEI 336
            + +N +  S S      A                              +++YT +IP +
Sbjct: 262 DNKSNHADDSQSAKRPMSARSRIALEIEKEPDDMGDGYTRFHDEAPPKPDLEYTQDIPAV 321

Query: 337 FKFDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLP 396
           F      + NV  Q + ++L +  + +Q+  + +  ++        EN  LN +      
Sbjct: 322 F-----TDPNVMEQYY-LTLDQQQNNHQNMAWLTPPQLPP----HLENVILNNY------ 365

Query: 397 IYLNSNFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKFIT 453
               SN       + +NNE T+  +P   HV LNHL T+SIK +TLCVA   RY  K++T
Sbjct: 366 ----SN------AQTDNNENTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVT 415

Query: 454 QIMYAP 459
           QI+Y P
Sbjct: 416 QILYTP 421

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 105/244 (43%), Gaps = 55/244 (22%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHRE 278
           L LP G ++ +F+++  L  S+YLPTAT+  GN VN+ E+  G K     R     I  E
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRGQKDTLSARSR---IAME 211

Query: 279 KSTANESISSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFK 338
                + I  N  T +                               +++YT +IP +F 
Sbjct: 212 IENEPDDIG-NGFTRFK-----------------------EEIPLKPQVEYTQDIPAVFT 247

Query: 339 FDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIY 398
                         D S+ +   L  D    + Q +A +       +      + D+P+ 
Sbjct: 248 --------------DPSVMEQYYLTLDQQQHNHQNMAWLTPPTLPPH------LEDVPL- 286

Query: 399 LNSNFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQI 455
              N  N I   D+NNE  +  +P   HV LNHL T+SIK +TLCVA   RY  K++TQI
Sbjct: 287 ---NSYNGI-QGDSNNENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQI 342

Query: 456 MYAP 459
           +YAP
Sbjct: 343 LYAP 346

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 115/247 (46%), Gaps = 37/247 (14%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHRE 278
           L LP G ++ +F+++  L  S+YLPTAT+  GN VN+ EVI       P +++ +   ++
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIA-----PPSQEKPQTKDKQ 241

Query: 279 KSTANES-ISSNSLTD--YAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPE 335
           +   N++ ++    TD   A                               ++YT +IP 
Sbjct: 242 RDNENKNDVARRKTTDPVSARSRIALEIEKEPDEIGNGFTRFREELTLGPSLEYTQDIPA 301

Query: 336 IFKFDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDL 395
           +F      +  V  Q + ++L +  + +Q+  + +  ++        EN  LN       
Sbjct: 302 VF-----TDPTVMEQYY-LTLDQQQNNHQNMAWLTPPQLP----PHLENVPLNS------ 345

Query: 396 PIYLNSNFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKFI 452
             Y NS        ++++NE  +  +P   HV LNHL T+SIK +TLCVA   RY  K++
Sbjct: 346 --YTNS--------QNDSNENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYV 395

Query: 453 TQIMYAP 459
           TQI+YAP
Sbjct: 396 TQILYAP 402

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 106/246 (43%), Gaps = 39/246 (15%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIE-PYRDEERIIHR 277
           L LPPG ++ +F+++  L  S++LPTAT+  GN VN+ E+     T E P     ++  +
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAGTDEKPPPLTPQVSGK 261

Query: 278 EKSTANESISSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIF 337
                 E +S+ S                                 + + +YT +IP +F
Sbjct: 262 SGDERKEPMSARS-------RIALEIEREPDDLGNGYSRFHDTSPLETKYEYTQDIPAVF 314

Query: 338 KFDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPI 397
                 + NV  Q +         L  D    + Q +A +   +             LP 
Sbjct: 315 -----TDPNVMEQYY---------LTLDQQKNNHQNMAWLTPPQ-------------LPP 347

Query: 398 YLNSNFLNKIF-IRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKFIT 453
           +L +  LN     +  +NE  +  +P   HV LNHL T+SIK +TLCVA   RY  K++T
Sbjct: 348 HLENVILNSYSNAQGESNENNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKRKYVT 407

Query: 454 QIMYAP 459
           QI+YAP
Sbjct: 408 QILYAP 413

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 103/246 (41%), Gaps = 39/246 (15%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHRE 278
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ EV     +  P    E   H  
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV-----SAPPDWGNEPQQHLA 258

Query: 279 KSTANE----SISSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIP 334
           +  AN      +S   ++  A                               ++YT +IP
Sbjct: 259 EKKANHVDDSKLSKRPMS--ARSRIALEIEKEPDDMGDGYTRFHDETPAKPNLEYTQDIP 316

Query: 335 EIFKFDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHD 394
            +F      + NV  Q +         L  D    + Q +A +   +             
Sbjct: 317 AVF-----TDPNVMEQYY---------LTLDQQQNNHQNMAWLTPPQ------------- 349

Query: 395 LPIYLNSNFLNKIFIRDNNNETTNNTVP-HVNLNHLLTTSIKDDTLCVACTTRYVGKFIT 453
           LP +L +  LN       +N +    +P HV LNHL T+SIK +TLCVA   RY  K++T
Sbjct: 350 LPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVT 409

Query: 454 QIMYAP 459
           QI+Y P
Sbjct: 410 QILYTP 415

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 105/254 (41%), Gaps = 55/254 (21%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVIC-----------GYKTIEP 267
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ EV             G      
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSSEPQQQGSDNKAN 263

Query: 268 YRDEERIIHREKSTANE-SISSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDE 326
           Y D++++  R  S  +  ++      D  G                              
Sbjct: 264 YADDDKLNKRPMSARSRIALEIEKEPDDMGDGYTRFHDETPAKP---------------N 308

Query: 327 IKYTNEIPEIFKFDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYF 386
           ++YT +IP +F      + NV  Q +         L  D    + Q +A +   +     
Sbjct: 309 LEYTQDIPAVF-----TDPNVMEQYY---------LTLDQQQNNHQNMAWLTPPQ----- 349

Query: 387 LNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNTVP-HVNLNHLLTTSIKDDTLCVACTT 445
                   LP +L +  LN       +N +    +P HV LNHL T+SIK +TLCVA   
Sbjct: 350 --------LPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIV 401

Query: 446 RYVGKFITQIMYAP 459
           RY  K++TQI+Y P
Sbjct: 402 RYKQKYVTQILYTP 415

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 106/243 (43%), Gaps = 33/243 (13%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYK-TIEPYRDEERIIHR 277
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ EV      T EP   ++++   
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWTNEP---QQQVTDN 261

Query: 278 EKSTANESISSNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIF 337
           +   A+++ S+      A                               ++YT +IP +F
Sbjct: 262 KAYHADDNQSTKRPMS-ARSRIALEIEKEPDDMGDGYTRFHDETPSKPNLEYTQDIPAVF 320

Query: 338 KFDSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPI 397
                 + NV  Q +         L  D    + Q +A +   +             LP 
Sbjct: 321 -----TDPNVMEQYY---------LTLDQQQNNHQNMAWLTPPQ-------------LPP 353

Query: 398 YLNSNFLNKIFIRDNNNETTNNTVP-HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIM 456
           +L +  LN       +N +    +P HV LNHL T+SIK +TLCVA   RY  K++TQI+
Sbjct: 354 HLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQIL 413

Query: 457 YAP 459
           Y P
Sbjct: 414 YTP 416

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 118/272 (43%), Gaps = 48/272 (17%)

Query: 194 TFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIV 253
           +F + +K  I L+ D   +  +   L L PG ++ +F+++  L  S++LPTAT+  GN V
Sbjct: 182 SFTKWRKM-IGLIPDSKHSGAFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFV 240

Query: 254 NWFEVICGYKTIEPYR---DEERIIHREKSTANESISSNSLTDYAGXXXXXXXXXXXXXX 310
           N+ EV       EP +   D +R   +E S    +   +S+    G              
Sbjct: 241 NYIEV------REPEKKATDGKRKSKKEYSIQAPTSDRSSIALQIGKDPDDFGDGYTRFH 294

Query: 311 XXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMSLSKVIDLNQDHVFAS 370
                            +YT +IP +F     ++ +V  + +       +D  Q+H   S
Sbjct: 295 EDFSPRPPQ--------EYTADIPAVF-----SDPSVMERYY-----YTLDREQNHNDTS 336

Query: 371 LQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNTVP---HVNLN 427
                 +   + EN  LN++                   +D  NE  +  +P   HV LN
Sbjct: 337 WLTPPLLPP-QLENVILNKY----------------YMTQDQFNENNSGALPIPNHVVLN 379

Query: 428 HLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           HL+T+SIK +TLCVA   RY  K++TQI+YAP
Sbjct: 380 HLITSSIKHNTLCVASIVRYKQKYVTQILYAP 411

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 112/274 (40%), Gaps = 52/274 (18%)

Query: 194 TFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIV 253
           +F + +K  I L+ D   N  +   L L PG ++ +F+++  L  S++LPTAT+  GN V
Sbjct: 182 SFTKWRKM-IGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFV 240

Query: 254 NWFEVICGYKTIEPYRDEERIIHREKSTANESISSNSLTDYAGXXXXXXXXXXXXXXXXX 313
           N+ EV                   EK+  NE I S                         
Sbjct: 241 NYIEV----------------RQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQIGKDPD 284

Query: 314 XXXXXXXXXXDD-----EIKYTNEIPEIFKFDSTANSNVNNQAFDMSLSKVIDLNQDHVF 368
                     +D      ++YT +IP +F      + +V  + +       +D  Q +  
Sbjct: 285 DFGDGYTRFHEDLSPRPPLEYTTDIPAVF-----TDPSVMERYY-----YTLDRQQSNTD 334

Query: 369 ASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIRDNNNETTNNTVP---HVN 425
            S     ++   + EN  LN++                   +D  NE  +  +P   HV 
Sbjct: 335 TSWLTPPQL-PPQLENVILNKY----------------YATQDQFNENNSGALPIPNHVV 377

Query: 426 LNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           LNHL+T+SIK +TLCVA   RY  K++TQI+Y P
Sbjct: 378 LNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTP 411

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 115/300 (38%), Gaps = 72/300 (24%)

Query: 169 AVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKL 228
           +VAI   DI S L    K               +I L ++  ++EW  P+L+LPPG YK 
Sbjct: 88  SVAIQGTDITSKLQRTGKMGGLQ----------QIPLQFEGDSSEWVAPDLYLPPGEYKF 137

Query: 229 QFLINGNL-IHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHREKSTANESIS 287
           +F+IN    +HS YLP  T  +G   N+F VI   + +EP              A+  + 
Sbjct: 138 RFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP-----------AVAADAPMG 186

Query: 288 SNSLTDYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDDEIKYTNEIPEIFKFDSTANSNV 347
            +S                                    ++YTNEI  +F+         
Sbjct: 187 QDS-------------------------------PLGARVEYTNEILPLFE------GYC 209

Query: 348 NNQAFDMS--LSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLN 405
           ++Q  D +        +NQ   F    +     + + +  F  R+ +  +P Y  S    
Sbjct: 210 DSQQIDHTAQYKPKTHMNQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYS---- 265

Query: 406 KIFIRDNNNETTNNTVP--HVNLNHLLTTSIKD---DTLCVACTTRYVGKFITQIMYAPS 460
            I I   +N T    +P    NLN  +  S +D   D LC+ C   Y GK++  + Y PS
Sbjct: 266 -IDITPQDN-TLKVPLPIQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRPS 323

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 5/68 (7%)

Query: 395 LPIYLNSNFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKF 451
           LP +L +  LN    +D +NE T+  +P   HV LNHL+TTSIK +TLCVA   RY  K+
Sbjct: 433 LPPHLENIILNSS--QDTSNENTSGALPIPNHVVLNHLVTTSIKHNTLCVASIIRYKHKY 490

Query: 452 ITQIMYAP 459
           +TQI+YAP
Sbjct: 491 VTQILYAP 498

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           L LP G ++ +F+++  L  S++LPTAT+  GN VN+ EV
Sbjct: 271 LQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 395 LPIYLNSNFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKF 451
           LP +L +  LN      ++NE T+  +P   HV LNHL T+SIK +TLCVA   RY  K+
Sbjct: 364 LPPHLENVILNSYSGSGSDNENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKY 423

Query: 452 ITQIMYAP 459
           +TQI+YAP
Sbjct: 424 VTQILYAP 431

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 33/48 (68%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIE 266
           L LPPG ++ +F+++  L  S++LPTAT+  GN VN+ EV+    T++
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVVAPPTTVD 249

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNKIF-IRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP  L +  LNK +  +D  NE  +  +P   HV LNHL+T+SIK +TLCVA   RY  K
Sbjct: 369 LPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQK 428

Query: 451 FITQIMYAP 459
           ++TQI+Y P
Sbjct: 429 YVTQILYTP 437

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 194 TFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIV 253
           +F + +K  I L+ D   N  +   L L PG ++ +F+++  L  S++LPTAT+  GN V
Sbjct: 208 SFTKWRKM-IGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFV 266

Query: 254 NWFEV 258
           N+ EV
Sbjct: 267 NYIEV 271

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNKIF-IRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP +L +  LN     +  +NE T+  +P   HV LNHL T+SIK +TLCVA   RY  K
Sbjct: 339 LPPHLENVILNSYSNSQGESNENTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYRQK 398

Query: 451 FITQIMYAP 459
           ++TQI+YAP
Sbjct: 399 YVTQILYAP 407

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVIC 260
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ EVI 
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIA 219

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNK-IFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP  L +  LNK    +D  NE  +  +P   HV LNHL+T+SIK +TLCV+   RY  K
Sbjct: 342 LPPQLENVILNKYCTTQDQVNENNSGALPIPNHVVLNHLITSSIKHNTLCVSSIVRYKQK 401

Query: 451 FITQIMYAP 459
           ++TQI+Y P
Sbjct: 402 YVTQILYTP 410

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 194 TFIERKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIV 253
           +F + +K  I L+ D   +  +   L L PG ++ +F+++  L  S++LPTAT+  GN V
Sbjct: 181 SFTKWRKM-IGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFV 239

Query: 254 NWFEV 258
           N+ EV
Sbjct: 240 NYIEV 244

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNKI-FIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP +L    LN      D  +E T+  +P   HV LNHL T+SIK +TLCVA   RY  K
Sbjct: 380 LPPHLEHVILNHYNKSADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSK 439

Query: 451 FITQIMYAP 459
           + TQI+YAP
Sbjct: 440 YATQILYAP 448

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 5/49 (10%)

Query: 217 PNLF-----LPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVIC 260
           P LF     LPPG ++ +F+++  L  S++LPTAT+  GN VN+ E++ 
Sbjct: 210 PGLFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIVA 258

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNKI-FIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP +L    LN      D  +E T+  +P   HV LNHL T+SIK +TLCVA   RY  K
Sbjct: 405 LPPHLEHVILNHYNKSADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKQK 464

Query: 451 FITQIMYAP 459
           + TQI+YAP
Sbjct: 465 YATQILYAP 473

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 203 INLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVIC 260
           I L+ D      +   L LPPG ++ +F+++  L  S++L TAT+  GN VN+ E++ 
Sbjct: 220 IGLVADPARPGVFQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIVS 277

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 12/72 (16%)

Query: 394 DLPIYLNSNFLNKIFIRDNNNETTNN-----TVP-HVNLNHLLTTSIKDDTLCVACTTRY 447
           +LP  L    LN      N NE T+N     T P +V LNHLLT+SIK++ LC+ C+ RY
Sbjct: 322 ELPSQLERCILN------NKNEDTDNGPCELTTPNYVTLNHLLTSSIKNNMLCLGCSVRY 375

Query: 448 VGKFITQIMYAP 459
             K++TQ+ Y P
Sbjct: 376 RQKYVTQVYYTP 387

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERIIHRE 278
           L LP G +K +F+++  L  S++LPTAT+  GN VN+ EV    +T+E  +D +++  R 
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKDIKKMSLRS 252

Query: 279 K 279
           K
Sbjct: 253 K 253

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNKIF-IRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP +L +  LN    ++  +NE  +  +P   HV LNHL T+SIK +TLCVA   RY  K
Sbjct: 353 LPPHLENVILNSYSSLQGESNENNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQK 412

Query: 451 FITQIMYAP 459
           + TQI+YAP
Sbjct: 413 YATQILYAP 421

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVIC 260
           L LPPG +K +F+++  L  S+YLPTAT+  GN VN+ EV+ 
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVVA 233

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 395 LPIYLNSNFLNKIF-IRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGK 450
           LP +L +  LN     +  NNE  +  +P   HV LNHL T+SIK +TLCVA   RY  K
Sbjct: 362 LPPHLENVILNSYSNSQGTNNENNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKRK 421

Query: 451 FITQIMYAP 459
           ++TQI+YAP
Sbjct: 422 YVTQILYAP 430

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 29/40 (72%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 8/71 (11%)

Query: 395 LPIYLNSNFLNKIFIRDNNNETTNN-----TVP-HVNLNHLLTTSIKDDTLCVACTTRYV 448
           LP +L +  LN      N+ ET  N      +P HV LNHL T+SIK +TLCVA   RY 
Sbjct: 365 LPPHLENVILNSY--SSNSPETGQNNSGSLPIPNHVVLNHLATSSIKHNTLCVASIVRYK 422

Query: 449 GKFITQIMYAP 459
            K++TQI+YAP
Sbjct: 423 RKYVTQILYAP 433

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKT 264
           L LPPG +K +F+++  L  S++LPTAT+  GN VN+ E +   +T
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVAPPQT 223

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 397 IYLNSNFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRYVGKFIT 453
           + LN+   N     ++  E  +  +P   HV LNHL T+SIK +TLCVA   RY  K+ T
Sbjct: 436 VILNNYSANSAQAEESGGENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYAT 495

Query: 454 QIMYAP 459
           QI+YAP
Sbjct: 496 QILYAP 501

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVI 259
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ E++
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIV 293

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 7/72 (9%)

Query: 395 LPIYLNSNFLNKIFIR----DNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRY 447
           LP +L +  LN    +    D+ +E  +  +P   HV LNHL T+SIK  TLCVA   RY
Sbjct: 356 LPPHLENVILNNYSSQSEPGDSGSENNSGALPIPNHVVLNHLATSSIKHSTLCVASIVRY 415

Query: 448 VGKFITQIMYAP 459
             K+ TQI+Y+P
Sbjct: 416 KRKYATQILYSP 427

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 5/49 (10%)

Query: 217 PNLF-----LPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVIC 260
           P LF     LPPG ++ +F+++  L  S++LPTAT+  GN VN+ E++ 
Sbjct: 161 PGLFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVS 209

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 29/37 (78%)

Query: 423 HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           HV LNHL T+SIK +TLCVA   RY  K++TQI+YAP
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAP 501

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 29/40 (72%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           L LPPG ++ +F+++  L  S+YLPTAT+  GN VN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 28/37 (75%)

Query: 423 HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           HV LNHL T+SIK +TLCVA   RY  K+ TQI+YAP
Sbjct: 448 HVVLNHLATSSIKHNTLCVASIVRYKRKYATQILYAP 484

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 30/41 (73%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVI 259
           L LPPG ++ +F+++  L  S++LPTAT+  GN VN+ E++
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 281

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 28/37 (75%)

Query: 423 HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           HV LNHL+TTSIK +TLCVA   RY  K+ TQI+Y P
Sbjct: 544 HVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTP 580

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           L LP G ++ +F+++  L  S+YLPTAT+  GN VN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 7/72 (9%)

Query: 395 LPIYLNS----NFLNKIFIRDNNNETTNNTVP---HVNLNHLLTTSIKDDTLCVACTTRY 447
           LP +L +    N+ N      + +E  +  +P   HV LNHL T+SIK +TLCVA   RY
Sbjct: 343 LPPHLENVILNNYSNSSDPGGSGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRY 402

Query: 448 VGKFITQIMYAP 459
             K+ TQI+Y+P
Sbjct: 403 KRKYATQILYSP 414

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           L LPPG ++ +F+++  L  S+YL TAT+  GN VN+ E+
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEI 207

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 395 LPIYLNSNFLNKIFIRDNNNETTNNT----VP-HVNLNHLLTTSIKDDTLCVACTTRYVG 449
           LP  L +  LNK F    +  T NN     +P H  LNHL+TTSIK +TLCVA   RY  
Sbjct: 363 LPPQLENVILNK-FGEPLSQSTENNAGALPIPNHSVLNHLVTTSIKHNTLCVATNNRYRQ 421

Query: 450 KFITQIMYAP 459
           K+++QI Y P
Sbjct: 422 KYVSQIYYVP 431

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           L L PG ++ +F+++  L  S+ LPTAT+  GN VN+ EV
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query: 423 HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           HV L+HL T+SIK +TLCVA   RY  K++TQI+YAP
Sbjct: 386 HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAP 422

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (70%)

Query: 219 LFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVI 259
           L LPPG +K +F+++  L  S++LPTAT+  GN VN+ E +
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 223

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (72%)

Query: 423 HVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459
           HV LNHL+  S+K + L ++ TTRY  KFITQ+ Y+P
Sbjct: 310 HVVLNHLIVNSVKSNMLAISTTTRYKEKFITQVCYSP 346

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 32/46 (69%)

Query: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEV 258
           +W    L LPPG ++ +F+++  L  S+ +P+AT++ GN+VN+ EV
Sbjct: 142 DWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEV 187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,052,370
Number of extensions: 2013194
Number of successful extensions: 7681
Number of sequences better than 10.0: 89
Number of HSP's gapped: 7924
Number of HSP's successfully gapped: 144
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)