Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E025405.475ON65965931170.0
YOR138C (RUP1)5.475ON67166212571e-164
Suva_8.1905.475ON66666012561e-164
Smik_15.3185.475ON67267712381e-161
Skud_15.3025.475ON67866012181e-158
Kpol_543.95.475ON64266611871e-154
TDEL0A033905.475ON62266511681e-152
SAKL0G03564g5.475ON60566810981e-141
KNAG0B040505.475ON67368010821e-138
TPHA0J027805.475ON63166210641e-136
Kwal_55.212675.475ON6046649361e-117
KLTH0F15004g5.475ON5974948691e-107
ZYRO0D11264g5.475ON5476568631e-107
NDAI0C013905.475ON7095428641e-105
TBLA0A025405.475ON6785258551e-104
TBLA0B022305.475ON7907187967e-95
CAGL0I07205g5.475ON6034996957e-82
KLLA0E03169g5.475ON5445125464e-61
NCAS0H022705.475ON696381137e-05
YBR058C (UBP14)3.270ON781118840.18
KAFR0C004103.270ON76938830.25
KNAG0B010703.439ON18586770.60
SAKL0D03322g3.270ON76550790.62
NDAI0A074103.270ON81079790.67
TDEL0D035503.270ON780116771.1
AGR023C3.270ON78039771.4
ZYRO0G06864g8.185ON41838761.4
Skud_2.1773.270ON78239724.7
NDAI0G047401.475ON59973725.0
NCAS0I016203.270ON79539725.2
KNAG0G015808.185ON40636715.5
Suva_2.5725.488ON94486715.9
KLLA0E17513g3.198ON48074715.9
Skud_7.1666.145ON61153716.5
TDEL0A016306.145ON60161707.4
AFR394W5.486ON47246698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E02540
         (659 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...  1205   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   488   e-164
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   488   e-164
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   481   e-161
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   473   e-158
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   461   e-154
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   454   e-152
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   427   e-141
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   421   e-138
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   414   e-136
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   365   e-117
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   339   e-107
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   337   e-107
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   337   e-105
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   333   e-104
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   311   7e-95
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   272   7e-82
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   214   4e-61
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...    48   7e-05
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    37   0.18 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.25 
KNAG0B01070 Chr2 (196562..197119) [558 bp, 185 aa] {ON} Anc_3.439      34   0.60 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    35   0.62 
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    35   0.67 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    34   1.1  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    34   1.4  
ZYRO0G06864g Chr7 complement(548758..550014) [1257 bp, 418 aa] {...    34   1.4  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    32   4.7  
NDAI0G04740 Chr7 (1135051..1136850) [1800 bp, 599 aa] {ON} Anc_1...    32   5.0  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    32   5.2  
KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.1...    32   5.5  
Suva_2.572 Chr2 (1014577..1017411) [2835 bp, 944 aa] {ON} YDR395...    32   5.9  
KLLA0E17513g Chr5 (1555877..1557319) [1443 bp, 480 aa] {ON} simi...    32   5.9  
Skud_7.166 Chr7 complement(305955..307790) [1836 bp, 611 aa] {ON...    32   6.5  
TDEL0A01630 Chr1 (294729..296534) [1806 bp, 601 aa] {ON} Anc_6.1...    32   7.4  
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...    31   8.8  

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score = 1205 bits (3117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/659 (90%), Positives = 598/659 (90%)

Query: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60
           MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF
Sbjct: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60

Query: 61  LEEHTVELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKV 120
           LEEHTVELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKV
Sbjct: 61  LEEHTVELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKV 120

Query: 121 NIPIDXXXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPP 180
           NIPID              NENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPP
Sbjct: 121 NIPIDSQSSSYSSFSTSLSNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPP 180

Query: 181 NSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADETEN 240
           NSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADETEN
Sbjct: 181 NSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADETEN 240

Query: 241 EIVPAAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAE 300
           EIVPAAELTETDH            IAVVNSDLSERAYVSAKIF          KLGDAE
Sbjct: 241 EIVPAAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSKLGDAE 300

Query: 301 HLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEE 360
           HLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEE
Sbjct: 301 HLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEE 360

Query: 361 YDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDESTDDNMTTSA 420
           YDTNLYKMFNVLLIP             QPDNSLNIISPFLTIVFNEMDESTDDNMTTSA
Sbjct: 361 YDTNLYKMFNVLLIPDEDDEESGESDEDQPDNSLNIISPFLTIVFNEMDESTDDNMTTSA 420

Query: 421 SFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGKDILMF 480
           SFQGVDIPFEFYPQLYTKKCKDELIKHI            VILQEINALKSYHGKDILMF
Sbjct: 421 SFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHGKDILMF 480

Query: 481 LNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYP 540
           LNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYP
Sbjct: 481 LNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYP 540

Query: 541 DLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLD 600
           DLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLD
Sbjct: 541 DLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLD 600

Query: 601 KENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHLTS 659
           KENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHLTS
Sbjct: 601 KENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHLTS 659

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  488 bits (1257), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/662 (42%), Positives = 387/662 (58%), Gaps = 50/662 (7%)

Query: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66
           ++ SLLEMGI   VA+DALQ+  GNLEAA+N+IFSN++  ++        + P + E+ +
Sbjct: 6   AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRISENKI 65

Query: 67  ELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIPIDX 126
               +  KP D+     P  G  + D+  +S  D +    ++     +G        +  
Sbjct: 66  V---AGTKPCDV-----PNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRV-- 115

Query: 127 XXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPPNSLIEN 186
                        N +   +SE +   PP YS VQH+E KS++ DPT+VLPLP NSLIE+
Sbjct: 116 ----------TAQNYDRYSISETSIP-PPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIES 164

Query: 187 YLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE--TENEIVP 244
           Y  L+AL  A +F   FLKPDFKDLNYR +W++ SS  EP YR+ + +A++  T +EIV 
Sbjct: 165 YFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVL 224

Query: 245 AAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAEHLNE 304
           A+   E               I+VVN+   ERA+VSAK+F          KL D+EHL E
Sbjct: 225 ASGPNEG--LQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYE 282

Query: 305 VLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTN 364
           VLP FIK+LAVDLE C G +  + + LFISSA + P++NEP  ET+LS FHFLPEEYD+N
Sbjct: 283 VLPAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSN 342

Query: 365 LYKMFNVLLIPXX--------XXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDESTDDNM 416
           LYKMFNVLL P                     +P+N+L  ++P LTI+FNE++ +T+   
Sbjct: 343 LYKMFNVLLYPEEEEEEEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTE--- 399

Query: 417 TTSASF-QGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGK 475
             S S   GVDIP EFYPQLYTK+CKD+LI+HI             +LQEIN LKSY GK
Sbjct: 400 --SVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGK 457

Query: 476 DILMFLNSTIDFLQK---DSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLH 532
           +I   L ST+ +LQ    D+N E+      A+++  L+  +N  +A   +EYK+L+ KLH
Sbjct: 458 NISTILESTLAYLQTIPDDANNEA------AKQIASLKDTLNSARAAKMEEYKDLASKLH 511

Query: 533 NEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTD 592
            EWNLS+P+ HII TAK LGLI+ PY+LT   +SPY YF+R R     W  +QSN LGT+
Sbjct: 512 GEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNGA--WSWIQSNTLGTE 569

Query: 593 FHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKA 652
           F +        V   IK  TK  +E+PLMFIYC+E  I +++ + + ++ N GC  F + 
Sbjct: 570 FKVKKCSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAED 629

Query: 653 DQ 654
           DQ
Sbjct: 630 DQ 631

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  488 bits (1256), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 277/660 (41%), Positives = 380/660 (57%), Gaps = 46/660 (6%)

Query: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66
           ++ SLLEMGI   VA+DALQ+  GNLEAA+N+IFSN++  +     P+ + N        
Sbjct: 6   AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISEN-------- 57

Query: 67  ELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIPIDX 126
                          + P AG    D+   +S D++   +  PD    G     +   D 
Sbjct: 58  --------------RVVPDAGAGAYDVP--NSGDQD---IDMPDVVGGGGDGDGDGYDDL 98

Query: 127 XXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPPNSLIEN 186
                          +   +SE +   PP YS VQH++ KS + DPT+VLPLP NSLIE+
Sbjct: 99  TDDRSGSSSSNGRGPDHYSISETSLP-PPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIES 157

Query: 187 YLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE--TENEIVP 244
           Y  L+AL  + +F   FLKPDF+DLNYR +W++ SS  EP YR+ + ++ +  T +EIV 
Sbjct: 158 YFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVV 217

Query: 245 AAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAEHLNE 304
           A+    +              I+VVN+ + ERA+VSAK+F          KL D+EHL E
Sbjct: 218 AS--GPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYE 275

Query: 305 VLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTN 364
           VLP FIK+LAVDLE C G +  + + LFISSA + P +NEP  ET+LS FHFLPEEYD+N
Sbjct: 276 VLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSN 335

Query: 365 LYKMFNVLLIPXXXXXXXXXX-----XXXQPDNSLNIISPFLTIVFNEMDESTDDNMTTS 419
           LYKMFNVLL P                  +P+N+L  ++P LTI+FNE++ +T+     +
Sbjct: 336 LYKMFNVLLYPEEEEEEGEVVYGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPN 395

Query: 420 ASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGKDILM 479
               GVD+P EFYPQLYTK+CKD+LI+HI             +LQEIN LKSY GK+I  
Sbjct: 396 ----GVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNIST 451

Query: 480 FLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSY 539
            L ST+ +LQ D+        E ++++  L+  +N  +A   +EYK+L+ KLH EWNLS+
Sbjct: 452 ILESTLAYLQADTKDADN---EASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSH 508

Query: 540 PDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFL 599
           P++HII TAK LGLI+ PY+L+  V+SPY YF RDR    +W  +QSN LGT+F I    
Sbjct: 509 PEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRD--GEWSWIQSNTLGTEFKINKCS 566

Query: 600 DKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHLTS 659
               V   I+  TK  +E PLMFIYC+E  I + D++ K +E N GC  F K DQ  L +
Sbjct: 567 SPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNT 626

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  481 bits (1238), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/677 (40%), Positives = 391/677 (57%), Gaps = 69/677 (10%)

Query: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66
           ++ SLLEMGI   VA++ALQ+  GNLEAA+N+IFSN++          P+      E+ V
Sbjct: 6   AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNEL----------PDQGSMSTENNV 55

Query: 67  EL---SDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIP 123
           EL   S+++   G+   V  P  G  + D+  +   D +    ++     +G        
Sbjct: 56  ELPRISENRIMAGNSYDV--PNNGEQDVDMPDVGGVDVDYDDDEDITDDRSGSN------ 107

Query: 124 IDXXXXXXXXXXXXXXNENELRMSENTYNN---------PPEYSTVQHSERKSDIADPTI 174
                           + NE R +   Y++         PP Y+ VQH+E KS + DPT+
Sbjct: 108 ----------------STNEYRRAAQEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTV 151

Query: 175 VLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNK 234
           VLPLP NSLIE+Y  L+AL ++ +F   FLKPDF+DLN+R +W++ +S  EP YR+ + +
Sbjct: 152 VLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYRE 211

Query: 235 ADE--TENEIVPAAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXX 292
           AD+  T ++IV A+    +D             I+VVN+ + ERA+VSAK+F        
Sbjct: 212 ADDGSTTSDIVLAS--GPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQL 269

Query: 293 XXKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLS 352
             KL ++EHL EVLP FIK+LAVDLE C G +  + + LFISSA + P++NEP  ET+LS
Sbjct: 270 KSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLS 329

Query: 353 FFHFLPEEYDTNLYKMFNVLLIP----------XXXXXXXXXXXXXQPDNSLNIISPFLT 402
            FHFLPEEYD+NLYKMFNVLL P                       +P+N+L  ++P LT
Sbjct: 330 LFHFLPEEYDSNLYKMFNVLLYPEEEEEEEEVIRRGGTGQEEERYVEPENTLKEVAPVLT 389

Query: 403 IVFNEMDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVI 462
           I+FNE++ +T+     +    GVD+P EFYPQLYTK+CKD+LI+HI             +
Sbjct: 390 ILFNELETNTESVTLPN----GVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYL 445

Query: 463 LQEINALKSYHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKD 522
           L+EI+ALKSY GK+    L ST+ +LQ+  +  +    E A ++  L+  +N  ++   +
Sbjct: 446 LEEISALKSYQGKNTFTILESTLAYLQESPDDANN---EAASQIASLKDTLNSMRSAKME 502

Query: 523 EYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWC 582
           EYK+L+ KLH EWNLS+P+ HII TAK LGLI+ PY+LT   ISPY YF+R+R  V  W 
Sbjct: 503 EYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGV--WS 560

Query: 583 LVQSNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEE 642
            +QSN LGT+F +        V   I+  TK  +E PLMFIYC+E  I +++ + K ++ 
Sbjct: 561 WIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDS 620

Query: 643 NEGCSSFIKADQLHLTS 659
           N GCS F K DQ  L +
Sbjct: 621 NNGCSKFAKDDQSSLRT 637

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  473 bits (1218), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 269/660 (40%), Positives = 384/660 (58%), Gaps = 41/660 (6%)

Query: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66
           ++ SLLEMGI   VA+DAL +  GNLEAA+N+IFSN++  ++          P + E+ +
Sbjct: 6   AVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRISENRM 65

Query: 67  ELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIPIDX 126
               + +          P +G D++D+     +D   G     D+     TE        
Sbjct: 66  MAGSNSYD--------VPNSG-DQEDI---DMADVAGGEADYDDEDDEDITEN-----HS 108

Query: 127 XXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPPNSLIEN 186
                        + +   +SE +   PP Y+ VQ +E K  + DPT+VLPLP NSLIE+
Sbjct: 109 GSSSSNERGPAARDYDHYSISETSIA-PPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIES 167

Query: 187 YLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE--TENEIVP 244
           Y  L+AL ++ +F   FLKPDF+DLNY  +W++ SS   P YR+ + +AD+    +EIV 
Sbjct: 168 YFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVL 227

Query: 245 AAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAEHLNE 304
           A+    +D             I+V+N+ + ERA+VSA++F          KL D+EHL E
Sbjct: 228 AS--GSSDDLQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYE 285

Query: 305 VLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTN 364
           VLP FIK+LAVDLE C G +  + + LFISSA + P++NEP  ET+LS FHFLPEEYD+N
Sbjct: 286 VLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSN 345

Query: 365 LYKMFNVLLIPXXXXXXXXXXXX----------XQPDNSLNIISPFLTIVFNEMDESTDD 414
           LYKMFNVLL P                       +P+N+L  ++P LTI+FNE++ +T +
Sbjct: 346 LYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNT-E 404

Query: 415 NMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHG 474
           +MT      GVDIP EFYPQLYTK+CKD+LI+H+             +LQEIN LKSY G
Sbjct: 405 SMTLP---NGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQG 461

Query: 475 KDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNE 534
           K+I   L ST+ +LQ   N  +    + A+++  L+  +N  ++   +EYK+L+ K+H E
Sbjct: 462 KNISTVLESTLAYLQASPNDANN---KAARQIASLKDTLNSTRSAKMEEYKDLASKVHGE 518

Query: 535 WNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFH 594
           W+LS+P+ HII+TAK L LI+ PY+LT   +SPY YF+R+R  V  W  VQSN LGT+F 
Sbjct: 519 WDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGV--WSWVQSNALGTEFK 576

Query: 595 ITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQ 654
           I N      V   IK  TK  +E+PLMFIYC+E  I +++++ K ++ N GCS F K D+
Sbjct: 577 IKNCPSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDE 636

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/666 (39%), Positives = 395/666 (59%), Gaps = 52/666 (7%)

Query: 5   ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMES------IQTHPQPNNN 58
           E+S+NSL+EMGI +++AIDAL + +GNLEAA+N+IFSN++  E+      I ++ +  N+
Sbjct: 6   ENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANH 65

Query: 59  PFLEEHTVELSDSK-FKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGET 117
                  VE+S+ + F+PGDL  VI                    +  LQ   Q    + 
Sbjct: 66  -------VEISNKESFQPGDLTEVIA------------------NQQPLQPEFQNYVNDN 100

Query: 118 EKVNIPIDXXXXXXXXXXXXXXNENELRMSENTYNN--PPEYSTVQHSERKSDIADPTIV 175
            + NI  +              + +   ++ +  +N  PP Y  V+HS+ KS + DPT++
Sbjct: 101 SE-NIDSNCYVSDKIVDNMDYYSSDSDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVI 159

Query: 176 LPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKA 235
           LPLPPNS+IENY ALY+L I N+     ++PDFKDL++ ++W++ SS  +P   +K +  
Sbjct: 160 LPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLK-SVT 218

Query: 236 DETENE----IVPAAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXX 291
           DET ++    I P  ++ + D              ++VNS +SERAYV AKIF       
Sbjct: 219 DETTSKSTMKICPIEDMNQDDDQPELLWQLQKLS-SIVNSTMSERAYVCAKIFSVILDQQ 277

Query: 292 XXXKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYL 351
              +L +A+HLNEVLP FIK L V+LESC G +  +I+KLFISSAFY PS ++    T L
Sbjct: 278 SQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLL 337

Query: 352 SFFHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDES 411
           S FHFLP+EYD+NLYKMFNVLL P             +  NSL  ISP L+IVF+E +E 
Sbjct: 338 SLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEG 397

Query: 412 TDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKS 471
           +    +  +  +GV++P EF+PQ+YTK CK++LIKHI             IL +IN++KS
Sbjct: 398 S----SGISLPEGVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKS 453

Query: 472 YHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKL 531
           + GKDIL F+NS++++L++D+ +++     + +EL  ++  +   K    +EY++L+QKL
Sbjct: 454 FQGKDILKFINSSLEYLERDNKSDN-----ITEELLKIKNDMAIVKTQKMNEYRDLAQKL 508

Query: 532 HNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGT 591
            NEWN+S P+ HI++T + LGLI  PYLL   V+SPY Y++R+R    +W LVQ +  G 
Sbjct: 509 QNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYSYYIRER--TGKWNLVQCSTTGG 566

Query: 592 DFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIK 651
           DF +     +  V  TIKQ T+  +E+PLMF+YC+ + I  + +I K  E N GC +F K
Sbjct: 567 DFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFK 626

Query: 652 ADQLHL 657
            DQL L
Sbjct: 627 EDQLVL 632

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  454 bits (1168), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 267/665 (40%), Positives = 372/665 (55%), Gaps = 84/665 (12%)

Query: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66
           ++ SL+EMGISK+VA DAL++ +G++EAA N+IF ND          Q + N     H +
Sbjct: 6   AVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPA-------QISENVEQRAH-I 57

Query: 67  EL---SDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIP 123
           EL   S S F+PGDL+  I+     + +D                               
Sbjct: 58  ELPAGSASGFQPGDLNEYISNAPDTESEDF------------------------------ 87

Query: 124 IDXXXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPPNSL 183
                              E+ + E++    P   +++ S RK  I+DPT+VLPLPPN L
Sbjct: 88  ------------------EEIDVEEDSVETGP---SLECSGRKGQISDPTVVLPLPPNFL 126

Query: 184 IENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKF---NKADETEN 240
            E Y AL+ L +AN+      +PDF DLNY K WYR  S     YR+K+   N +D+ + 
Sbjct: 127 FEGYFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYLSKNGSDDEQI 186

Query: 241 EIVPAAELTETDHXXXXXXX---XXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLG 297
           EIVP  ELT+ D                 +V NS +S+RAYV AK+F           + 
Sbjct: 187 EIVPKDELTQEDGDYTLQSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVEPQVQRNMA 246

Query: 298 DAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQE----TYLSF 353
           +AEHL+EVLP FIK++AVDLE C   + +++++ FISSAF+ PS + P +E    T+LS 
Sbjct: 247 EAEHLHEVLPSFIKSVAVDLEMCPNFQDNEVRECFISSAFHTPSNSAPQEESTMKTWLSL 306

Query: 354 FHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXX-XXQPDNSLNIISPFLTIVFNEMDEST 412
           FHFLPEEY+TNLY+MFN LL                + +NSL+ I+P  TIVF+EM+E+T
Sbjct: 307 FHFLPEEYETNLYRMFNALLFADDSVESDQSDSPDGEGENSLSEIAPVFTIVFDEMEETT 366

Query: 413 DDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSY 472
           +         +GV++P EFYPQLYTK+CKD+LIKHI             ILQEI  LKS+
Sbjct: 367 E----AVPLAEGVEMPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQEITDLKSF 422

Query: 473 HGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLH 532
            GKD+  F+NS++D+LQKD  +      E+ + L DL+ QI  +K    +EYKE++ +L 
Sbjct: 423 QGKDLSKFINSSLDYLQKDEKSP-----ELIKGLLDLKDQITNKKTKKMNEYKEIAHRLQ 477

Query: 533 NEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTD 592
           +EWNLS P++ I++TAK LGLID  YLLT  VISPY Y+ R+R    QW  VQS      
Sbjct: 478 SEWNLSLPEIQIVKTAKELGLIDDSYLLTMAVISPYMYYTRNRDG--QWFFVQSTPYEAS 535

Query: 593 FHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKA 652
           +++        +   IKQ+T+ P+E+PLMFIYCK+ +I   D + K +E N+GC  F K 
Sbjct: 536 YNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLKALENNQGCHRFAKD 595

Query: 653 DQLHL 657
           DQL L
Sbjct: 596 DQLQL 600

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  427 bits (1098), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 267/668 (39%), Positives = 367/668 (54%), Gaps = 90/668 (13%)

Query: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60
           M     S+  LL+MGIS  VA+DAL + +G+LEA++NYIFS ++   +            
Sbjct: 1   MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATT------------ 48

Query: 61  LEEH---TVELSDSK--FKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAG 115
             EH   T + SDS+   KPG L+ VI                         N D     
Sbjct: 49  --EHVDLTQDDSDSENGIKPGMLNDVIP------------------------NTDNVTTV 82

Query: 116 ETEKV--NIPIDXXXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPT 173
           ET +V   IP D                                ST Q    K  + DPT
Sbjct: 83  ETREVENTIPDDVLAPSGIMD-----------------------STTQL--LKDSLNDPT 117

Query: 174 IVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFN 233
           +VLPLPPN+L+ENY AL+ LS+   F   FLKPDF+DLNY + W++     +P YR++F+
Sbjct: 118 VVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YSKPEYRLQFS 176

Query: 234 KADETENEIVPAAELTETDHXXXXXXX--XXXXXIAVVNSDLSERAYVSAKIFXXXXXXX 291
             +     IVP A+LT  D               IAV+NS +S+R +VSAKIF       
Sbjct: 177 SNNNVS--IVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPL 234

Query: 292 XXXKLGDAEHLNEVLPYFIKALAVDLESCY-GDKSSDIKKLFISSAFYKPSQNEPLQETY 350
              KLG  +HL EVLP FIK+LA D+E C   + + DI+ LFIS+A++KPS++E   ET 
Sbjct: 235 VLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETL 294

Query: 351 LSFFHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDE 410
           +S  HFLPEEYDTNLY+MFN LL P                NSL  ++P LT+VF+EMDE
Sbjct: 295 VSLLHFLPEEYDTNLYRMFNTLLYPEEDEDGEEVE------NSLGNLAPMLTVVFDEMDE 348

Query: 411 STDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALK 470
           ST+ N++     QGVD+P +FYPQ+YTK  KD LI H+             ILQ++N LK
Sbjct: 349 STE-NVSLQ---QGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLK 404

Query: 471 SYHGKDILMFLNSTIDFLQKDSNAES-TDHLEVAQELNDLRAQINGRKAGLKDEYKELSQ 529
           S+ GK I  FLNST+DF  KD   ++  D  E+ + L  ++ QI  +K    +EYK +S 
Sbjct: 405 SFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISH 464

Query: 530 KLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGL 589
            +HN+WNLS+PDL+++  AK +GLID PYLLT+ ++SPY Y++R R  +  W  V S   
Sbjct: 465 MIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGI--WYRVISEAN 522

Query: 590 GTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSF 649
           G+D    +  +   VS +IK  T+  +E+PLMF YCKE+ I +++ I K +E+N+G S F
Sbjct: 523 GSDLE-ASITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKF 581

Query: 650 IKADQLHL 657
           +K DQ  L
Sbjct: 582 VKMDQTEL 589

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  421 bits (1082), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 253/680 (37%), Positives = 350/680 (51%), Gaps = 39/680 (5%)

Query: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60
           M  E+ ++ SL EMGI ++VA+DAL++ +GNL AA+NYIFSNDM        PQP  +  
Sbjct: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRES-- 58

Query: 61  LEEHTVELSDSKFKPGDLDTVI--TPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGET- 117
                     S  KPGDLD V+  + R G     L+QL S    + +    D+   G   
Sbjct: 59  ----------SDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTN----DEDTGGNIY 104

Query: 118 --EKVNIPIDXXXXXXXXXXXXXXNENELRMS-ENTYNNPPEYSTVQHSERKSDIADPTI 174
             E  NI +                 +++  S ++   +PPEY   +    +     P  
Sbjct: 105 LDEDDNIEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDS 164

Query: 175 VLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNK 234
                      NYL L+A ++A +  + F++ DFK+LNY  EWY   +I +P   V    
Sbjct: 165 GAAPAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVG 224

Query: 235 ADETENEIVPAAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXX 294
           AD    +IVP  E+T                I+V +S LSER+YVSAK+F          
Sbjct: 225 ADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVES 284

Query: 295 KLGDAEHLNEVLPYFIKALAVDLESCYGDKS-SDIKKLFISSAFYKPSQNEPLQETYLSF 353
            + D++HL E LP FIK++  D E C    S +D+K +F+SSA     Q    +ET+L  
Sbjct: 285 CIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFL 344

Query: 354 FHFLPEEYDTNLYKMFNVLLIPX-------XXXXXXXXXXXXQPDNSLNIISPFLTIVFN 406
           FHF PEEY+ NLYKMFN LL P                    Q + SL  ++P LTI+FN
Sbjct: 345 FHFPPEEYNANLYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFN 404

Query: 407 EMDE---STDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVIL 463
           E D    S     T   S QGV++PF FYPQLYT++ K++++K I              L
Sbjct: 405 EADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCL 464

Query: 464 QEINALKSYHGKDILMFLNSTIDFLQKDSNAEST------DHLEVAQELNDLRAQINGRK 517
             +N LKSY GK    FL    + L       +       +  EV Q++  ++ Q+N  +
Sbjct: 465 ARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEER 524

Query: 518 AGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKK 577
           A LK +Y +LS KL NEWN+S P+  +I  AK LGL+D P+LL+ VV+SPYFY MRD   
Sbjct: 525 AKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSG 584

Query: 578 VDQWCLVQSNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIW 637
              W LVQSN  GTD  IT  + +E V   I+  TK  N++PLMFIYC+E++  SQ++ W
Sbjct: 585 GSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETW 644

Query: 638 KLIEENEGCSSFIKADQLHL 657
             IE+N GCS F KADQL+L
Sbjct: 645 SAIEKNMGCSEFNKADQLYL 664

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  414 bits (1064), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 250/662 (37%), Positives = 369/662 (55%), Gaps = 53/662 (8%)

Query: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60
           MN  ++S+ S+++MGI ++VAIDAL + +G+LEAA+N+IFSN++  ++       N    
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELP-DNNMGESVGNEKYT 59

Query: 61  LEEHTVELSDSKFKPGDLDTVI-TPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEK 119
             EH    +D+ F+ GDL  V+     G D +   +  S D     + +P + V  +   
Sbjct: 60  TSEHVNISNDNNFQAGDLSEVMNVSNYGYDNR--FETDSGDLSSDEVSDP-EIVENDIS- 115

Query: 120 VNIPIDXXXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLP 179
                                 N L++        P Y+ V+H   K+ ++DPT+V+PLP
Sbjct: 116 ----------------------NNLKL--------PAYNIVKHEVEKTSLSDPTVVMPLP 145

Query: 180 PNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADETE 239
            NS+IE+Y  L+++ I+ +     LKPDFKDLNY  EWY       P + +K +  +  +
Sbjct: 146 HNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLK 205

Query: 240 NEIVPAAE-LTETDHXXXXXXX---XXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXK 295
           +++  + E LT  D                  ++NS +SER+YVS+K+F          K
Sbjct: 206 DDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMK 265

Query: 296 LGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFH 355
           L DAEHL EVLP FIK L  +LE C   +  +I+   ISSA+Y PS +EP  +T L+ FH
Sbjct: 266 LQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFH 325

Query: 356 FLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDESTDDN 415
           FLP+EY++NLYKMFN+LL                  NSLN ++P LTI+F+E+DE +   
Sbjct: 326 FLPDEYESNLYKMFNILLY----ADDEDGDGAIDEGNSLNYLAPNLTIIFDEIDELS--- 378

Query: 416 MTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGK 475
            + +   +GV IP EFYPQLYTK+CKD+LIKHI              L+++N+LKS+ GK
Sbjct: 379 -SMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGK 437

Query: 476 DILMFLNSTIDFLQKDS---NAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLH 532
           DIL FLNST+DFL +D    N  +  + ++ + L D++ Q+  +K    + YK+L+QKL+
Sbjct: 438 DILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLN 497

Query: 533 NEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTD 592
             WNLS P++ II TAK LGLID PY L+  V+SP  Y+++ R     W LVQ    G D
Sbjct: 498 TSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGT--WYLVQITENGDD 555

Query: 593 FHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKA 652
           F I        +   ++QYT+  +E+PLMF+Y KE  I   D + K++E N GC  F+K 
Sbjct: 556 FDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKD 615

Query: 653 DQ 654
           DQ
Sbjct: 616 DQ 617

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  365 bits (936), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 239/664 (35%), Positives = 347/664 (52%), Gaps = 87/664 (13%)

Query: 5   ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEH 64
           ES++ SLL+MGI+++VAI+AL K +G++E ++NYIFS ++  +  ++ P           
Sbjct: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKP----------- 51

Query: 65  TVELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEE---GSLQNP----DQTVAGET 117
                    +P   D    P+   D +D   L  ++      G L+ P    D T++ + 
Sbjct: 52  --------LQPLHADAEQGPQKEEDREDSALLEHTEYASVSNGPLEEPERYRDYTLSTQE 103

Query: 118 EKVNIPIDXXXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLP 177
           E  N                                          E K+D  DP +V P
Sbjct: 104 EAAN------------------------------------------EVKNDQEDPLVVKP 121

Query: 178 LPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE 237
              N+L ENY AL+ L++   F   FL PDFKDLNY  +W R   + +P +R+KF   ++
Sbjct: 122 ESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFL-KPQFRIKFETNED 180

Query: 238 TENEIVPAAELTETDHXXXXXXX--XXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXK 295
               IVP   LT  D+              +AV +S  S R  VSA+            K
Sbjct: 181 VT--IVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEK 238

Query: 296 LGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFH 355
           L +AEHL++VLP FI++LA D+E C G +S  IK+LFIS+A+YKP+      ET +S  H
Sbjct: 239 LNNAEHLHDVLPSFIRSLANDVELCPGSQS--IKELFISTAYYKPASEPVPIETLVSLLH 296

Query: 356 FLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDESTDDN 415
           F+PEEYD+N+YKMFN LL P             +  NSL  ++  +TIVF+EMDESTDD 
Sbjct: 297 FMPEEYDSNIYKMFNALLYPNDADDDDDVE---ETQNSLGNLASMITIVFDEMDESTDDI 353

Query: 416 MTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGK 475
                   GV++P +FYPQLYT+  K  LIK +             IL+ +N LKS+ GK
Sbjct: 354 RLP----HGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGK 409

Query: 476 DILMFLNSTIDFLQKDSNA--ESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHN 533
            I  FLNST+DF+ +DS+A  E+    ++   L  ++  ++ +K     EYK +S KL+N
Sbjct: 410 HIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNN 469

Query: 534 EWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDF 593
           +WNLS+P+L II+  + LGLID PY+LTT VISP+ YF+R R    QW  V         
Sbjct: 470 DWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDS--QWYHVLGKQHNDAL 527

Query: 594 HITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKAD 653
           ++    D E V+ TI+  T+  +E+PLMF Y KE+ I + + + + IE+N G +SF + D
Sbjct: 528 NVAK-TDAETVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQD 586

Query: 654 QLHL 657
           Q  L
Sbjct: 587 QSSL 590

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  339 bits (869), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/494 (40%), Positives = 280/494 (56%), Gaps = 22/494 (4%)

Query: 171 DPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRV 230
           DP +V P   N+L ENY AL+ L++   F   FL+PDF+DL Y ++WY+   + +P YRV
Sbjct: 109 DPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQFL-KPAYRV 167

Query: 231 KFNKADETENEIVPAAELTETDHXXXXXXX--XXXXXIAVVNSDLSERAYVSAKIFXXXX 288
           KF   D+    IVP   LT  D+              +AV NS    R YV+A+      
Sbjct: 168 KFENNDDVS--IVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARYLTKVL 225

Query: 289 XXXXXXKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKP-SQNEPLQ 347
                 KL +++HL+E LP FIK+LA D+E C G  S  +K+LFIS+A+YKP S+ EP+ 
Sbjct: 226 EPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAHS--VKELFISTAYYKPVSEPEPI- 282

Query: 348 ETYLSFFHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNE 407
           ET +S  HF+PEEYDTN+YKMFN LL P                NSL  ++P +TIVF+E
Sbjct: 283 ETLVSLLHFMPEEYDTNIYKMFNALLYPDSNEDAEMDDI----QNSLGNLAPMITIVFDE 338

Query: 408 MDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEIN 467
           MDEST+          GVD+P EFYPQLYT++ K+ LIK +             IL+ +N
Sbjct: 339 MDESTEQATLP----HGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSILRNLN 394

Query: 468 ALKSYHGKDILMFLNSTIDFLQKDSNA--ESTDHLEVAQELNDLRAQINGRKAGLKDEYK 525
            LKS+ GK I  FLNS +DF+ KD +   E +   E+   L +++ Q+  +K     +YK
Sbjct: 395 DLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGSKKTEKMAQYK 454

Query: 526 ELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQ 585
            +S +L+NE NLS+P+L IIQ AK LGLID PYLLT+ VIS   YF+R      QW  V 
Sbjct: 455 AVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNN--GQWFHVV 512

Query: 586 SNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEG 645
                    +T   D   VS+ I+ +T+  +ESPLMF Y K + I ++  + + +  N+G
Sbjct: 513 GRSNSEHMDVTK-TDASTVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNKG 571

Query: 646 CSSFIKADQLHLTS 659
              F + DQ H+ +
Sbjct: 572 AKLFAEQDQKHINT 585

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 35/44 (79%)

Query: 5  ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMES 48
          E+++ SLL+MGI++ VAI+AL K +G++E ++NYIFS ++  + 
Sbjct: 3  ENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQG 46

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 232/656 (35%), Positives = 324/656 (49%), Gaps = 117/656 (17%)

Query: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60
           MN ++S    L+EMGI+  VA  ALQ+  GNLEAA+NYIFS ++S +     PQ    P 
Sbjct: 1   MNAQQS----LIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQPVNQPQSAPMP- 55

Query: 61  LEEHTVELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKV 120
                       F PG L  V+T +   DE D    S  +             +G +E V
Sbjct: 56  -----------GFAPGSLSGVMTNQIDDDEDDDSSSSERELSPPLPPRDSPGFSGMSEGV 104

Query: 121 NIPIDXXXXXXXXXXXXXXNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPP 180
            I I                              P+ S V          DPT+V+PL P
Sbjct: 105 EIEIQS----------------------------PKKSLV---------TDPTVVIPL-P 126

Query: 181 NSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADETEN 240
           +SL ENY AL++LS+  +      KP+  DL Y  +W + SS             D + +
Sbjct: 127 HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGSS-------------DPSTS 173

Query: 241 EIVPAAELTETDHXXXXXXXXXXXXIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAE 300
            I     L                  +VVN+  S+R YVSAK+F          KL +AE
Sbjct: 174 FIQQLQRLC-----------------SVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAE 216

Query: 301 HLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEE 360
           HL+EVLP FI++L   LE C       I+ LF+SSA     +      + LS   F+PEE
Sbjct: 217 HLHEVLPSFIRSLIHALEECGCYAEDQIRSLFVSSALSSECK------SLLSVLQFMPEE 270

Query: 361 YDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDESTDDNMTTSA 420
           Y+++LY MFN LL P             +  NSL  ++P LTIVF+EMD  T+       
Sbjct: 271 YESSLYAMFNALLYP-------ELEEGEESGNSLLDLAPVLTIVFDEMDADTE-----VT 318

Query: 421 SFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGKDILMF 480
           S +GVD+P EFYPQLYTK  KD +++ +             +L E+N LKSY GKD L F
Sbjct: 319 SNRGVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKF 378

Query: 481 LNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYP 540
           +NST+D+LQ+D+ ++     E+  +L  L+  I   K   K+EYKELSQKLH EWNLS+P
Sbjct: 379 INSTLDYLQRDNQSK-----EIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHP 433

Query: 541 DLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLD 600
             ++I  A   GLID PYLL  VV+SP  Y  R R    QW +++     TD ++    D
Sbjct: 434 T-YLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRS--GQWKMIR-----TDSNMIRISD 485

Query: 601 --KENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQ 654
                V  TI+Q+T  P+++PLM +Y K ++++    + K +E NEG ++F++ DQ
Sbjct: 486 CAPSQVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQ 541

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  337 bits (864), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 204/542 (37%), Positives = 286/542 (52%), Gaps = 51/542 (9%)

Query: 157 YSTVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKE 216
           Y+ V +++ K+ + DPTI+LP+P NSL+ENYLAL  L+IA      FL+PDFKDLNY  +
Sbjct: 157 YNVVTYTQLKARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYEND 216

Query: 217 WYRSSSIDEPFYRVKFNKADETENEIVPAAELT------------ETDHXXXXXXXXXXX 264
           WY+ +S+  P Y +K     + ++E V     T              D            
Sbjct: 217 WYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQK 276

Query: 265 XIAVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAEHLNEVLPYFIKALAVDLESCYGDK 324
            I+VVNS LSER+Y+S K+F           L + E+L +VLP F K+LA ++E C    
Sbjct: 277 LISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIF 336

Query: 325 SSDI--------------------------KKLFISSAFYKPSQNEPLQETYLSFFHFLP 358
            SDI                          + LF+S+A Y+ +      +T ++   F P
Sbjct: 337 GSDITENDKVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSP 396

Query: 359 EEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQ--PDNSLNIISPFLTIVFNEMDESTDDNM 416
           EEY++NLYKMFN LL P                    L+ I+P  T+VF+ MD +TD+  
Sbjct: 397 EEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVD 456

Query: 417 TTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGKD 476
                  GVD+P EFYPQLYT  C+D L++ +             +LQ+ N L+S+ GKD
Sbjct: 457 LPG----GVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKD 512

Query: 477 ILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWN 536
           I MFL ST+D+L KD  +E+    +  +E+  L   IN  K  + ++YK LS  L    N
Sbjct: 513 ITMFLKSTMDYLTKDCGSET----KALEEMKILETLINNAKNTIMEDYKALSADLQGPLN 568

Query: 537 LSYPDLHIIQTAKTLGLI-DTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHI 595
           +S+P++ II  AK   LI D PYLLT  VISP  YF+R+R+   +W LV+ N + T+F I
Sbjct: 569 VSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQG--KWYLVRFNMISTEFQI 626

Query: 596 TNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQL 655
           T      NV T IKQ T   NE PLMFIYC+++ I     I K +E+N+GC  F K DQ+
Sbjct: 627 TECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQI 686

Query: 656 HL 657
            L
Sbjct: 687 AL 688

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  333 bits (855), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/525 (37%), Positives = 296/525 (56%), Gaps = 33/525 (6%)

Query: 154 PPEYSTVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNY 213
           PP YS   +  +KS   DPT++L L P+ L+ NY  L+++S+A F    F+ PDF +LN+
Sbjct: 160 PPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNF 219

Query: 214 RKEWYRSSSIDEPFYRVKFNK----ADETENEIVPAAELTETDHXXXXX---XXXXXXXI 266
              W +   ID P Y VK+        E   EIV A  L+E +                I
Sbjct: 220 NDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQKVI 279

Query: 267 AVVNSDLSERAYVSAKIFXXXXXXXXXXKLGDAEHLNEVLPYFIKALAVDLESCYGDKSS 326
           +++NS +S RAY+S+ I+          KL +  HL ++LP FI++L  D +       +
Sbjct: 280 SIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLDQN 339

Query: 327 DIKKLFISSAFYK-PSQNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPX--------- 376
            +K +F+S AF++ P   EP + + L  FHFLPEEYD+NLYKMFN LL            
Sbjct: 340 RMKNMFVSKAFHQIPIHKEPTKVS-LFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPRT 398

Query: 377 ----XXXXXXXXXXXXQPDNSLNIISPFLTIVFNEMDESTDDNMTTSASFQGVDIPFEFY 432
                           + ++SL+ IS  LT++F+E+D+ T+  + T     GV+IPFEFY
Sbjct: 399 NQNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTE--LITQPD--GVEIPFEFY 454

Query: 433 PQLYTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGKDILMFLNSTIDFLQKDS 492
           P+LYTKKCK++LI  I             +L ++N+LKS+ GKDIL FLNST+++LQ+D 
Sbjct: 455 PELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQRDG 514

Query: 493 NAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLG 552
                    +  +L+ ++ Q++  K     EYK +S+ L NEWN+  P+L II+ A+ LG
Sbjct: 515 KEGP-----MVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLG 569

Query: 553 LIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLDKENVSTTIKQYT 612
           LI  P+LL   V+SPY YF RDR+  ++W   QS+ +GTDF IT +   + V   IK  T
Sbjct: 570 LIGDPHLLVMAVLSPYLYFFRDRR--NRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNT 627

Query: 613 KVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHL 657
           K  +E+P+MF+YCK++ I +   + +   +N+GCS+F +AD++ L
Sbjct: 628 KSASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSL 672

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 21/27 (77%)

Query: 14 MGISKNVAIDALQKFDGNLEAAINYIF 40
          MGI+K+VA   L K  GNLEAAIN+IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  311 bits (796), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 230/718 (32%), Positives = 353/718 (49%), Gaps = 128/718 (17%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEE 63
           ++  + +L++MGI  +VA +AL+  +GN+EAA+NYIFSN++  ++ Q    P   P ++E
Sbjct: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP---PRIDE 59

Query: 64  H----------------TVELSDSK-FKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSL 106
           +                T+ +S S  F+PGDL+  +T +       ++Q + S     ++
Sbjct: 60  NSDNNTNTNVYNDNTGNTIPISGSNGFQPGDLNKYLTDKNNA----IVQDTDSTSHNATI 115

Query: 107 QNPDQTVAGET---------------EKVNIPIDXXXXXXXXXXXXXXNENELRMSENTY 151
                     T                + +I ID                 EL     + 
Sbjct: 116 NTSFINNTTTTTSNSNSNSNPNTNYMSESDIDIDMMTSSTR----------ELSTDIRSQ 165

Query: 152 NNPPEYSTVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAID-FLKPDFKD 210
           +  P+ S    S  K  I+DPT++LPL  N L+ENYL+L+  S+     +  F    F D
Sbjct: 166 SFKPQASYT--STHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFND 223

Query: 211 LNYRKEWYRSSSIDEPFYRVKFNKADETENEIVPAAELTETDHXXXXXXXXXXXXIAVVN 270
           L Y K+WY  S+          N+   T++  +    +T                 +++N
Sbjct: 224 LMYNKKWYSISN---------NNENTTTDSLFLQLQRVT-----------------SIIN 257

Query: 271 SDLSERAYVSAKIFXXXXXXXXXXKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKK 330
           S +SERA++S K+F           L  ++HLNE+   FI++L   +           K 
Sbjct: 258 SRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPI------FKD 311

Query: 331 LFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQP 390
           + +++A  K SQ   +  + +S  +FLPEEY++NLYKMFN L+ P             Q 
Sbjct: 312 ILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNDDE----QS 367

Query: 391 DNSLNI---------------ISPFLTIVFNEMDESTDDNMTTSASFQGVDIPFEFYPQL 435
           D SL                 ISP  TI+F E DES D + TT    +GV+IP +FYPQL
Sbjct: 368 DESLQTDDDDNDDANDSALEEISPIFTILFEEYDES-DSSSTTLP--EGVEIPLQFYPQL 424

Query: 436 YTKKCKDELIKHIXXXXXXXXXXXXVILQEINALKSYHGKDILMFLNSTIDFLQKDSNAE 495
           Y+KK  D+LIKHI             +L EIN+LKS+ GKDI+  L STID+++KDS  E
Sbjct: 425 YSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRE 484

Query: 496 STDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLID 555
           +    + A  L ++  ++   K    D+YKEL++KLH+EWNLS+P+  II+TAK L LID
Sbjct: 485 T----KSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLID 540

Query: 556 TPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGT---------------DFHITNFLD 600
           +PY L+ V+ SP  Y ++ +  VD W L+    +                 D  +    +
Sbjct: 541 SPYNLSMVIFSPDLYLIK-KANVD-WYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCN 598

Query: 601 KE-NVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHL 657
            E  +   IKQ T+ P+E+PLMFIYCKE+++ ++DD+ K  E N  C+ F+K DQL L
Sbjct: 599 SEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  272 bits (695), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 189/499 (37%), Positives = 268/499 (53%), Gaps = 60/499 (12%)

Query: 172 PTIVLPLP--PNSLIENYLALYALSIANFFAIDFLKPDFKD--LNYRKEWYRSSSIDEPF 227
           PT+V+P P  PN +   Y AL+AL I+      F+K D  D  L +  +W          
Sbjct: 138 PTVVIPAPAVPNHIY--YCALFALFISIHLPHYFVKADHDDMPLLFSPDW---------- 185

Query: 228 YRVKFNKADETENEIVPAAELTETDHXXXXXXXXXXXXIAVVNS-DLSERAYVSAKIFXX 286
               FN  D  E E  P   L +  H            IAV NS D S RA+V++K+F  
Sbjct: 186 ----FNDIDR-EPEDEPLLVLRDQLHKL----------IAVQNSNDHSARAFVTSKMFDV 230

Query: 287 XXXXXXXXK---LGDAE--HLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPS 341
                       L +    HL ++LP FIK +A        + S   K LFISSA     
Sbjct: 231 DLQSVIQSNEPMLTNPNYFHLYQILPSFIKTIA--------NLSYTEKNLFISSAIQGGE 282

Query: 342 QNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLNIISPFL 401
           +    +E+ LS FHFLPEEY++NLYKMFNVLL P               +NSL  ++P +
Sbjct: 283 EASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDDHDIGEDEDEVS-ENSLKELAPVM 341

Query: 402 TIVFNEMDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXXXXXXXXV 461
           TI+FNE  E+ D+N   +    GV++P +FYPQLYTKKCKD+LI H+             
Sbjct: 342 TIIFNEA-ENIDENAPVT---NGVEVPLKFYPQLYTKKCKDQLISHVLSKRKDGRKELKQ 397

Query: 462 ILQEINALKSYHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLK 521
           IL++I  LKSY GKDIL F+NS++D+L KD      D   +A+EL+ L+ ++  +K    
Sbjct: 398 ILKDIGNLKSYQGKDILSFINSSLDYLTKDK-----DDSGIAEELHKLKDELTAKKTEKM 452

Query: 522 DEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQW 581
           + YK++S+K+H EWN+  P+L I++TA  LGLID PY L   V+SP+FYF+R+RK  D+W
Sbjct: 453 NSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLAVVSPFFYFVRNRK--DEW 510

Query: 582 CLVQSNGLGT---DFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWK 638
             V+ N   T      +        V   +K  T VPN +PLMF+Y K++Y+A   ++ +
Sbjct: 511 YEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNSTPLMFVYSKDSYMADDTEMQE 570

Query: 639 LIEENEGCSSFIKADQLHL 657
           L+ +N+    F K DQ++L
Sbjct: 571 LLSQNKTLLDFFKQDQIYL 589

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 32/37 (86%)

Query: 5  ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFS 41
          E ++ SLLEMGI+++VA  AL++ +G++EAA+NYIF+
Sbjct: 4  EGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFN 40

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 147/512 (28%), Positives = 256/512 (50%), Gaps = 33/512 (6%)

Query: 158 STVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEW 217
           +T++H  +K D +    +LP   ++L+E+Y  L+AL +A      FL  DFK+L Y   W
Sbjct: 41  TTIEHWWKK-DPSQLVGILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHW 99

Query: 218 YRSSSIDEPFYRVKFNKADETENEIVPAAELTETDHXXXXXXX--XXXXXIAVVNSDLSE 275
           ++   +   +  V  N        ++   ELT +++              I + N   S 
Sbjct: 100 FKGELVQSDYRLVHRNAGPL----LIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESM 155

Query: 276 RAYVSAKIFXXXXXXXXXXKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISS 335
           R +V++++            L + +HL+EV P FIK L  D++ C  D  S   KLF+S 
Sbjct: 156 RRFVASELINKGTDFNVSRALSECDHLSEVFPQFIKNLHNDMDLCLKDDKS-TSKLFLSK 214

Query: 336 AFYKPSQNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPXXXXXXXXXXXXXQPDNSLN 395
           A ++P+  EP Q T LS  +F PE Y   LY+MFN +L+P             + +N+ +
Sbjct: 215 ALHRPNVLEPFQPTSLSVLNFSPENYAYTLYEMFNPMLLPEDSGRGY------EIENAFD 268

Query: 396 IISPFLTIVFNEMDESTDD-NMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHIXXXXXX 454
            ++P  TI+F++MD++T++ N++      GV IP EFYPQLYTK   ++++  +      
Sbjct: 269 FLAPVFTIIFDDMDDTTEEVNLS-----HGVQIPIEFYPQLYTKNALEKVVVPVLEETDA 323

Query: 455 XXXXXXVILQEINALKSYHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQIN 514
                 + + ++++L+S+ GK I  FLNS+I++L++    +     E+   L  ++ Q++
Sbjct: 324 LRNTNKLKVDQMSSLQSFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLS 383

Query: 515 GRKAGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRD 574
            +K  +  +Y E +Q+  +  +   P   II  AK +G+ID PYLL  VV SP  Y +  
Sbjct: 384 NKKREMMADYTE-TQRQIDLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIAR 442

Query: 575 RKKVDQWCLVQSNGLGTDFHITNFLDKENVSTT------------IKQYTKVPNESPLMF 622
               D        G     +I N ++  + S T             K +T+  +E+P++F
Sbjct: 443 GISADDGNTGMETGNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILF 502

Query: 623 IYCKENYIASQDDIWKLIEENEGCSSFIKADQ 654
           +Y K+++I +  DI   I ENE  ++F+K + 
Sbjct: 503 VYIKKDHIDAPQDILASISENETLTNFLKEEH 534

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa]
          {ON} Anc_5.475 YOR138C
          Length = 696

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 30/38 (78%)

Query: 7  SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDM 44
          ++ +LLEMGI + VA+DAL +  GNLE A+ +IFSN++
Sbjct: 6  TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNEL 43

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 7/118 (5%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEE 63
           +E SL S+L MG++ N+   AL   +G++  ++ ++F+N   M+   T P+P      ++
Sbjct: 651 DEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFNN---MDDDGTFPEPEVPNEEQQ 707

Query: 64  HTVELSDSKFKPGDLDTVITPRA----GGDEKDLIQLSSSDEEEGSLQNPDQTVAGET 117
              +L  S  KP  L  VI  +      G     I+   +D+ +  L N ++ VA ++
Sbjct: 708 QKKDLGYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADS 765

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 29/38 (76%)

Query: 5   ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSN 42
           E SLNS++ MG+++N++  AL   +G++ A+I ++F+N
Sbjct: 642 EESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNN 679

>KNAG0B01070 Chr2 (196562..197119) [558 bp, 185 aa] {ON} Anc_3.439
          Length = 185

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 176 LPLPPNSLIENYLAL-----YALSIANFFAIDFLKPDFKDLNYRKEWYRSSSID--EPFY 228
           L L P  L++  L L      AL + N FA+ FL+PD+K +   K + + + +    PF 
Sbjct: 43  LSLNPKPLLQFNLQLPSHTSRALRMHNLFAVHFLRPDYKSIELAKRFSQGTRVGGTHPFL 102

Query: 229 RVK-------FNKADETENEIVPAAE 247
            +K       F  ++E E  ++  AE
Sbjct: 103 GLKKLKDYSLFLGSEEIELPLLKHAE 128

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 5/50 (10%)

Query: 5   ESSLNSLLEMGISKNVAIDAL-QKFDGNLEAAINYIFSN----DMSMESI 49
           ESS+N L+EMG +KN A  +L    +G  E A++++F +    D++ME +
Sbjct: 573 ESSVNQLIEMGFTKNAATRSLFNTGNGQAETAMDWLFQHMDDPDLNMEFV 622

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 15/79 (18%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSN---DMSMESIQTHPQPNNNPF 60
           ++SSL ++L MG+   ++  AL  + G++ A+  ++F+N   D  +ES+           
Sbjct: 677 DQSSLQTMLAMGLDAKLSRKALTIYSGDVAASTEWVFNNLDDDGELESVH---------- 726

Query: 61  LEEHTVELSDSKFKPGDLD 79
             E   E ++   +PG+LD
Sbjct: 727 --EEVEERTEGGSEPGNLD 743

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEE 63
           ++ +++S+  MG+   +   AL   +G++ ++++++F+N   M+     PQ +  P  + 
Sbjct: 649 DQEAISSMTAMGLDAKLCKKALILNNGDVTSSVDWVFNN---MDDDGELPQKDTQP-AKS 704

Query: 64  HTVELSDSKFKPGDLDTVITPRA----GGDEKDLIQLSSSDEEEGSLQNPDQTVAG 115
           HT  L  S   P  L  V+  +      G     I+ S   EE+  L N ++ V  
Sbjct: 705 HTANLGHSSASPYKLVAVVCHKGNSAHSGHYVAFIRKSVEQEEKWVLYNDEKIVVA 760

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 2   NGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIF 40
           N +E  + S++ MG SKN A+ AL      +E A+N+IF
Sbjct: 582 NPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIF 620

>ZYRO0G06864g Chr7 complement(548758..550014) [1257 bp, 418 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 418

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFS 41
           +ES++  L ++G S++ AI+AL + DGN E A + +F 
Sbjct: 381 DESNIKQLTDLGFSRSEAINALDQTDGNAELAASLLFG 418

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 27/39 (69%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSN 42
           +E+SL S+L MG++ N+   AL   +G++  ++ +IF+N
Sbjct: 651 DETSLTSILSMGLNPNLCRKALILNNGDVNRSVEWIFNN 689

>NDAI0G04740 Chr7 (1135051..1136850) [1800 bp, 599 aa] {ON}
           Anc_1.475 YJR046W
          Length = 599

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query: 3   GEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPN------ 56
             +SSL+SL+      N A D  Q+FD N    ++   +ND+SME    + +P+      
Sbjct: 45  ANKSSLDSLISHLNDSNNAPDTKQQFDANFTGTLS--INNDISMEQYIYNSEPDLQFNRT 102

Query: 57  -NNPFLEEHTVEL 68
            NNP+L++ +  L
Sbjct: 103 VNNPYLQKLSSRL 115

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 30/39 (76%)

Query: 4   EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSN 42
           ++ SL+++++MG+++ ++I AL    G++ A+I ++F+N
Sbjct: 666 DQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNN 704

>KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.185
           YER143W
          Length = 406

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%)

Query: 5   ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIF 40
           E+++N L+++G ++   I AL    GN E A +Y+F
Sbjct: 370 EAAINQLMDLGFTRTEVIKALDMTGGNAELAASYLF 405

>Suva_2.572 Chr2 (1014577..1017411) [2835 bp, 944 aa] {ON} YDR395W
           (REAL)
          Length = 944

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 298 DAEHLNEVL----------PYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQ 347
           D EH+ ++L          P F KA+ V      G  S  I KL +++ F KP +   + 
Sbjct: 733 DIEHVMQILMYFALSMRDIPLFSKAIKVSTNDELGLDSKCIVKLGLANLFAKPIETLQIM 792

Query: 348 ETYLSFFHFLPEEYDTNLYKMFNVLL 373
           ET     +F    ++ N Y +F + L
Sbjct: 793 ETEGFTINFFSNWFNENFYSVFTIKL 818

>KLLA0E17513g Chr5 (1555877..1557319) [1443 bp, 480 aa] {ON} similar
           to uniprot|P25301 Saccharomyces cerevisiae YDR004W RAD57
           Protein that stimulates strand exchange by stabilizing
           the binding of Rad51p to single-stranded DNA involved in
           the recombinational repair of double-strand breaks in
           DNA during vegetative growth and meiosis forms
           heterodimer with Rad55p
          Length = 480

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 19/74 (25%)

Query: 181 NSLIENYLAL-----YALSIANFFAIDFL--KP---DFKDLNYRKEW---YRSSSIDEPF 227
           +S+ EN L+L      A+ +AN  +   L  KP   DFKD +Y+  W   +++S+I   F
Sbjct: 243 DSMAENLLSLAQKHNLAIVVANQVSDKLLPEKPIRQDFKDYDYQLGWNIGWKNSTI---F 299

Query: 228 YRVKFN---KADET 238
           YR KFN   K DET
Sbjct: 300 YRHKFNEIEKYDET 313

>Skud_7.166 Chr7 complement(305955..307790) [1836 bp, 611 aa] {ON}
           YGL110C (REAL)
          Length = 611

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 4   EESSLNSLLEM--GISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQ 54
           +E  L+SL+E+    SKN  + AL  +D N+E   N IF +   +E+    P+
Sbjct: 317 DEEQLSSLMELFPQFSKNQLLQALLAYDNNIELVTNKIFEDSTIIEAFAKEPE 369

>TDEL0A01630 Chr1 (294729..296534) [1806 bp, 601 aa] {ON} Anc_6.145
           YGL110C
          Length = 601

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 10  SLLEMG-----ISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEH 64
           SL+ MG     +SK+     LQKF+GN E A N +F +   +++I         P  +E 
Sbjct: 311 SLVAMGELLPSLSKDQLTHLLQKFEGNAELATNAVFEDPTLIDAIAREISTEGRPSTDEE 370

Query: 65  T 65
           +
Sbjct: 371 S 371

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 513 INGRKAGLKDEYKELSQ-----KLHNEWNLSYPDLHIIQTAKTLGL 553
           +N R AG ++  +  SQ      LHN  +LSYPDL +  T + LG+
Sbjct: 4   VNLRSAGWQNPKENESQLVSIEHLHNTGHLSYPDLWVKHTMEELGI 49

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,457,256
Number of extensions: 3087726
Number of successful extensions: 8316
Number of sequences better than 10.0: 57
Number of HSP's gapped: 8420
Number of HSP's successfully gapped: 68
Length of query: 659
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 543
Effective length of database: 40,180,143
Effective search space: 21817817649
Effective search space used: 21817817649
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)