Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0E020205.122ON56456430260.0
CAGL0M07920g5.122ON56456427110.0
KAFR0E01520singletonON56356326460.0
Smik_12.1065.122ON56356326250.0
YLR044C (PDC1)5.122ON56356326230.0
Suva_10.1285.122ON56356326140.0
TDEL0E050805.122ON56356226100.0
NCAS0D016605.122ON56456426060.0
Skud_12.1105.122ON56356326050.0
NDAI0C031105.122ON56456425930.0
NDAI0A01400na 1ON56356225190.0
KLLA0E16303g5.122ON56356225150.0
SAKL0G14894g5.122ON56456425140.0
Kpol_1010.485.122ON56356325100.0
Suva_10.227na 2ON56356325080.0
ACL134C5.122ON58656425050.0
SAKL0G10164gna 3ON56456425000.0
TBLA0B075205.122ON56356324960.0
NCAS0A14630na 1ON56356224900.0
TPHA0H009505.122ON56356324850.0
TPHA0Q00120singletonON56356324810.0
Smik_12.197na 2ON56356324790.0
ZYRO0F01606g5.122ON56356324770.0
KNAG0M012505.122ON56356324750.0
Skud_12.203na 2ON56356324740.0
YLR134W (PDC5)na 2ON56356324730.0
Ecym_24795.122ON56456424650.0
KLTH0B01188g5.122ON59356224630.0
YGR087C (PDC6)na 4ON56356324290.0
AAL073Wna 3ON56356224240.0
Kwal_33.155405.122ON56456224140.0
TBLA0B10060singletonON56456424070.0
Suva_7.369na 4ON56356324070.0
SAKL0F04334gsingletonON56456323960.0
NDAI0A02510singletonON56356323810.0
TBLA0E03070singletonON56356323600.0
TBLA0D02840singletonON56356323570.0
KNAG0J01330singletonON56456423310.0
NCAS0A14240singletonON56556423220.0
KNAG0J01340singletonON56556223000.0
NDAI0D03270singletonON52152122700.0
KLTH0D08272gsingletonON56356222360.0
CAGL0G02937gna 4ON56456821570.0
Ecym_3185na 3ON56356320670.0
SAKL0E04972g2.390ON61155018970.0
KLTH0E09702g2.390ON60755116670.0
YDL080C (THI3)2.390ON60955616570.0
ZYRO0A08426g2.390ON58454916530.0
Suva_4.1672.390ON62055616550.0
Kwal_47.178782.390ON61055116450.0
TDEL0G032102.390ON60656716070.0
Skud_4.1752.390ON62055616070.0
Smik_4.1562.390ON62155616050.0
KNAG0A059002.390ON62055815950.0
TPHA0G026202.390ON68859315840.0
KAFR0F029902.390ON60855915670.0
CAGL0L06842g2.390ON63857115590.0
NCAS0A040002.390ON62556915520.0
TBLA0B088202.390ON63559015320.0
NDAI0E017002.390ON62156615230.0
Ecym_60552.390ON59256213810.0
ADR254W2.390ON58155513291e-178
Kpol_1046.92.390ON59856411711e-154
KLLA0F16962g2.390ON5785559231e-117
NCAS0A118305.456ON6376128731e-109
CAGL0A03102g5.456ON6496178671e-108
Kpol_1062.125.456ON6305918651e-108
SAKL0G03036g5.456ON6376008651e-107
Suva_2.5545.456ON6356158631e-107
YDR380W (ARO10)5.456ON6356008581e-106
Skud_4.6515.456ON6356038551e-106
Smik_4.6495.456ON6356028541e-106
ACR211W5.456ON6295968391e-104
KLTH0F15510g5.456ON6255998351e-103
ZYRO0G04378g5.456ON6136128181e-101
KAFR0E037305.456ON6356148121e-100
TPHA0J026805.456ON6486268093e-99
TBLA0A026705.456ON6406078066e-99
TBLA0A064205.456ON6386097735e-94
TDEL0D024505.456ON6756067756e-94
KLLA0E02707g5.456ON6316007716e-94
Kpol_440.45.456ON6366057718e-94
KNAG0C047905.456ON6376147604e-92
TPHA0E016005.456ON6515977422e-89
SAKL0D00220gsingletonON5775737206e-87
KLTH0D00418gsingletonON5615656779e-81
TDEL0C07020singletonON5605676612e-78
TDEL0F00150singletonON5605676593e-78
NDAI0A044505.456ON5615606202e-72
Skud_7.383na 4ON86922162e-20
NDAI0H023802.441ON6855642125e-17
YMR108W (ILV2)2.441ON6875882101e-16
CAGL0K03465g2.441ON6775772054e-16
ZYRO0E03454g1.450ON5494982028e-16
KAFR0A005702.441ON6825162028e-16
Kwal_26.75822.441ON6795812002e-15
Smik_13.2972.441ON6875881956e-15
SAKL0E03740g2.441ON6795191931e-14
NCAS0F015002.441ON6845821922e-14
Kpol_297.122.441ON6715131922e-14
TBLA0I014002.441ON7105791912e-14
KNAG0E023602.441ON6935581903e-14
KLLA0B12584g2.441ON6915711884e-14
Suva_13.2872.441ON6875811851e-13
TDEL0A021602.441ON6825841842e-13
Skud_13.2672.441ON6875941832e-13
Ecym_61072.441ON6895151832e-13
TPHA0G024402.441ON6915441813e-13
NCAS0A043202.441ON6895221814e-13
TDEL0B055201.450ON5555291787e-13
KNAG0A062502.441ON6805221779e-13
KLTH0D04532g2.441ON6785991752e-12
AEL305C2.441ON6685161742e-12
NCAS0G039601.450ON5775071714e-12
Smik_5.871.450ON5605371671e-11
ZYRO0G19954g2.441ON7005221681e-11
NDAI0E020502.441ON6905711617e-11
Skud_5.761.450ON5605361601e-10
YEL020C1.450ON5605401591e-10
TPHA0G028852.441ON6885141582e-10
AEL055C1.450ON5454791502e-09
Ecym_13601.450ON5444881448e-09
TPHA0B039401.450ON5755191441e-08
KLTH0H14102g1.450ON5515021431e-08
Suva_5.681.450ON5615411403e-08
SAKL0D10934g1.450ON5503371332e-07
Kwal_34.161161.450ON5534951271e-06
Kpol_1061.501.450ON5715041261e-06
KNAG0H015801.450ON5602711153e-05
KAFR0H028901.450ON560343940.008
CAGL0M03245g1.450ON56256800.44
Smik_10.1671.295ON122944752.0
Suva_6.1491.295ON123044742.1
YJL074C (SMC3)1.295ON123044742.2
NDAI0G005201.450ON575340733.0
NDAI0G056301.295ON122944733.2
TBLA0C015601.450ON58256714.3
Skud_10.1701.295ON123044724.6
Skud_4.7355.580ON321117704.8
NCAS0B07970na 5ON205124695.0
ZYRO0G21296g1.295ON122744715.5
TDEL0D016201.295ON122344715.6
TBLA0C027401.295ON111944715.8
KNAG0B052301.295ON122544706.6
Kpol_1018.21.295ON121144707.5
TPHA0I010901.295ON121644699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0E02020
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...  1170   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...  1048   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...  1023   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...  1015   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...  1014   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...  1011   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...  1009   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...  1008   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...  1008   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122   1003   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              974   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   973   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   972   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   971   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   970   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   969   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   967   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   966   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   963   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   961   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      960   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   959   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   958   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   957   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   957   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   957   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   954   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   953   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   940   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   938   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   934   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   931   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   931   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   927   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   921   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              913   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   912   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   902   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            899   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   890   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              879   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   865   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   835   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   800   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   735   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   646   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   642   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   641   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   642   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   638   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   623   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   623   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   622   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   619   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   614   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   608   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   605   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   602   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   594   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    591   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   536   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   516   e-178
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   455   e-154
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   360   e-117
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   340   e-109
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   338   e-108
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   337   e-108
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   337   e-107
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   337   e-107
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   335   e-106
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   333   e-106
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   333   e-106
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   327   e-104
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   326   e-103
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   319   e-101
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   317   e-100
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   316   3e-99
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   315   6e-99
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   302   5e-94
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   303   6e-94
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   301   6e-94
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   301   8e-94
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   297   4e-92
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   290   2e-89
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   281   6e-87
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   265   9e-81
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   259   2e-78
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                258   3e-78
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   243   2e-72
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    88   2e-20
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     86   5e-17
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    86   1e-16
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    84   4e-16
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    82   8e-16
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    82   8e-16
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    82   2e-15
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    80   6e-15
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    79   1e-14
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    79   2e-14
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    79   2e-14
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    78   2e-14
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    78   3e-14
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    77   4e-14
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    76   1e-13
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    75   2e-13
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    75   2e-13
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    75   2e-13
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    74   3e-13
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    74   4e-13
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    73   7e-13
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    73   9e-13
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    72   2e-12
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    72   2e-12
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    70   4e-12
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    69   1e-11
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    69   1e-11
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    67   7e-11
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    66   1e-10
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    66   1e-10
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     65   2e-10
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    62   2e-09
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    60   8e-09
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    60   1e-08
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    60   1e-08
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    59   3e-08
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    56   2e-07
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    54   1e-06
Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON} (1417...    53   1e-06
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    49   3e-05
KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {O...    41   0.008
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    35   0.44 
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    33   2.0  
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    33   2.1  
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    33   2.2  
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    33   3.0  
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    33   3.2  
TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.4...    32   4.3  
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    32   4.6  
Skud_4.735 Chr4 (1303900..1304865) [966 bp, 321 aa] {ON} YDR460W...    32   4.8  
NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {...    31   5.0  
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    32   5.5  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    32   5.6  
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    32   5.8  
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    32   6.6  
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    32   7.5  
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    31   9.2  

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score = 1170 bits (3026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/564 (100%), Positives = 564/564 (100%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLVQQAKITAATNAKQD
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQD 564

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/564 (90%), Positives = 536/564 (95%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QVDVKTIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPND EAE EVVDT+L LIK AKNPVIL+DACASRHDVKAETK+LIDATQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDY KIRNATFPGVQMKF L+KLL +V +A KGYKPV VPARVPENK+CD
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P+TPL QEWMWNQ +KF QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGEKAGYNDIQNW HL LL TFGAKDYENHRVATTGEWD L  DKEFNKNS+IRMIEVML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAP++L++QAK+TA+ NAKQ+
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQE 564

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/563 (86%), Positives = 535/563 (95%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL+QVDVKTIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTA++TDIATA AEIDRCI+TTY+TQRPVYLG+PAN+ D K+PAKL
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPND EAE EV+D ILSL+K AKNPVILSDACASRH+V+ ET+QLIDATQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFTTPMGKGSIDEQHPR+GGVYVGTLSRPEVK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSDYTKI+NATFPGVQMKFVL+KL   +    KGYKP+ VPA+VP NK C 
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PSTPL+QEWMWNQ +KFFQEGD+IITETGT+AFGINQS FP ++VGISQVLWGSIGFTGG
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           AVLGAAFAAEE+D  +RVILFIGDGSLQLTVQEISTMIRWNL+PYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN+IQNWKHL LLETFGAKDYENHR+ATTGEWDAL+ +K+FNKNSRIR+IE+ML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNLVQQAKITAATNA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/563 (88%), Positives = 521/563 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPID+SLK NDAE+EKEV+DTILSL+KDAKNPVIL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL  +ADAAKGYKPVAVPA  P N A  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEWMWNQ   F QEGDV+I ETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG KA YN+IQNW HL LL TFGAKDYE HRVATTGEWD L  DK FN NS+IRMIEVML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QAK+TAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/563 (87%), Positives = 523/563 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPID+SLKPNDAE+EKEV+DTIL+L+KDAKNPVIL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL ++ADAAKGYKPVAVPAR P N A  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEWMWNQ   F QEGDV+I ETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG KA YN+IQ W HL LL TFGAKDYE HRVATTGEWD L  DK FN NS+IRMIE+ML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QAK+TAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/563 (87%), Positives = 524/563 (93%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPID+SLKPNDAE+EKEV+DTIL+L+KDAKNP+IL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE+HPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL +VADAAKGYKPVAVPA  P N A  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEWMWNQ  +F QEGDV+I ETGTSAFGINQ  FPNN+ GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG KA YN+IQNW HL LL TFGAKDYE HRVATTGEWD L  DK FN+NS+IRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QAK+TAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/562 (85%), Positives = 515/562 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QVD  TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLK NDAEAE+EVVD +L+LIK AKNPVIL+DAC SRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQ+PRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDY KIRNATFPGVQMKF L+KLLA V D AK YKPV VPAR PEN A  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL Q+W+WNQ  KF QEGDV+ITETGTSAFGINQS FPN + GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGEKA YNDIQ WK+L LL TFGAKDYE HRV+TTGEW+ L  D EFNKNS+IRMIEVML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
           PVMDAPS+LV QA++TA+ NAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/564 (86%), Positives = 524/564 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL Q+DVKTIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLK NDAEAE EV++TIL L+K AKNP+IL+DACASRHDVKAET++LID TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSDY KI+NATFPGVQMKFVL+KLL  +A AAKGYKPVAVPA+   N A  
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEW+WNQ  KF QEGDV+I+ETGTSAFGINQ+ FPNN+ GISQVLWGSIGF  G
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RWNLKPYLFVLNNDGYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGEKA YNDIQNW+HL LL TFGAKDYENHRV+TTGEWD L  +KEFN+N+RIRMIE+ML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV QAK+TA+ NAKQD
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQD 564

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/563 (86%), Positives = 521/563 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+E+TLGKYLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPID+SLKPNDAE+EKEV+DTI++L+KDAKNPVIL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPR+GGVYVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL ++ADAAKGYKPVAVPA  P N A  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEWMWNQ   F QEGDV+I ETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLF+LNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG KA YN+IQNW HL LL TFGAKDYE HRVATTGEWD L  DK FN NS+IRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QAK+TAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/564 (87%), Positives = 524/564 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL+QVDVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLK ND EAE EVV+TIL LIKDAKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDY KI+NATFPGVQMKF L+KLL SVA+AAKGYKPVAVPA+   N A D
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +TPL QEWMWNQ  KF QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ+W HL LL TFGAKDYENHRVATTGEW  L  +KEFN+NSRIR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV QA++TA  NAKQD
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQD 564

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/562 (85%), Positives = 521/562 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL+QV+V TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPNDAEAE EV++ +LSLIK+AKNPVIL+DAC SRHDVK ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQ+PRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL SV  A KGYKPV VPA +P NK   
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEWMWNQ  KF QEGD++ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPK+RVILFIGDGSLQLTVQEISTM+RWNLKPYLF+LNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ+W+HL LLETFGAKDYENHRVATTGEW+ L  +KEFN NSRIR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
           PVMDAP +L++Q ++TA  NA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/562 (84%), Positives = 514/562 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV+V+TIFGLPGDFNLSLLD IYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETTAM+TDI TAPAEIDRCIRTTYV+QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLKPND EAE+EV++ +L LIK+AKNPVIL+DAC SRHD KAETK+LID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDE+HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDYTKIR+ATFPGVQMKF L+KLL  VADAAKGYKPV VP+    N+A  
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEW+W Q  +F +EGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN IQNW+HL LL TFGAKDYE  RV+TTGEW+ L  D++F  N+RIR+IEVML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
           P MDAPSNLV+QA++TAATNAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/564 (85%), Positives = 519/564 (92%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV+V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLKPND EAE EVV+T+L LIKDAKNPVIL+DACASRH+VK+ETKQLID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TP+GKGSIDEQHPRFGGVYVGTLS  +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDY KIRNATFPGVQMKF L+KLL+ V +  K YKPVAVPA+   N ACD
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PSTPL QEW+WNQ  +F QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAA AAEE+D  KRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN+IQ WK+L LL TFGAKDYE +RVATTGEWD L  D+ FNKNSRIRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV+QA++TA+ NAKQ+
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQE 564

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/563 (83%), Positives = 514/563 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETTAM+TDIA APAEIDRCIRTTY+TQR VYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLKPND EAE EV+DTIL+++K+AKNP+IL+DACASRHDVKAETKQLID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P F TPMGKGSIDEQHPRFGGVYVGTLSRPEVK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y+TKN++EFHSD+TKI+ A+FPGVQMKFVL+KL+A +  A K YKPVA PA    N  C 
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEW+WNQ  KF QEGD+++TETGTSAFGINQ+ FPNN+ GISQVLWGSIGFTGG
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKR I+FIGDGSLQLTVQEISTMIRWNLKPY+FVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQNWKHL +L TFGAKDYE  RVATTGE++ L  DK FN+NS+IRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNLV QAK+TA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  970 bits (2508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/563 (83%), Positives = 509/563 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL+QVD  T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPID++LKPNDAEAE EVV T++ +I+DAKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P F TPMGKGSIDEQHPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y+TKNI+EFHSD+ KIRNATFPGVQMKF L++LL+++ +  K YKPVAVPAR P NKA  
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STP+ QEWMWNQ + F QEGD++I ETGTSAFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A+LGA  AAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN++Q W HL LL TFGAKDYE HRV TTGEWD L  DKEF  NSRIRMIEVML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QA++TAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/564 (83%), Positives = 515/564 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL Q++V+TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANIS TTAM++DI +APAEIDRCIRT Y+TQRPVYLGLPAN+VDLKVPA L
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDL+LKPND EAE EVV+T+L +I  AKNPVILSDACASRHDVKAET +LID TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSI EQHPRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSD+ KIRNATFPGVQMK+VLRKL+ +VA+  K Y PV VP++   N+  D
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +TPL QEW+WNQ  KF +EGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+DP +RVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YNDIQ W+HL LL TFGAKDYE  RV+TTGEWDAL  DK FN+NS+IRMIEVML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV+QA++TAATNAKQ+
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQE 586

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/564 (85%), Positives = 515/564 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG YLFERL QVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLKPND EAE EVV+++L LIKDAKNP+IL+DACASRHDVK ETKQLID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TP+GKGSIDEQHPRFGGVYVGTLS  +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDY KIRNATFPGVQMKF L+KLL+ +    K YKPVAVP +   N ACD
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PSTPL QEW+WNQ  +F QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAA AAEE+D  KRVILFIGDGSLQLTVQEISTMIRW L+PYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN+IQ WK+L LL TFGAKDYE +RVATTGEWD L  D+ FNKNSRIRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV+QA++TA+ NAKQD
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQD 564

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/563 (82%), Positives = 514/563 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MAEITLGKYLFERL QV V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETTAM+TDIATAPAEIDRCIRTTYV QR VYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPNDAEAE EV++T+L L+++AKNP+I++DAC SRHDVK+ET++LI+ATQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FTTPMGKGSI+E+HPRFGGVYVGTLSRPEVK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ K++NATFPGVQMKFVL+KL++ +  A KGYKPVAVPA +P NK   
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +TPL QEW+WNQ   F QEGD+++TETGTSAFGINQ+ FP ++ GISQVLWGSIGFTGG
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
            VLGAAFAAEEI+P KR ILFIGDGSLQLTVQEIST+IRWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL +L TFGAKDYE  RVATTGEW  L  DK F KNS+IRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNLV QAK+TAATNAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/562 (82%), Positives = 513/562 (91%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV+V TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETTAMVTD+A A +EIDRCIRTTYVTQR VYLGLPAN+ DLKV A L
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLKPNDA AE EVV+TILSL+KDAKNP+IL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQ+PR+GGVYVGTLS P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSD+ KI++ATFPGVQMKFVL+KLL  +   AKGYKPVAVP R   NK   
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +TP+ QEWMWN+ AKFFQEGDVIITETGTSAFGINQ+ FP N+ GISQVLWGSIGF  G
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RWNLKPYLFVLNN GYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGEKAGYNDIQ W HL LLETFGAKDYENHRV+TTGEW+ L  +K+FN+NSRIR+IE+ML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
            VMDAPSNLV QA++TA+ NAK
Sbjct: 541 EVMDAPSNLVAQAQLTASINAK 562

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/563 (82%), Positives = 508/563 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M++ITLGKYLFERL QV  +TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L TPIDLSLKPND +AE EV+  IL LIKDAKNP+IL+DACASRHDVKAETK LIDATQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y TKNI+EFHSD+ KIR A+FPGVQMKFVL KL+A V    KGYKPVA+PA VP N A  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
             TPL QEW+WNQ  KF +EGD+++TETGTSAFGINQ+ FP N+ GISQVLWGSIGFTGG
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKR I+FIGDGSLQLTVQEISTMIRWNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQNWKHL +L TFGAKDYE  RVATTGEWD L  DK FN+NS+IRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNL+ QAK+TAATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/563 (82%), Positives = 507/563 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M++ITLGKYLFERL QV   TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L TPIDLSLKPND +AE EV+  IL LIKDAKNP+IL+DACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y TKNI+EFHSD+ KIR A+FPGVQMKFVL KL+A V    KGYKPVA+PA VP N A  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
             TPL QEW+WNQ  KF +EGD+++TETGTSAFGINQ+ FP N+ GISQVLWGSIGFTGG
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKR I+FIGDGSLQLTVQEISTMIRWNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQNWKHL +L TFGAKDYENHRVATTGEWD L  D+ FN+NS+IR+IE+ML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNL+ QAK+T ATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/563 (82%), Positives = 506/563 (89%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL+QV   T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKG++CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPNDAEAE EVV T++ +IKDAKNPVIL+DACASRHDVKAETK+LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P + TPMGKG+IDEQHPR+GGVYVGTLSRPEVKE VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKF L+KLL ++    K YKPVAVPARVP NK   
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +TP+ QEWMWNQ + F QEGD++I ETGTSAFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A+LGA  AAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL LL TFGAKDYENHR+ATTGEWD L  DK+F  NSRIR+IEVML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLVQQA++TA+ NAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/563 (81%), Positives = 500/563 (88%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QVD  TIFG+PGDFNLSLLDK+YEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++ +ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  YV QRPVYLGLPANLVD KVPA L
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L TPIDLSLK ND EAE EVVDT+L LIK+AKNPVIL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQ+PRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSD+ KIRNATFPGVQMKFVL+KLL +V +A K YKP  VPA    N    
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            ST L QEW+W Q   F +EGDV+ITETGTSAFGINQ+ FPN + GISQVLWGSIG+T G
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           + LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN IQ WKHL LL TFGAKDYENHRV+T GEW+ L  D +FN+NSRIRMIEVML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
            VMDAPS+LV QA++TAATNAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/563 (82%), Positives = 508/563 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDL+LKPND EAE EV++T+L LI++A NPVIL+DACA RHDVK ET +LID TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDY KIRNATFPGVQMKFVL KLLA V  A KGY PV +P R+  N+ C 
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P T L QEWMWN+ +KFF++GD+I+TETGT+AFGINQSLFPNN++GISQVLWGSIGFTGG
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           AVLGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW+LKPYLFVLNN+GYTIERLI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  AGYN IQ W+H  LLE FGA DYEN ++ TTGEW  L  DK+FN+ S+IRMIEVML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNL+ QAK+TA  N+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/563 (81%), Positives = 508/563 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL+QV+  T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIA+AP+EIDRCIRTT+ TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPID+SLKPNDAEAE EVV T++ +IKDAKNPVIL+DACASRHDVKAETK+LI+ TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P F TPMGKG+IDEQHPR+GGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSD+ KIRNATFPGVQMKF L+KLL ++ +  K YKPVAVPARVP NKA  
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +T + QEWMWNQ   F QEGD++I ETGTSAFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A+LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN++Q+W HL LL TFGA+DYE HR+ TTGEWD L  DK+F  NSRIRMIEVML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QA++TAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/563 (82%), Positives = 507/563 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL+QV+  T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTTY TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPNDAEAE EVV T++ LIKDAKNPVIL+DACASRHDVKAETK+L+D TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P + TPMGKG+IDEQHPR+GGVYVGTLSRPEVK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKF L+KLL ++ +  K YKPVAVPARVP  K+  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            +TP+ QEWMWN    F +EGD++I ETGTSAFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A+LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL LL TFGA++YE HRVATTGEW+ L  DK+F  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP NLV+QA++TAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/564 (83%), Positives = 510/564 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EIT+G YLF+RL QV+V+TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISE+TAM+TD+ATA  EIDRCIRT Y++QRPVYLGLPANLVD KVPA L
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPID SLKPNDAEAE EVV T+L +I ++KNPVILSDACASRHDVK ETK+LID TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+TK+RNATFPGVQMKFVL+KL+  V D AK Y PV VP +       D
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P+TPL QEW+W + A+F +EGDV+ITETGTSAFGINQ+ FPN++ GISQVLWGSIGFT G
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YNDIQ W HL LL TFGAKDYE  RV+T GEW  L  DK F++NS+IRMIEVML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV+QA++TAATNAKQD
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQD 564

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/562 (79%), Positives = 499/562 (88%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+Y+FERL QVDV T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDL+LKPND +AE+EV+ T+L +IKDAKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE+HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSD+ KIRNATFPGVQMKFVL+ LL  V    K YKPV VP     N A D
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PSTPL Q+W+WNQ  +F QEGD+++TETGTSAFGINQ+ FPNN+ GISQVLWGSIG+  G
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RWNLKPYLFVLNN GYTIE+LI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQNW HL LL TFGAKDYE  RV+TTGEW+ L  DK+FNKNS+IR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
           PVMDAP +LV+QA++TAATNAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/563 (80%), Positives = 504/563 (89%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV+V TIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKG+S ++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETT+M+TDIATAP+EIDR IRTT++TQRP YLGLPANLVDLKVP  L
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LE PIDLSLKPND EAEKEV+DT+L LI+++KNPVILSDACASRH+VK ET++LID TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TP+GKGSIDEQHPR+GGVYVGTLS+ +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSDY K++NATF GVQMKF L+ LL  + D  KGYK V VP + P NK   
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEW+WN+ +KF QEGDVII+ETGTSAFGINQ++FP ++ GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDP KRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL LL  FGAK YENH++ATTGEWDAL  D EF KNS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP +L++QA++TAATNAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/562 (80%), Positives = 506/562 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV+V+TIFG+PGDFNLSLLDK+YEV GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+K +SC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANIS+TTA++TDI++APAEIDRCIR  YV QRPVYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L T IDLSLKPND EAE+EVV T+L L+ +AK+PVILSDACASRHDVK ETKQLID TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPRFGGVYVGTLS P+VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+TKIR+ATFPG++MK VL+ L+  + +AAKGY+P  VP     N+  D
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P TPL QEW+WNQ + F +EGD++ITETGT+AFGINQ+ FP++++GISQVLWGSIGFT G
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDP KRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN IQ WKHL LL TFGAKDYE HRVATTGEW AL   +EFNKNS IRMIE+ML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
            VMDAPS+L++QAK+TAATNA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/562 (83%), Positives = 505/562 (89%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLSLKPNDA AE+EVV T+L LIK+AKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE+HPRFGGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL  V D  K YKPVA+P     N A D
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL Q+W+WNQ  KF QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+D  KRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YN+IQ W HL LL TFGAKDYE  RVATTGEW+ L  D+EFNKNS+IRMIEVML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
           PVMDAP +LV+QA++TAATNAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/564 (81%), Positives = 508/564 (90%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M++ITLGKYLFERL QV V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS++SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF  FHRMSA ISETTAM+TDIA APAEIDRCIRTTYVTQR VYLGLPANLVDL VPA L
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDL+LKPN  E+E EV++TIL ++K+AKNP+I++DACASRH+VK ET+QLID TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFTTPMGKGSI+E+HPRFGGVYVGTLSRPE+K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y+TKNI+EFHSD+ KI+NATF GVQMKFVL KL+A + D  K YKPVAVPA VP NK   
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
             TPL QEW+WNQ   F QEGD+++TETGTSAFGINQ+ FP ++ GISQVLWGSIGFTGG
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
            VLGAAFAAEEI+P KR ILFIGDGSLQLTVQEIST+IRWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL +L TFGAKDYE  RVATTGEWD L  DK FNKNS+IRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAPSNLV QA++TAA NAKQD
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQD 564

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/563 (79%), Positives = 501/563 (88%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV+V TIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKG+S +ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS NISETT+M+TDIATAP+EIDR IRTT+VTQRP YLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L  PIDLSLKPND EAEKEV+DT+L LI+ +KNP+ILSDACASRH VK ET++LID TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TP+GKGSIDEQHPR+GGVYVGTLS+P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKN++EFHSDY K++NATFPGVQMKF L+KLL+ +    K YK V VP +   NK   
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEW+WN+ +KF QEGDVI++ETGTSAFGINQ+ FP ++ GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+DP +RVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL LL TFGAK YENH+VATTGEWD L  D EF KNS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PV DAP +L++QA++TAATNAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 504/563 (89%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV V+TIFGLPGDFNLSLLDKIYEVPG+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCI+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+ ISETTA++TDI  AP EIDRCI+ TY  QRPVYLGLPANLVDLKV A L
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLS+ PNDA+AE EVV+T+L+++  AKNPVIL+DAC +RHDVK ETK+LID TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDE HPRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           YKTKNI+EFHSDYTK+RNATFPGVQMK VL+KLL+ V+DAA GYKPV VP     N   +
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STPL QEW+WN  + + +EGDV+ITETGTSAFGINQS FPN++ GISQVLWGSIG++ G
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           + LGAAFAAEE+D  +RVILF+GDGSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HGE A YND+Q W HL LL TFGAKDY++ R++TTGE+  L  D+ F++NS+IR+IEVML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPS LV+QA++TAATNAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/563 (75%), Positives = 486/563 (86%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QV V TIFGLPGDFNL+LLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVG PS +SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTY+ QRPVYLG+PAN  DLKVPA L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L TPIDLSL  N+ EAEKE +  +L L+K +KNP+I+ DACASRHDVKAET +LI+ TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P F TPMGKG+I+EQHPR+GGVYVGTLSRPEVKEAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y TK+++EFHSDY +I+ ATFPGVQMKF+L KL   + +  + YKP  VP RVP+N    
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PST L Q W+WNQ +KF +EGD++I ETGTS FGIN++ FP N   ISQVLWGSIGF  G
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEE+DPK+RVILF GDGSLQLTVQEISTMIRWNLKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ+W+HL LLETFGAKDYEN+RV+TTG W+ + GDK+FN+NS+IRMIEVML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAP +L++Q ++TA  N+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/563 (77%), Positives = 494/563 (87%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL QV+V TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS +SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMS  ISETTAM+TD++ A ++ID CIR TY TQRPVYLG+PAN+ D  +PAKL
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPI++ L PN+ E+E EVV+TIL ++K AKNPVI++DAC SRH+VKAET++LIDATQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFTTPMGKGSI+E HPRFGGVYVGTL+RPEVK+AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y+TKNI+EFHSD+ KI+NATF GVQMKFVL +L+  + D  K YKPV VPA +P+NK C 
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
             TPL QEW+WNQ   F QEGD+++TETGTSAFGIN + FP N+ GI+QVLWGSIGFTGG
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
            VLGAAFAAEEIDPKKRV LFIGDGSLQLTVQEISTMIRWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W HL +L TFGA DYE  RVAT GEW+ L  D +FNKNS+IRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           PVMDAPSNL+ Q K+T A NA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/563 (76%), Positives = 495/563 (87%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+++TLG+YLFERL Q+ ++TIFGLPGDFNL LLDKIYE+PGMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ +QAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF  F+RMS+ ISET  M+ D+ TAPAEIDRCI+T YV QRPVYLGLP NLV+  VP  L
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSL+PNDA++E EV+ TIL ++K AKNP+I++DACASRHDVKAET++LID TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+EQHPRFGGVYVGTL+RPEVK+AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y+TKN+IEFHSD+TKI+NA + G+QMKFVL KL+  + +  K YKPVAVPA +  N    
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P TPL QEW+WNQ   F QEGD+++TETGTSAFGINQ+ FP N+ GISQVLWGSIGFTGG
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
            VLGAAFAAEEIDPKKRV+LFIGDGSLQLTVQEISTM+ WNLKPYLFVLNNDGYTIERLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ W +L LL TFGAKDY+  RVATTGEW+ L  + EFN+NS+IRMIEVML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           P MDAPSNL+ QA++TA+ NAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/564 (76%), Positives = 491/564 (87%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+ ++LG YLFERL QV V TIFGLPGDFNL LLDKIY++PGMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMSA ISETTA++TD++ A +EIDRCIRTTYV QR VYLG+PAN+ D ++P  L
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLK N+ E+E EV+DTIL L+  AKNP+IL+DACASRHDVK ET+QLIDATQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDE HPR+GG+YVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y+TKNI+EFHSD+ KIRNA FP +QMK +L+KL+  +      Y PVAVPAR P N A D
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           PSTPL QEWMW +   F QEGD++ITETGTSAFGIN + FP N+VGISQVLWGSIGFTGG
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           AVLGAAFAAEEIDP +RVILFIGDGSLQLTVQEIST I+WNLKPYLF+LNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQ+W+HL LL TFGAKDYE  R+AT GEW+ L  DKEFNKNSRIR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQD 564
           PVMDAP +L++Q ++TAA NAK+D
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKKD 564

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/564 (76%), Positives = 485/564 (85%), Gaps = 2/564 (0%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+ I+LG+YLFERL QV V TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETT++VTD+A APAEIDRCIR TY+ QRPVYLG+PAN  DL + AKL
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L TPIDLSL  ND EAE E +D +L L+KDA NP+IL DACASRHDVK ETK+LID TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P F TPMGKG+I+EQHPR+GGVYVG L+ P +KEAVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
            KTKN++EFHSDY KIRNA+FPGVQMKFVL+KL   +    K YKPV VP +   NK   
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            STP+ QEWMWNQ AKF QEGD++I+ETGTS FGINQ+ FPNN+ GISQVLWGSIGF  G
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEEIDPKKRVILF GDGSLQLTVQEISTM+RWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKD--YENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
           HGE AGYN+IQ W HL L   FGAK+  +ENHRV+TTGEW+ L   K+F  N++IRMIEV
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPSNLVQQAKITAATNAK 562
           MLPVMDAP++L++QAK+TA+ NAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/562 (76%), Positives = 487/562 (86%), Gaps = 1/562 (0%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+ I+LG YLFERL QV V TIFGLPGDFNL LLDKIY+VPG+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  SQA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMSA ISETT M+TD   A  +IDRCIRTTYV QR VYLG+PAN+ D ++P  L
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSLK N+  +E++V+DTIL  +KDAKNP+I+SDACASRHDVK ET+QLI+ TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TP+GKGSIDE HPR+GG+YVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPEN-KAC 359
           Y+TKN++EFHSD+ KI+NA FPGVQM+ +LRKLL  +    KGY PVAVPA++P N K+ 
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 360 DPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTG 419
             + PL QEWMWNQ ++F QEGD+IITETGTSAFGIN + FP N+VGISQVLWGSIGFT 
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 GAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERL 479
           GA+LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMI+WNLKPYLF+LNN+GYTIE+L
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVM 539
           IHG  A YN+IQ+W HL LL T GAKDYE  RVAT GEW+ L  DKEFNKNSRIR+IEVM
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPSNLVQQAKITAATNA 561
           LPVMDAP +L++Q K+T   NA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/521 (78%), Positives = 454/521 (87%)

Query: 43  MRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGNANELNAAYAADGYAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
           S +SQAK LLLHHTLGNGDFTVFHRMS+N+SETTAM+TD+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLKVPAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACA 222
           VYLG+PAN  DLKVPA LL TPIDL L PN+ EAEKE +D IL LIKD+KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLI 282
           SRHDVKAET +LI+ TQFP F TPMGKG+I+EQHPR+GGVYVGTLS+PEVK+AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAK 342
           LSVGALLSDFNTGSFSYSYKTKNI+EFHSDY KIRNATFPGVQMKFVL KL A + +   
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 GYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPN 402
           GYKP AVPAR P NKA   +TPL Q WMWNQ +KF +EGDV+I ETGT  FGIN++ FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNL 462
           N +GISQVLWGSIG+  G  LGA  AAEE+DP KRVILF GDGSLQLTVQEISTMIRWNL
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALM 522
           +PYLF+LNN+GYTIE+LIHG  A YN+IQ+W HL LLETFGAKDYENHRVATTGEW  L 
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 GDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAKQ 563
            +K+FNKNSRIR+IEVMLPVMDAP +L++Q ++TA  NAK 
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/562 (74%), Positives = 480/562 (85%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+ ITLG+YLFERL QV+  TIFGLPGDFNL LLD+IYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++C+ITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS++SQAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMSANIS+TTAMVTD+ATAP EIDRCIRTTYVTQRPVYLGLPAN+V+  V  +L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDLSL+PND + E+EV+  +L+L++ A+NP+IL+DAC SRHD K E  QL DATQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P F TPMGKGS+ E+HPRFGGVYVGTLS P+VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y T+N++EFHSD+TK+RNA FP V MKFVL+KL+  +  A + Y P  VP R   N    
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
             TPL QEW+W Q  +F +EGDV++TETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LGAA AAEE+D  KRVILFIGDGSLQLTVQEIS+M+RW L+PYLFV NNDGYTIE+LI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG  A YN+IQNW HL LL TFGA DYE  RVATTGEWDAL  D  FN+NSRIR++EVML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPSNLVQQAKITAATNAK 562
            VMDAPS+LV+QA++TAATNA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/568 (72%), Positives = 473/568 (83%), Gaps = 11/568 (1%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M EITLG+YLFERL Q+ + TIFGLPGDFNL+LLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  S+AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DF  FHRMS+ ISETT +V+D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D KV +KL
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           L+TPIDL+L+PN  +AE+EV+D I+++IK +K P+IL+DAC SRHDVK ETK+LI+ TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FTTPMGKGSIDE  PRFGGVYVG LS PEVK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
             T+N+IEFHSD+ KIRNATFPGVQMKFVL KLL  +    KG     V   VP  K  +
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRV---VPRQK--E 355

Query: 361 PSTPL------AQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGS 414
           PST L       QEWMW    KF QEGDV++TETGTS FGI +S FP N+VGISQVLWGS
Sbjct: 356 PSTTLNGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGS 415

Query: 415 IGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGY 474
           IG+  G+ +GAAFAA+EIDPKKRVILFIGDGSLQLTVQE+ST  RW L PY+FVLNN+GY
Sbjct: 416 IGYALGSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGY 475

Query: 475 TIERLIHGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIR 534
           TIERLIHGE  GYNDIQ+W H ++L  FGAK+YEN RVAT GEW+ ++ DK+FNKN ++R
Sbjct: 476 TIERLIHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLR 535

Query: 535 MIEVMLPVMDAPSNLVQQAKITAATNAK 562
           MIEVMLP MD P NL +QAK+TA+ NAK
Sbjct: 536 MIEVMLPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/563 (65%), Positives = 456/563 (80%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+EI++G+YLFERL QV VKTIFGLPGDFNLSLLDK+YEVPG+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+ GM C++TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180
           DFT FHRM   I++TTA+++D ATA +EIDRCI+T  +T  PVYLG+PAN+    + A L
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           LETPIDLS + ND +AE EV+D +L LI++A+NP+ILSDACASR+D+K E K LID TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P + TPMGK S++EQHPR+GGVY G++S+PEVK+AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360
           Y TK+I+EFHS +T I+NATF GVQMKFVL+KL   V D  + Y PV + ++   NK  D
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P TPLAQ+W+W + + F +EGD++I E+GT AFGIN+   P  +  ISQ+LWGSIG+T G
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LG   A +EIDP +RVILFIGDGSLQL VQE+STMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
           HG +A YNDIQ W HL LL  FGAK+YE  R++T G W  L  D EFN++S+IR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPSNLVQQAKITAATNAKQ 563
           P +D+   LV+QAK+    N+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/550 (60%), Positives = 437/550 (79%), Gaps = 1/550 (0%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I+LG YLF+RL Q+ V+TIFGLPGDFN++LLDKIYEVPG+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           IKG+ C++TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  +Q K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ V   +L+ 
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           P+DLSLK ND E EK+VV++I+  +K AKNPVI++DAC +RHDV  ET++L+D TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG+IDEQHPRFGGVYVG++S PEV+E V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           KN++  ++++ K++NA +P +++KFVL+ LL S+++    YKP  VP  +        + 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
           PL QEW+WNQ + +F EGD++ITETGTSAFGINQ+ FPNN+  ISQVLWGSIG++ GA L
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 GAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIH-G 482
           GA+FA EE+  K RVILF+GDG+LQLTVQEISTMIRW LKPYLFV+NN GYTI+RL+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 EKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVMLPV 542
             AGY+DIQ W +L LL  FGA +Y+  +V T G++  L+ D +F  + +++MIEV+LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPSNLVQQ 552
           MDAP  L+ +
Sbjct: 554 MDAPPALLNK 563

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/551 (53%), Positives = 407/551 (73%), Gaps = 1/551 (0%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           EI L +Y+  RL Q+ + TIFG+PG FN+ LL +I  VP M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK ++C++TTFGVGELSA+NG+AGS+AEHVG+LH VG+P +++Q ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
            VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V + LL 
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
            P+DLS    + E +++ V+ ILS +   ++P I+ DAC SRH+V AE +QL++ TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPRFGG +VG++S P+V+E V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPS 362
            KN     S Y +++NA +P +++K  LR LL  +  +   Y+P  VP  +        +
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAV 422
            PL QEW+WNQ + +F+EGD++ITETGTSAFG+NQS FPNN+  I+Q LWGS+G++ GA 
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHG 482
           LGA+FAA E     RVILF+GDG+LQLTVQE+STMIRW LKP +FV+NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 E-KAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVMLP 541
           +  AGY+DIQ W +L LL  FGA DY+   V T G++  L+ D  F  N++I+M+EV+LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPSNLVQQ 552
            MDAP  L+ +
Sbjct: 554 PMDAPPALMDK 564

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 406/556 (73%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q+++ TIFGL G+F++ LLDK+Y +P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           P+DL L  ND + EKEV+  ILS I  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           KN    +S   K++NAT+P + +K +L+K+LA++ ++   Y+P   P+ +        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
            L QEW+WN+ + +FQ GD+IITETG SAFG+NQ+ FP N++GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+ +++ D  F  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EVMLPVMDAPSNLVQQ 552
           E+MLP  D P  L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/549 (52%), Positives = 397/549 (72%), Gaps = 1/549 (0%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           IT+  Y F RL Q++V TIFGLPG+FN  L+DK+Y + G+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ CII+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  S+Q +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHRM+  +S  +A++ D      E+D CIR  Y+ QRPVY+G+P NLV + V +  L  
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           PIDLS+ PND   E EV+D IL+    A NPVI++DAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKGS+DE  P+FGGVY G++S P V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
             ++  +    K ++AT+P + +K +L  LLA++ +    Y+    P  V        + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
           PL QEW+WNQ +++F EGDVIITETGTSAFGINQ+ FP +++GISQ LWGS+G++ GA L
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 GAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGE 483
           GAA A +E     RV+LF+GDG+ QLT QE+ST+IRW L PY+F++NN GY+++R +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 KAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVMLPVM 543
            A Y DIQ W +  L   FGAKDYE+ ++ T G++ +++ D  F+   RIR++E+MLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPSNLVQQ 552
           D P  L ++
Sbjct: 551 DVPQALREK 559

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/556 (51%), Positives = 407/556 (73%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q+++ TIFGL G+F++ LLDK+Y++P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           P+DL L  ND + EKEV+  ILS I  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           KN    +S   K++NAT+P + +K +L+KLLA++ ++   Y+P   P+ +        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
            L QEW+WN+ +++FQ GD+IITETG SAFG+NQ+ FP N++GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+ +++ D  F  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EVMLPVMDAPSNLVQQ 552
           E+MLP  D P  L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 404/551 (73%), Gaps = 1/551 (0%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +ITL ++L  RL Q+ + TIF +PG F++  + +IY+ P M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK + C+ TTFGVGELSA+NG+AG++AEHVG+LHVVG+P +++Q KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
            VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL 
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
            P+DL     + + E+  V+T+L+ I    NP I++DAC SRH+V+AE K L+D TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQHPRFGG +VG++S P+V+E V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPS 362
           TKN +   SDY K++NA +P + +K VLR +LA +  +   Y+P  VP  +        +
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAV 422
            PL QEW+W Q +++F+EGD++ITETGTSAFG+NQ+ FP+++  I+Q LWGS+G++ GA 
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHG 482
           LGA+FAA E     RVILF+GDG+LQLTVQEISTMIRW L P +F++NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 483 E-KAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVMLP 541
           +  A Y+DIQ W +L +L TFGA +YE   V T G++  L+ D +F  N +I+M+EV+LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VMDAPSNLVQQ 552
            MDAP  L+ +
Sbjct: 554 PMDAPPALMDK 564

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/567 (50%), Positives = 401/567 (70%), Gaps = 8/567 (1%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I++ +YLF RL Q+ ++TIFGLPG FN +LLDK+ E+PG+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ CIITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHRM++ ++  + ++ D      E+D CI   +  Q+PVY+G+P NLVD  V ++ L T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
            ++L+L  ND + E E+V  IL  +  +KNPVI++DAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P FGGV++G++S PEV+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           K  +  +    K ++A +P +++K ++  LL ++ ++   Y+    P  +          
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
            L  EW+WNQ + +FQEGD+IITETGTSAFGINQ+ FP++S GISQ LWGS+G+T GA L
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 GAAFAAEEIDPKK------RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIE 477
           GA+FAA E+   +      RVILF+GDG+ QLTVQE+STMIRW L PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 RLIHGE-KAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMI 536
           R +H    A Y DIQ W++L L+  FGA+ YE  ++ T G++  ++ D  F  N +IRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EVMLPVMDAPSNLVQQAKITAATNAKQ 563
           E+MLP MD P  L+ +  +T   N K+
Sbjct: 553 EIMLPPMDVPQALMDRW-LTEQENKKR 578

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/556 (51%), Positives = 407/556 (73%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL Q+++ TIFGL G+F++ LLDK+Y++P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           P+DL L  ND + EKEV+  ILS++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           KN    +S   K++NAT+P + +K +L+KLLAS+ ++   Y+P   P  +        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
            L QEW+WN+ +++FQ GD+IITETG SAFG+NQ+ FP N++GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+ +L+ D  F  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EVMLPVMDAPSNLVQQ 552
           E+MLP  D P  L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/556 (51%), Positives = 406/556 (73%), Gaps = 7/556 (1%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RL Q+++ TIFGL G+F++ LLDK+Y +P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CIR  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           P+DL L  ND + EKEV+  ILS +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           KN    +S   K++NAT+P + +K +L+KLLAS+ ++   Y+P   P+ +        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
            L QEW+WN+ + +FQ GD+IITETG SAFG+NQ+ FP N++GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI        K RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+ +++ D EF  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EVMLPVMDAPSNLVQQ 552
           E+MLP  D P  L+ +
Sbjct: 555 EIMLPPRDVPQVLLDR 570

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/558 (51%), Positives = 390/558 (69%), Gaps = 9/558 (1%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL Q+ VKTIFGLPG+FN+ LLDKIY +P MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK + C++TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
            VF+RM+ +++  T +V D      E+D+C+   +  Q+P YLG+P N VDL V +  L+
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
           TP++L  +PN+ E E +VV TIL  +   +NP I+ DAC  RHD+  ETKQ    T FP 
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG++DE    FGGV+ G+LS P V+E V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPS 362
           TKN    HS   K++NAT+P + +K +++ LL+ +  +         P           +
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAV 422
             L QEW+WN+ + +FQ+GD+IITE GTSAFGINQ+ FP  + GISQ LW S G++ GA 
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 LGAAFAAEEIDP--------KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGY 474
           LGA+FAA+E+          + RV+LF+GDG+ Q+T+QEISTMIRW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIERLIHGE-KAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRI 533
           +++R +H   KA Y D+Q W +L   + FGA DYE  ++ T G+   +M DK F K+ +I
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEVMLPVMDAPSNLVQ 551
           RM+E+MLP  D P  LV+
Sbjct: 556 RMLEIMLPSTDVPQVLVE 573

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/593 (49%), Positives = 407/593 (68%), Gaps = 43/593 (7%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           E+T+ +YLF RL Q++V TIFGLPG+FN+SLLDK+Y V GMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K + C++TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
            +FHR+S +I   +A+VT       EID+C+   +++Q+PVYLGLP NLV +KV + LL 
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
           TP+DL L  ND + E   +D IL  I  AKNP I++DAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG +DE   +FGGV+VG++S  +V+E V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVP-ARVPENKACDP 361
           TK+I+   S   K++N  +P + +K  L KL+ ++      YKP+  P   +P N   + 
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 362 S--------------------TPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFP 401
           S                    T L QEW+WN+ + +F+EGD+IITETGTSAFGINQ+ FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNSVGISQVLWGSIGFTGGAVLGAAFAAEEI---DP---KKRVILFIGDGSLQLTVQEIS 455
           N ++GISQ LWGS G++ GA LGA+FAAEEI   +P   K RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMIRWNLKPYLFVLNNDGYTIERLIHGE----------------KAGYNDIQNWKHLMLL 499
           TM++WNL PY+F++NN GY+++R +  +                   Y DIQ W +L L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 ETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQ 552
             F A +YE ++V +  +   ++  K F+   RIRM+E++LP MD P +L+++
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/559 (49%), Positives = 393/559 (70%), Gaps = 10/559 (1%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           EIT+  YLF RL Q+ V+TIFGLPG+FN+ LLD++Y +PG++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+ CIITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
            VFHRM+ ++S  + ++ D      E+D+CI   Y+ Q+PVYLG+P N V+LKV +  L 
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
             +   +  N+ + E E ++ IL  I   ++P I+ DAC +R D   ET+Q I  T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDE  P FGGV+ G++S P V+E V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVA---VPARVPENKAC 359
           +KN +    D  + + + +P + +K +++ +L+ +      ++P +    P  VP++K  
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 360 DPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTG 419
           D    L QEW+W++ + +FQEGD+IITE GTS+FGINQ  FP+++ GISQ LWGS G++ 
Sbjct: 372 DDQL-LRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSM 430

Query: 420 GAVLGAAFAAEE-----IDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGY 474
           G+ LGA FA  E        ++RVILFIGDG+ Q+T+QEISTMIRWNL PY+F+LNN GY
Sbjct: 431 GSCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGY 490

Query: 475 TIERLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRI 533
           +I+R +H  K     D+Q W +L   + FGA DYE  ++ T G+   ++G+++F++  RI
Sbjct: 491 SIDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRI 550

Query: 534 RMIEVMLPVMDAPSNLVQQ 552
           RM E+MLP MD P  +V +
Sbjct: 551 RMAEIMLPSMDVPKAIVDK 569

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/571 (49%), Positives = 389/571 (68%), Gaps = 21/571 (3%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           ++I++ +YLF RL Q+ + TIFGLPGDFN+ LLDK+Y +P MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +R+K + C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLL 181
           ++VF+R++ +I+  TA++ D      E+D CIR  +  Q+PVYLG+P N VD+ V +  L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 ETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFP 241
             PIDLS+     E + +V+D +L  +  A  P+I+ DAC  RHD   ET  L + T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 AFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            F TPMGKG+IDE +  FGGVY G+LS PEV+E  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVA-VPARVPENKACD 360
           K KN         KI+ ATFP + +K  L+ L+ ++  +   YK  A V    P+ +  D
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
            S  L QEW+WN+ + +F+E D+IITETG+SAFGINQ+ FP N++GI+Q LWGS+GF   
Sbjct: 371 -SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALC 429

Query: 421 AVLGAAFAAEE------------------IDPKKRVILFIGDGSLQLTVQEISTMIRWNL 462
           + LGA FA EE                  I  + R ILF+GDG+ QLTVQE+ST+IRW L
Sbjct: 430 SCLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKL 489

Query: 463 KPYLFVLNNDGYTIERLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDAL 521
           KPY+F++NN+GY+++R +H    A Y D+Q W +L LLE FG   +E  ++ T  ++  L
Sbjct: 490 KPYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKEL 549

Query: 522 MGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQ 552
           + D+ F K  +IRMIE+MLP  D P  L+ +
Sbjct: 550 LADESFAKPDKIRMIEIMLPQSDVPKTLIAR 580

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/569 (49%), Positives = 399/569 (70%), Gaps = 17/569 (2%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +IT+ +YLF RL Q+ ++TIFGL G++N+ L+DK+Y+V  +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+  +ITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
           +VFHR++++I+    ++ D      E+D+CI   ++ QRPVY+G+P N V+L V +K L+
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
            P+DL +  N  E   E+ + IL  I   K+P I+ DAC  RH+   E ++    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E  P FGGV++G+LS P V+E V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARV-PENKACDP 361
            K+ +   SD  KI+N+ +  + +K +++ LL S+ ++   Y     P+ + P+ K  D 
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPD- 370

Query: 362 STPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGA 421
              L QEW+WN+ + +F+EGD+IITE GTSAFGINQ+ FPN + GISQ LWGS G++ GA
Sbjct: 371 DVLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGA 430

Query: 422 VLGAAFAAEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLF 467
            LG +FA +E +               K RVILF+GDG+ QLT+QE+ST+IRWNL PY+F
Sbjct: 431 CLGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIF 490

Query: 468 VLNNDGYTIERLIHGE-KAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKE 526
           VLNN+GY+++R +H E  A Y DIQ W +L L+ TF AK+YE  ++ T G++  ++ D  
Sbjct: 491 VLNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPL 550

Query: 527 FNKNSRIRMIEVMLPVMDAPSNLVQQAKI 555
           F  N +IRM+E++LP  D P  LV   K+
Sbjct: 551 FAINDKIRMVEILLPSTDVPQALVDTWKL 579

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/590 (47%), Positives = 399/590 (67%), Gaps = 34/590 (5%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +ITL  YLF RL Q  + T+FGLPG+FN+ L+DK+  +P ++WAGNANELNAAYAADGYA
Sbjct: 12  DITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIKG+ C++TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD+
Sbjct: 72  RIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
           TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +   + + LL 
Sbjct: 132 TVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLLN 191

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
             +D +L+ N+  ++ +V++ IL  I   K PVI+ DAC +RH+++ ET++L   T+FP 
Sbjct: 192 KDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFPV 251

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
             TPM KGS+DE  P F GV+ G++S P+V+E ++S DL+L +G  L +F T SF +SYK
Sbjct: 252 LVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSYK 311

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASV-ADAAKGYK-------PVAVPARVP 354
           +K+ I   SDY K RN TF  + +K +++KLL ++     K ++        + +P    
Sbjct: 312 SKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQLQENNNGNIYIP---- 367

Query: 355 ENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGS 414
            N   +P+  L QEW+WNQ + +FQ+GD+IITETGT+AFGINQ+ FP+N+ GISQ LWGS
Sbjct: 368 -NIKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGS 426

Query: 415 IGFTGGAVLGAAFAAEEID--------------------PKKRVILFIGDGSLQLTVQEI 454
            G++ GA LGA+FA  EI                     PK RVILFIGDG+ QLTVQE+
Sbjct: 427 TGYSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQEL 486

Query: 455 STMIRWNLKPYLFVLNNDGYTIERLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVA 513
           ST+IRW L PY+F++NN GY+ +R +H    AGY DI  W +L LLE FGAK YE+ ++ 
Sbjct: 487 STIIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKII 546

Query: 514 TTGEWDALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAKQ 563
           T G+++ ++ +  F  +S +RMIE++LP MD P  L+ + ++      K+
Sbjct: 547 TVGDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/566 (48%), Positives = 387/566 (68%), Gaps = 15/566 (2%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           IT+ +Y+F RL Q+ ++TIFGLPG+FN+ L+DK+Y++P +RWAG+ANELNAAYAADGY+R
Sbjct: 13  ITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGYSR 72

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  ++TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDYN 132

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           VF R+++ ++  T ++ D      E+D+CI   +  Q+PVY+G+P N VD+ V +  L  
Sbjct: 133 VFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHLNV 192

Query: 184 PIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAF 243
           P+ LS   N  +   +VV  +L  I  + +PVI+ D C  RH    E ++ I  T+FP F
Sbjct: 193 PLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFPVF 252

Query: 244 TTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG+IDE +P F GV+ G++S P V+E V+ AD ++ +G +L+ FNT +F + YK+
Sbjct: 253 VTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGYKS 312

Query: 304 KNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPST 363
           KN    +SD  K  NAT+P V +K +L+ LL ++ ++   Y P   P  +   +      
Sbjct: 313 KNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPDDE 372

Query: 364 PLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVL 423
            L QEW+WN+ + +FQEGD+IITETGTSAFGINQ+ FPN + GISQ LWGS+G++ GA L
Sbjct: 373 LLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGACL 432

Query: 424 GAAFAAEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVL 469
           G+ FA +E                 K RVILF+GDG+ QLT+QE+ST++RW L PY+F+L
Sbjct: 433 GSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIFIL 492

Query: 470 NNDGYTIERLIHGEK-AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFN 528
           NN GY+++R++H    A Y DIQ W +L L+ TF A D +  ++ T G+   ++ D EF 
Sbjct: 493 NNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPEFA 552

Query: 529 KNSRIRMIEVMLPVMDAPSNLVQQAK 554
            ++RIRMIEVMLP MD P  LV   K
Sbjct: 553 VDNRIRMIEVMLPSMDVPKALVDTWK 578

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/562 (48%), Positives = 378/562 (67%), Gaps = 14/562 (2%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           +I LGKYLF RL Q++V TIFGLP +FN  LLD+IY++P MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK +SC++TTFGVGE+S LNGIAGS++EHV VLHVVG+P  S+Q K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLE 182
            +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    V +K L+
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKPND--AEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
           +P+ L    N   ++A +E+VD +L  I  A++PVI++D CASRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  R+ GVY+G++S P+V+E V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIIEFHSDYTKIRNA-TFPGVQMKFVLRKLLASVADAAK-GYKPVAVPARVPENKA 358
           YK KNI+     Y K+    T+P V++K VL +LLA   D  K  Y    +P        
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVL-QLLARCLDPTKLQYIQEEIPESSCLRVK 371

Query: 359 CDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFT 418
            D +TPL QEWMW + + +F+ GDVI+TE GTS  G+NQ  FP+ +  +SQ LWGS+G++
Sbjct: 372 PDANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYS 431

Query: 419 GGAVLGAAFAAEEID-----PKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
            GA LG   A +E          R+ILF+GDG+LQLTVQEIST+I+W L PY+FV+NN G
Sbjct: 432 VGACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQG 491

Query: 474 YTIERLI----HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNK 529
           YTI+RL+    H   A Y +IQ W +L ++  FG  +Y+  +V   G+ D L+ D+ F+ 
Sbjct: 492 YTIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSN 551

Query: 530 NSRIRMIEVMLPVMDAPSNLVQ 551
              ++M+E++LP MDAP  L++
Sbjct: 552 QDILKMVEIILPSMDAPQALLE 573

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  516 bits (1329), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 255/555 (45%), Positives = 360/555 (64%), Gaps = 10/555 (1%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           + I L +YLF RL Q+ V T FGLP D+N+ LLD +  V  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR++ +SC+++TFGVGELS +NGIAGS+AEHV VL +VG+P  S+Q ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLL 181
           + VF R++++I   + +V    TA   +D CI   Y  Q+PVY G+P NL +  +P+  L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 ETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFP 241
           + P+ L  +P       E+V  +L  I  AK+PV++ DAC +RH    + ++L  AT FP
Sbjct: 192 DVPLPLLDEP--CAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 AFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  RF GVYVG+LS P+V+E V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLA--SVADAAKGYKPVAVPARVPENKAC 359
           K KNI   H+ + ++    FP   ++ +L  L+   +   +A   +PV  P+ +    A 
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSAL--RVAP 367

Query: 360 DPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTG 419
           +P+TPL  EW+W + +++F  GD++++ETGTSAFG+ Q+  P     +SQ LWGS+G++ 
Sbjct: 368 NPATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSV 427

Query: 420 GAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERL 479
           GA LG   A     P +RV+LF+GDG+LQLTVQE+STM+R  L P +FVLNN GY+ +RL
Sbjct: 428 GACLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRL 487

Query: 480 I----HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRM 535
           +    H   A Y D+Q W +L L   FGA  Y+   V T GE DAL+ D  F + S ++M
Sbjct: 488 LNRARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKM 547

Query: 536 IEVMLPVMDAPSNLV 550
           +EV LP MD P  L+
Sbjct: 548 VEVALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  455 bits (1171), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 240/564 (42%), Positives = 344/564 (60%), Gaps = 48/564 (8%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           + IT+ +YLF RL Q+D++TIFGLPG+FN+ L+DK+Y++P +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR+K + C+ITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+    G+  
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLILFRNGDYK 131

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLV-----DLKV 176
           F +  R             DI   P    R +    +     ++     L        K+
Sbjct: 132 FPMKAR-------------DILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKI 178

Query: 177 PAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLID 236
           P            K   A+   + +    S +  +   +   + C      +  +   + 
Sbjct: 179 P------------KGKGADXXXKNLQCRTSYL--SSRSLRFKEQCR-----RCNSDYSVR 219

Query: 237 ATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGS 296
             +FP F  P  +    E + +FGGV+ G++S P V+E V+ ADL++ +G  L DF+T S
Sbjct: 220 KQKFPYFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSS 278

Query: 297 FSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPEN 356
           F +SY+ K+++   S Y KIRN  +P + +K +L  LL+ V  +   Y  +  P  VP +
Sbjct: 279 FHFSYRAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIK-PMVVPTS 337

Query: 357 KACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIG 416
           K    S  L QEW+WN+ + +FQE DVIITETGTSAFGINQ+ FP  S GISQ LWGS+G
Sbjct: 338 KLPSKSV-LRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVG 396

Query: 417 FTGGAVLGAAFAAEEIDPK-------KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVL 469
           ++ GA LGA+FA +E+           RVILF+GDG+ QLT+QE+STMI+WNLKPY+F++
Sbjct: 397 YSLGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLM 456

Query: 470 NNDGYTIERLI-HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFN 528
           NN GY+I+R + H   A Y DIQ W++L LL+ FGA DYE  ++ T  ++  ++ D  F 
Sbjct: 457 NNQGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFA 516

Query: 529 KNSRIRMIEVMLPVMDAPSNLVQQ 552
           +N +IRMIE+MLP MD P +L++Q
Sbjct: 517 RNDKIRMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  360 bits (923), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/555 (36%), Positives = 323/555 (58%), Gaps = 38/555 (6%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           I L +YLF RL Q++ +T+FG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
             G+SC +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLET 183
           +FH              D+   P+EID C+RT +  +RPVY+GL +      VP+  L  
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PI--DLSLKPNDAEAE--KEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQ 239
            I   + +K    + +  K V+D I++ +  +  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSY 299
            P  TT M KGSIDE  P F G ++GT+S+P V+E + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAK--GYKPVAVPARVPENK 357
           +YK+KN I   +D  KI N   P + +  +L +L+AS+ D  K    +PV +P  +P  +
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASL-DTTKIVNSRPVTIPNMIPRVE 361

Query: 358 ACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGF 417
              P T L QE++W + + + ++GDVII+E+GTSA G+ Q  FP+N+  +SQ +W S G+
Sbjct: 362 P-QPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGY 420

Query: 418 TGGAVLG--AAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYT 475
           + GA LG  AA+       K R+IL +GDGSLQ T QE+ST++    KPY+FV+NN GYT
Sbjct: 421 SIGACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYT 480

Query: 476 IERLIHGEK----AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNS 531
           ++R ++ EK    A Y DIQ W+ L L   F +++Y   R  + GE ++L+ DKEFNK+ 
Sbjct: 481 VDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSD 540

Query: 532 RIRMIEVMLPVMDAP 546
           +++++E++LP MD P
Sbjct: 541 QLKIVELILPSMDVP 555

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  340 bits (873), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 218/612 (35%), Positives = 323/612 (52%), Gaps = 54/612 (8%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAAD 59
           I  G+YL +R+     K+IFG+PGDFNLSLL+ +Y       G+RW G  NELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL---LH 114
           GY+R    MSC+ITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ S++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPANLVDLKV-PAKLLETPIDLSLK---PNDAEAE-KEVVDTILSLIKDAKNPVILSDA 220
            +PA+  D+ V P+ L+  P+ ++L+   P     E +EV   +L  I D+K P I+ D 
Sbjct: 208 FVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDV 266

Query: 221 CASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESAD 280
              R     E  +LI  T    F+T MGK  IDE +P++ G+Y G      V E     D
Sbjct: 267 LTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCD 326

Query: 281 LILSVGALLSDFNTGSFSYSY-KTKNIIEFHSDYTKI------RNATFPGVQMKFVLRKL 333
           L+L  G  +++ N G ++Y Y +   I+E H +Y +           F GV    +L++L
Sbjct: 327 LVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRL 386

Query: 334 LASVADAAKGYKPVAVPARVPENKACDPSTP-----LAQEWMWNQCAKFFQEGDVIITET 388
           L  +      +      AR  + + C P        + Q  + N+   +F +GDV++ ET
Sbjct: 387 LEKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCET 446

Query: 389 GTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKK------------ 436
           G+  F +   +FP+    ISQ  + SIG    A +G   A ++  PK             
Sbjct: 447 GSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSYQ 505

Query: 437 -RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKH 495
            R+ILF GDG+ Q+TVQE++TM+R  +   + +LNN+GYTIER I G    YNDI  WK 
Sbjct: 506 PRLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKW 565

Query: 496 LMLLETFGAKDYE---NHRVATTGEWDALMGDKEFNK-NSRIRMIEVMLPVMDAPSNLVQ 551
             L E FG  D +   N  V T  E D ++ D ++ K ++ I ++EV L VMD P  L  
Sbjct: 566 TKLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQS 625

Query: 552 QAKITAATNAKQ 563
                A   +K+
Sbjct: 626 MVDAAAFKRSKK 637

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 215/617 (34%), Positives = 315/617 (51%), Gaps = 58/617 (9%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYE---VPGMRWAGNANELNAAYAA 58
            EIT G+Y+F RL     K++FG+PGDFNL+LL+ +Y+      +RW GN NELNAAYAA
Sbjct: 29  GEITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAA 88

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQL---LLH 114
           DGY+R    + C+ITT+GVGELSALNG+AGS+AE V VLH+VGV S  +  K      +H
Sbjct: 89  DGYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVH 148

Query: 115 H---TLGNGDF------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL
Sbjct: 149 HLIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYL 208

Query: 166 GLPANLVDLKV--------PAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVIL 217
            +PA+  D+ V        P   LE  I   +   +++ E  +V  +  LI ++ NP IL
Sbjct: 209 FIPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEA-IVAKVAQLIYNSSNPCIL 267

Query: 218 SDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVE 277
            D    R+ V  +   LI   Q   F+T MGK  IDE +P + G+Y G      V E   
Sbjct: 268 GDVLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFS 327

Query: 278 SADLILSVGALLSDFNTGSFSYSYKTK---NIIEFHSDYTKIRNAT------FPGVQMKF 328
             DLIL  G   ++ N G ++  Y      N++EFHSDY +  N+         GV    
Sbjct: 328 KCDLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVH 387

Query: 329 VLRKLLASV-ADAAK-GYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIIT 386
           VL +L  ++ AD     Y+  +  +          S  + QE++ +   ++   GDV++ 
Sbjct: 388 VLNRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVC 447

Query: 387 ETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAA-----------EEIDPK 435
           ETG+  FG+    FP+N   +SQ  + SIG    A LG                EEI+ +
Sbjct: 448 ETGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYE 507

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKH 495
            ++ILF GDGS Q+T+QE+STM+  N+K  +F+ NNDGYTIER I G    YNDI  W  
Sbjct: 508 PKLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNW 567

Query: 496 LMLLETFG-----AKDYENHRVATTGEWDALMGDKEFNKNS----RIRMIEVMLPVMDAP 546
             + E FG          N   +T  E+   + +K+  K++    +I ++EV + V+D P
Sbjct: 568 TKMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFP 627

Query: 547 SNLVQQAKITAATNAKQ 563
             L  +  ++AA   K+
Sbjct: 628 EQL--KCMVSAAMYNKK 642

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  337 bits (865), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/591 (34%), Positives = 311/591 (52%), Gaps = 49/591 (8%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY------EVPGMRWAGNANELNAAYA 57
           +  G Y+F+RL     K+IFG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT 116
           ADGY+R    + CI+TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGL 167
           L N         ++ VF  M   ++S +T  + ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLKV-PAKLLETPI-----DLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDAC 221
           P N   L V P  L ETP       +++ P+  E    + D I S +  A+ P I++D  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 ASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL 281
             R+   +   + I  T    F+T MGK  +DE    + GVY G     +V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIIEFHSDYTKI------RNATFPGVQMKFVLRK 332
           IL  G   ++ N+G+++   Y  K   IIEFH  Y ++          F GV+  ++L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLASV--ADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGT 390
           +L  V  ++    Y P +  +    ++    +  + Q+ +      + + GDV++ +TGT
Sbjct: 384 MLKMVNPSNLHLNY-PTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGT 442

Query: 391 SAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEI------------DPKKRV 438
             F +    F +    +SQ  + SIG+   + LG   A  +             + K R+
Sbjct: 443 FQFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRL 502

Query: 439 ILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKHLML 498
           ILF GDG+ Q+TVQE+STM+R+ +   +F+ NNDGYTIER I G    YNDIQ W    L
Sbjct: 503 ILFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYL 562

Query: 499 LETFG-AKDY--ENHRVATTGEWDALMGDKEFNKNSRIRMIEVMLPVMDAP 546
            + FG AK+   +NH+V TT E D ++ +      + I  +EV L +MD P
Sbjct: 563 FKAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMP 613

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/600 (34%), Positives = 316/600 (52%), Gaps = 50/600 (8%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           I  G+Y+FERL     K++FG+PGDFNLSLL+ +Y    +   ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
                + N +F       +H M    IS +T  V ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLKVPAKLLETPIDLSLKPNDAEA-EKEVVDT----ILSLIKDAKNPVILSDA 220
            +PA+  D  V A+ L T   ++L+   ++   +EVVD+    I+ L+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESAD 280
              R     E +  +  T+  AF++ MG+  +DE  P F GVY G  S P + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-IEFHSDYTKI------RNATFPGVQMKFVLRKL 333
           LIL  G L ++ N G +S+S+      +E HSDY               GV    VL ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 --LASVADAAKGYKPVAV-PARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGT 390
             L  V      Y  + V P          P + + Q+++ N  +++   GDV + ETG+
Sbjct: 392 IQLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETGS 451

Query: 391 SAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEE-------------IDPKKR 437
             F +    FP N   ISQ  + SIG    + LG   A ++             +D   +
Sbjct: 452 FQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTPK 511

Query: 438 VILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKHLM 497
           +IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN GYT+ER I G    YNDI  WK   
Sbjct: 512 LILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWTK 571

Query: 498 LLETFGAKD---YENHRVATTGEWDALMGD-KEFNKNSRIRMIEVMLPVMDAPSNLVQQA 553
           LLE FG  D    E  +V   GE+  ++G  K   + S++R+IEVML +MD P  L+  A
Sbjct: 572 LLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAMA 631

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/615 (36%), Positives = 324/615 (52%), Gaps = 55/615 (8%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYA 57
           A +  G+Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAYA
Sbjct: 23  ATMPFGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYA 82

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISSQAKQLL 112
           ADGY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+  K+  
Sbjct: 83  ADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERN 142

Query: 113 LHH---TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P 
Sbjct: 143 LHHLVPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPG 202

Query: 164 YLGLPANLVDLKVPA-KLLETPIDLSLKPNDAEAEKE---VVDTILSLIKDAKNPVILSD 219
           Y+ +PA+  D+ V    L+  P         + +E +   ++D I + +  ++ P IL D
Sbjct: 203 YVFVPADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGD 262

Query: 220 ACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R+ V     +LI A++   FTT MGK  IDE +P + G+Y G     +V E  ES 
Sbjct: 263 VLTDRYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESC 322

Query: 280 DLILSVGALLSDFNTGSFSYSYK-TKNIIEFHSDYTKI------RNATFPGVQMKFVLRK 332
           DLIL  G  +++ N G +S++YK    II+FH +Y +           F GV    VL++
Sbjct: 323 DLILHFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQE 382

Query: 333 LLASVADAAK---GYKPVAVPARVPENKACDP----STPLAQEWMWNQCAKFFQEGDVII 385
           L   + D +K    Y     P      K  DP    ST + Q  +     KF   GDV++
Sbjct: 383 LYQCI-DVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVV 441

Query: 386 TETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDP----------- 434
            ETG+  F +    FP     ISQ  + SIG    A LG   A ++  P           
Sbjct: 442 CETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINE 500

Query: 435 --KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQN 492
             K R+ILF GDG+ Q+T+QE+ST++++++   + + NN+GYTIER I G    YNDI +
Sbjct: 501 GYKPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMS 560

Query: 493 WKHLMLLETFGAKD--YENHRVATTGEWDALMGDKEFNKNS--RIRMIEVMLPVMDAPSN 548
           WK   L E FG  D  Y N+ +  T    AL      N ++  RI ++EV L V+D P  
Sbjct: 561 WKWTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQ 620

Query: 549 LVQQAKITAATNAKQ 563
           L    +  A    K+
Sbjct: 621 LRCMVEAAALKRNKK 635

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 219/600 (36%), Positives = 318/600 (53%), Gaps = 53/600 (8%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYA 57
           A I  G+Y+F+RL  +D K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYA
Sbjct: 23  ATIPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYA 82

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL--- 112
           ADGY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI S++       
Sbjct: 83  ADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRN 142

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P 
Sbjct: 143 LHHLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPG 202

Query: 164 YLGLPANLVDLKVPA-KLLETPI----DLSLKPNDAEAEKEVVDTILSLIKDAKNPVILS 218
           Y+ +PA+  D+ V    L+  P     D  + P++ +   ++++ I S I  +K P IL 
Sbjct: 203 YIFVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQLS-DIINKITSWIYSSKTPAILG 261

Query: 219 DACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVES 278
           D    R+ V     +LI  T    F+T MGK  IDE +P + G Y G     +V E  E 
Sbjct: 262 DVLTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFEL 321

Query: 279 ADLILSVGALLSDFNTGSFSYSYK-TKNIIEFHSDYTKI------RNATFPGVQMKFVLR 331
            DL+L  G  +++ N G ++++YK    II+FH +Y ++          F G+    +L+
Sbjct: 322 CDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILK 381

Query: 332 KLLA--SVADAAKGYKPVAVPARVPENKACDP----STPLAQEWMWNQCAKFFQEGDVII 385
           +L     V+  +  Y            +  DP    S+ + Q  +     KF   GDV++
Sbjct: 382 ELYKRIDVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVVV 441

Query: 386 TETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEI------------D 433
            ETG+  F +    FP+    ISQ  + SIG    A LG   A ++             D
Sbjct: 442 CETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKED 501

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNW 493
            K R+ILF GDG+ Q+T+QE+ST+++ N+   + + NN+GYTIER I G    YND+ +W
Sbjct: 502 YKPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSW 561

Query: 494 KHLMLLETFGAKD--YENHRVATTGEWDALMGD--KEFNKNSRIRMIEVMLPVMDAPSNL 549
           K   L E FG  D  Y N  +       AL  +  K  NK S I ++EV L  +D P  L
Sbjct: 562 KWTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQL 621

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 216/603 (35%), Positives = 316/603 (52%), Gaps = 57/603 (9%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAY 56
           +A I+ G+Y+F RL     K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL-- 112
           AADGY+R    + C++TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI S++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLKVPAK-LLETP----IDLSLKPNDAEAEKEVVDTILSLIKDAKNPVIL 217
            Y+ +PA+  D+ V  + L+  P     D    P+  +   +++D I S +  +K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQL-FDILDRITSWMYSSKTPAIL 260

Query: 218 SDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVE 277
            D    R+ V     +LI AT    F+T MGK  IDE +P++ G Y G     +V E  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIIEFHSDYTKI------RNATFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    II+FH +Y +           F G+    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVL 380

Query: 331 RKLLASVADAAK-------GYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDV 383
            +L   + D ++       G           E+   D S  + Q  +     KF   GDV
Sbjct: 381 MELYKGI-DVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQVHLQKVMPKFLSPGDV 439

Query: 384 IITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDP--------- 434
           ++ ETG+  F +    FP     ISQ  + SIG    A LG   A ++            
Sbjct: 440 VVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDENIG 499

Query: 435 ---KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQ 491
              K R+ILF GDG+ Q+T+QE+ST+++ ++   +F+ NN+GYTIER I G    YND+ 
Sbjct: 500 EGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYNDVM 559

Query: 492 NWKHLMLLETFGAKDYENHRVATTGEWDALMGD-----KEFNKNSRIRMIEVMLPVMDAP 546
           +WK   LLE FG  D   H  +T  E+ + +       K  N    I ++EV L V+D P
Sbjct: 560 SWKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDFP 618

Query: 547 SNL 549
             L
Sbjct: 619 EQL 621

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 219/602 (36%), Positives = 320/602 (53%), Gaps = 55/602 (9%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAY 56
           +A I  G+Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISSQAKQL 111
           AADGY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+  K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-KLLETP----IDLSLKPNDAEAEKEVVDTILSLIKDAKNPVIL 217
            Y+ +PA+  D+ V A  L++ P     D    P + +   +++D I S +  +K P IL
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQL-LDIIDKITSWMYSSKTPAIL 260

Query: 218 SDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVE 277
            D    R+ V     +LI  T+   F+T MGK  IDE +P + G Y G     +V +  E
Sbjct: 261 GDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIIEFHSDYTKIRNA------TFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    II+FH +Y +  +        F GV    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVL 380

Query: 331 RKL--LASVADAAKGYKPVAVP----ARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVI 384
           ++L  L  VA  +  Y              E+   D S+ + Q  +      F   GDV+
Sbjct: 381 KELYKLIDVARLSLQYDSNVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPGDVV 440

Query: 385 ITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEI------------ 432
           + ETG+  F +    FP     ISQ  + SIG    A LG   A ++             
Sbjct: 441 VCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVKE 500

Query: 433 DPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQN 492
           D K R+ILF GDG+ Q+T+QE+ST+++ N+   + + NN+GYTIER I G    YNDI +
Sbjct: 501 DYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIMS 560

Query: 493 WKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFN-----KNSRIRMIEVMLPVMDAPS 547
           WK   L E FG  D   H  +T  E+ + +  K        + ++I ++EV L V+D P 
Sbjct: 561 WKWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDFPE 619

Query: 548 NL 549
            L
Sbjct: 620 QL 621

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 209/596 (35%), Positives = 314/596 (52%), Gaps = 44/596 (7%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYA 57
           AE+ LG+Y+F RL     KT+FG+PGDFN+ LL+ +Y       G++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   ++Q    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLKVPAK-LLETPIDL----SLKPNDAEAEKEVVDTILSLIKDAKNPVILSD 219
           L +PA++ ++KV ++ L++ P  +     L+  +  A   +   IL  +  +  P IL D
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSSTPAILCD 267

Query: 220 ACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R  +  + ++L++ T    F+T MGK  +DE  P + GVY G  S+ E    ++  
Sbjct: 268 GLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSK-ERNALLQEC 326

Query: 280 DLILSVGALLSDFNTGSFSYSYKTKN-IIEFHSDYTKI-RNA---TFPGVQMKFVLRKLL 334
           DLIL +G +  + NT  +++ +  ++ IIE H +Y  + RN          +  VLR +L
Sbjct: 327 DLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSIL 386

Query: 335 ASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFG 394
           A +  A   +       RVP         P+ Q  + +   +    GDV++ +TGT  F 
Sbjct: 387 AHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTFQFS 446

Query: 395 INQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEE-----IDPK-------KRVILFI 442
           +    FP +   ISQ  + SIG    A LG A A  E     + PK        R++L  
Sbjct: 447 VFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVLCE 506

Query: 443 GDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKHLMLLETF 502
           GDG+ Q+T+QE+ST IR+ L   + + NNDGYT+ER+I G    YNDI +W    LL  F
Sbjct: 507 GDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLRVF 566

Query: 503 GAKDYENHRVATTGEWDALMGD----KEFNKNSRIRMIEVMLPVMDAPSNLVQQAK 554
           G  D          ++++L+      K   K S+IR++EV+L  MD  + L + AK
Sbjct: 567 GDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAK 622

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 205/599 (34%), Positives = 320/599 (53%), Gaps = 55/599 (9%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAA 58
            I LG+Y+FER+     +TIFG+PGDFNLSLL+ IY     + G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SSQAKQLL 112
           DGY+R    + C+ITT GVGELSALNGIAG++AE V +LH+VGV PS     S+Q+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
            H      D  +    HR+        +S ++  + DI++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLKVPAKLLETPIDLSLKP-------NDAEAEKEVVDTILSLIKDAKNPVIL 217
           + +PA+  D  V A+ LE    + L+        ND + + E+ + IL  +  +  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 SDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVE 277
           +D    R+D+ +  ++L++ T    F + MGK  +DE +  F GVY G+ S+ +V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKT-KNIIEFHSDYTKIRNA-----TFPGVQMKFVLR 331
           + D +L VG + ++ NTG +SY +    NI+E H  Y    +A      +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLLASVADAAK---GYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITET 388
            ++  + D  K   GY+  ++P+R  E     P + +   ++     KF   GDV + +T
Sbjct: 380 DMMTQMIDPTKLHLGYQE-SIPSRTQE-YCGPPHSSVTHSYLQTHFPKFLSSGDVFVVDT 437

Query: 389 GTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEI-------------DPK 435
           G+  FG+    FP++   ISQ  + SIG      LG     ++              + +
Sbjct: 438 GSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQ 497

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKH 495
            R+IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+ER I G    YNDI  W+ 
Sbjct: 498 PRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEW 557

Query: 496 LMLLETFGAKDYEN---HRVATTGEWDALMGD-KEFNKNSR-IRMIEVMLPVMDAPSNL 549
             LL  FG    EN    +V++  +   L+   +  +K S+ +R++EVML VMD P  L
Sbjct: 558 TELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQL 616

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 213/612 (34%), Positives = 318/612 (51%), Gaps = 64/612 (10%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVP----GMRWAGNANELNAAYAA 58
            I  G+YLF++L Q   K+IFG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH-- 115
           DGY+R    ++ +ITT+GVGELSA+NG+AGS AE+V VLH+VGV  + S A +   HH  
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 116 -TLGNGDFT------VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
             L + +F        +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLKVPAKLLETPIDL--SLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHD 226
           A+  D  V    L   I+L  S++   +E    +VD +L  I  ++ P IL+D    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVG 286
           + ++  Q I+ TQ   FTT MGK  IDE +PR+ G+Y G      V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIIEFHSDYTKIRNAT------FPGVQMKFVLRKLLASVAD 339
              ++ N  +  + Y  +  +IEFH  Y ++ +        F  V    VL  L   + D
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRI-D 371

Query: 340 AAK-----------GYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITET 388
            +K            Y+P  +   +PE    D    + Q ++  +  +    GD+++++T
Sbjct: 372 ISKLNLQYDKAIFTTYEPSQL--NLPEEDTSD----VTQIYLQKKFPEILAPGDILVSDT 425

Query: 389 GTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDP-------------K 435
           G+  FG+     P  S  ++Q  W SIG    A LG     ++                K
Sbjct: 426 GSFQFGVRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYK 485

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKH 495
            +++L +GDG+ Q+TVQE++TM+R+++   +FV NN+GYTIER I GE + YNDI  W+ 
Sbjct: 486 PKLVLGVGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRW 545

Query: 496 LMLLETFGAKD--YENHR-VATTGEWDALMGDKEFNKNSR-IRMIEVMLPVMDAPSNLVQ 551
             L E FG  D  Y N   V T  E D  + D   NK  + I ++EV L VMD P+ L  
Sbjct: 546 TKLFEAFGDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL-- 601

Query: 552 QAKITAATNAKQ 563
           Q  ++   NAK+
Sbjct: 602 QMMLSNMKNAKK 613

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 212/614 (34%), Positives = 324/614 (52%), Gaps = 68/614 (11%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVP----GMRWAGNANELNAAYAA 58
           +I  G+Y+F+R+     K++FG+PGDFNL LL+ +Y+      G+RW G  NELNAAYAA
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  DGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQA---KQLLL 113
           DGY+R  +G+ C+ITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI SQ    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPANLVDLKVPAK-LLETPI----DLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSD 219
           + +P + V++ V  K LL+ P     D  L+ +      ++ + IL  I  +K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R+       + I  T+   FTT  GK  I+EQ+P + G+Y G      V +     
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NIIEFHSDYTKIRNA------TFPGVQMKFVLRK 332
           DLI++VG  +++ N G +++SY+    +IE H  Y ++ +        F G+    VL++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLASVADAAK---GYKPVAV---PARVPENKACDP-STPLAQEWMWNQCAKFFQEGDVII 385
           +L  + D  +    Y P      P    +  + DP S  + Q ++      +  +GDV++
Sbjct: 384 MLIKI-DIKRFDFDYDPSVTKFDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDGDVLV 442

Query: 386 TETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPK---------- 435
            ETG   F     L P+    I+Q  + SIG    A LG   A ++  P+          
Sbjct: 443 VETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKIPET 501

Query: 436 --KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNW 493
              R+IL  GDG+ Q+TVQE+S+ IR+N+   + +LNNDGYTIER I G    YNDI  W
Sbjct: 502 YNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAW 561

Query: 494 KHLMLLETFGAKDYENHRVATT---------GEWDALMGDKEFNKNSRIRMIEVMLPVMD 544
               + E  G  D++N     T          ++  L  + E NK   I  IEV+L V+D
Sbjct: 562 NWTKIFEALG--DFDNKATVNTTIKSPSKLLNKFKQLKNETERNK---IEFIEVILGVLD 616

Query: 545 APSNL---VQQAKI 555
            P  L   V+ AK+
Sbjct: 617 YPEQLKSMVEAAKV 630

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  316 bits (809), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 212/626 (33%), Positives = 325/626 (51%), Gaps = 77/626 (12%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY-------EVPGMRWAGNANELNAAY 56
           ITL +Y+F RL      ++FG+PGDFNL LL+ +Y       EV  + W G  NELNAAY
Sbjct: 17  ITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNAAY 76

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISS-QAKQLLLH 114
           AADGY+R    + C++TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  +H
Sbjct: 77  AADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYNIH 136

Query: 115 HTLGN--------GDFTVFHRMSAN-ISETTAMV--TDIATAPA-----EIDRCIRTTYV 158
           H++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  ++
Sbjct: 137 HSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNIFI 196

Query: 159 TQRPVYLGLPANLVDLKVPAKLL----ETPIDLSLKPNDAE----AEKEVVDTILSLIKD 210
           + +P YL +P+N+ ++ V +  L    +  +D +LK   +      E ++++ I  L+  
Sbjct: 197 SSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLLYK 256

Query: 211 AKNPVILSDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRP 270
           +K P IL D    R D + +  QLI       F+T +GK  IDE + RF G Y G  S  
Sbjct: 257 SKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTSDS 316

Query: 271 EVKEAVESADLILSVGALLSDFNTGSFSYSYKTKN-IIEFHSDYTKIR------NATFPG 323
            VK+  ES DLIL +G   ++ NTG +S+SY     IIE   DY KI       +     
Sbjct: 317 YVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKIIND 376

Query: 324 VQMKFVLRKLLASVADAA------------KGYKPVAVPARVPENKA-CDPSTPLAQEWM 370
           + ++ V++KLL  + D+               YK   +  +  EN         + Q+ +
Sbjct: 377 IMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQDDL 436

Query: 371 WNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFA-- 428
             +    F +GDV++ ETG+  F I   +FP  +  I+Q  + SIG    A LG      
Sbjct: 437 QVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIGMR 496

Query: 429 ----------AEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIER 478
                     +E+  PKK +ILF GDG+ Q+T+QE+S+++R+ +   +F+ NN+GYT+ER
Sbjct: 497 DYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTVER 555

Query: 479 LIHGEKAGYNDIQNWKHLMLLETFGAKDYE-----NHRVATTGEWDALMGD-KEFNKNSR 532
           +  GEK  YNDI  WK + LL+ FG  D+E     +  ++T  E    + + K  N    
Sbjct: 556 IFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQKI 613

Query: 533 IRMIEVMLPVMDAPSNL---VQQAKI 555
           I +IEV L  MD P NL   V+Q K+
Sbjct: 614 IELIEVKLGEMDIPKNLKHIVEQMKL 639

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  315 bits (806), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 206/607 (33%), Positives = 314/607 (51%), Gaps = 59/607 (9%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY---------EVPGMRWAGNANELNA 54
           IT G Y+F+RL  +  K++FG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SSQAK 109
           AY+ADGY+R    +SC+ITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLKVPAK-LLETP---IDLSLKPNDAEAE------KEVVDTILSLIKD 210
           RP YL +P+N  D+ V  K L++ P   +D +L  N  ++       K++   IL ++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILSDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRP 270
           ++ P ++ D    R+  K    + I+ T+   F TP+ K +IDE +  + G+Y G  S  
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 EVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIIEFHSDYTKI--------RNATF 321
           +V E  E++DL+L  G   ++ NTG +S+SY     +I+ +  Y ++            +
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHSELIY 382

Query: 322 PGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEG 381
             V    +L++LL  +  +   +K   +  RV +    +    + Q  +       F  G
Sbjct: 383 RDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQASLGQAFPSTFNPG 442

Query: 382 DVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEID-------- 433
           D+++ +TG   F I   +F +    I+Q  + SIG      LG   A ++          
Sbjct: 443 DILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAMQDYPLEHVYDKS 502

Query: 434 --PKK---RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYN 488
             PK    R+IL  GDG+ Q+TVQE+STMIR  +   +++ NNDGYTIER I G    YN
Sbjct: 503 KLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTIERAIMGPTRSYN 562

Query: 489 DIQNWKHLMLLETFG---AKDYENHRVATTGEWDALMGD-KEFNKNSRIRMIEVMLPVMD 544
           DI  W    LL +FG    K   +  + T  +  A + D KE + N  I  +EVML  +D
Sbjct: 563 DIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKCIEFMEVMLGKVD 622

Query: 545 APSNLVQ 551
            P  L Q
Sbjct: 623 YPPQLQQ 629

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  302 bits (773), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 192/609 (31%), Positives = 312/609 (51%), Gaps = 64/609 (10%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           + LG+YL+ +LAQ+  KTIFG+PGDFNLSLL+ +Y    +  G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPA 169
              ++        V+  M +  +    A +TD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLKVPAKL-----------LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILS 218
           +  D  +P  +           +E  +++ L P+       V D ILSL+  +K P I+ 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLEMVS--VCDYILSLLYSSKTPCIIG 263

Query: 219 DACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVES 278
           D    R  V  +   LI  T+   F+T M KG ++E +P + GVY G LS+  + + ++ 
Sbjct: 264 DILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQM 323

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTKNI-IEFHSDYTKIRNATFPGVQMKFVLRKLLASV 337
            DLI+  G + ++ NTG +S++YK  ++ I+ H DY +I       ++  +   +    V
Sbjct: 324 CDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQH-NIRTDYKGIEFRTFV 382

Query: 338 ADAAKGYKPVAVPARVPENKACDPST-------------PLAQEWMWNQCAKFFQEGDVI 384
               KG +P ++      N+   PS+             P++ +++     ++   GDV+
Sbjct: 383 DMVTKGVQPNSI--NTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINPGDVV 440

Query: 385 ITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEE------------- 431
           + ETG+  F +  +   ++   I+Q  + SIG    A LG   A  +             
Sbjct: 441 VCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKKSSHS 500

Query: 432 -IDP--KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYN 488
            + P  K R+IL  GDG+ Q+TVQEI+ +I++ +   + +LNN GYTIER I G    +N
Sbjct: 501 NVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGADKEFN 560

Query: 489 DIQNWKHLMLLETFGAKDYENHR----VATTGEWDALMGDKEFNKNSRIRMIEVMLPVMD 544
           DI  W    LL   G    E        +TT  ++ L   K++        +EV+L  ++
Sbjct: 561 DICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVILNKLN 620

Query: 545 APSNLVQQA 553
            P+ L++ A
Sbjct: 621 IPTTLIKMA 629

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  303 bits (775), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 201/606 (33%), Positives = 312/606 (51%), Gaps = 58/606 (9%)

Query: 2   AEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVP-------GMRWAGNANELNA 54
           A+I  G Y+F+RL  V VK+IFG+PGD+N+ LL+ +Y+          + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISSQA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVT 159
           +   LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVDLKVPAK-LLETP---IDLSLKPNDAEAEKEVVDTILSLIKDAKNPV 215
            +P YL +P + VD  V  K L+E P   +   ++ +  +  K V + IL L+  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 216 ILSDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEA 275
           ++ D    R+ ++ E    I+      F+T  GK  IDE  P + G Y G  S P V E 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTK-NIIEFHSDYTKIRNAT------FPGVQMKF 328
           + + DL+L  G   ++ N G++++ +K+   I+E H  Y +  + T      + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 329 VLRKLLAS--VADAAKGYKPVAVPARVPE------NKACDPSTPLAQEWMWNQCAKFFQE 380
           +L  L  S  +++ +  Y        + E      +   D ++ + Q  +      +   
Sbjct: 420 ILDLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDITQGTLQKSMPNYLNP 479

Query: 381 GDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEI------DP 434
           GDV+I++TGT  F I     P+    I+Q  + SIG    A LG   A  +       D 
Sbjct: 480 GDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHVWDV 539

Query: 435 KK-------RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGY 487
           +K       +VILF GDG+ Q+TVQE+STMIR  +   +F+ NN+GYTIER+I G    Y
Sbjct: 540 EKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPTRPY 599

Query: 488 NDIQNWKHLMLLETFGAKDYENHR---VATTGEWDALMGDKEFNKNSR-IRMIEVMLPVM 543
           NDIQ WK   LLE FG  D ++ R   + T  + +  + + ++  + R I  +EV L  M
Sbjct: 600 NDIQPWKWTKLLEAFGDFDGKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKLATM 659

Query: 544 DAPSNL 549
           D PS L
Sbjct: 660 DVPSQL 665

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  301 bits (771), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 205/600 (34%), Positives = 309/600 (51%), Gaps = 64/600 (10%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAAD 59
           I  G Y+FERL     K+IFG+PGDFNL LL+ +Y+      G++W G  NELN AYAAD
Sbjct: 32  IPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAYAAD 91

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q     +H
Sbjct: 92  GYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSHNVH 151

Query: 115 HTLGNGDF-------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGL 167
           H +   D          F  +   +  ++A + DI TA   +D+ I       +P Y+ +
Sbjct: 152 HLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGYVFI 211

Query: 168 PANLVDLKVPAK-LLETPI---DLSLKP-NDAEAEKEVVDTILSLIKDAKNPVILSDACA 222
           P +  D  V  K L++ PI   D  ++   D  A K   D +L  I ++  P + SD   
Sbjct: 212 PVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSDLLV 271

Query: 223 SRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLI 282
            R +++ E +Q I+      + T MGK ++DE++P++ G+Y G  +  E++  V+S+DLI
Sbjct: 272 DRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSSDLI 331

Query: 283 LSVGALLSDFNTGSFSYSYK--------TKNIIEF----HSDYTKIRNATFPGVQMKFVL 330
           L  G   ++ N G +S+ +         + NII+F      + + +  A F  V +K+V 
Sbjct: 332 LHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFIDIKDKNASTVEEANFVSV-LKYVN 390

Query: 331 RKLLASVADAAKGYKPVAVPARVPENKAC--DPSTPLAQEWMWNQCAKFFQEGDVIITET 388
             L  S    +  Y PV        N +C  D +  + Q+ +      +F +GDV+I ET
Sbjct: 391 DNLDKS--KLSFSYPPVP-----KSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVET 443

Query: 389 GTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEE----------IDPKK-- 436
           G+  FG+    F      I+Q  + SIG    A LG      +          + PK   
Sbjct: 444 GSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYI 503

Query: 437 -RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKH 495
            R+IL  GDG+ Q+T+QE ++ IR+ +   + V NN+GYT+ER I+G    YNDI  +K 
Sbjct: 504 PRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKW 563

Query: 496 LMLLETFGAKDYENH-----RVATTGEWDALMGD-KEFNKNSRIRMIEVMLPVMDAPSNL 549
             LL  FG  D+EN       V    E   L+   K   + + I++ EVMLPVMD P  L
Sbjct: 564 TALLNVFG--DFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQEL 621

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  301 bits (771), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 208/605 (34%), Positives = 306/605 (50%), Gaps = 64/605 (10%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPG---MRWAGNANELNAAYAAD 59
           +I LG+YL  RL  +  K+ FG+PGDFNL LL+ +Y   G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  S+ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLKVPAK-LLETP-IDLSLKPNDAEAEK--EVVDTILSLIKDAKNPVILSDAC 221
            +P++  +  V +K L+  P I+LS   N    EK   + + I+ LI ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 ASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL 281
             R          I  T+F  F+T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIIEFHSDYTKIRNAT---------FPGVQMKFVLR 331
            L  G  +++ N+G++S+ + K   IIE + +Y KI             +P V M  +L 
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLLASV--ADAAKGYKPVAVPARVPENKACDPSTPLAQE--------WMWNQCAKFFQEG 381
            L+A V   DA   Y        V      +   PL QE         +  +   F   G
Sbjct: 376 GLIAKVNIHDANTNYD-----KSVKSYDTSELVLPLQQEDEEKITQVHLQRELPNFLNPG 430

Query: 382 DVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPK------ 435
           DV++ ETG+  F +    FP+N   ISQ  + SIG    A LG   A ++  PK      
Sbjct: 431 DVLVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDH 489

Query: 436 -------KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYN 488
                   R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NN+GYT+ER I G    YN
Sbjct: 490 SLARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYN 549

Query: 489 DIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGD----KEFNKNSRIRMIEVMLPVMD 544
           DI  W    LL   G  + E +R  T  +   L       KE   N+ I++IEV L   D
Sbjct: 550 DIMPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHD 609

Query: 545 APSNL 549
            P  L
Sbjct: 610 IPRQL 614

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  297 bits (760), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 202/614 (32%), Positives = 303/614 (49%), Gaps = 56/614 (9%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEV----PGMRWAGNANELNAAYAA 58
           +I LGKYLF+R+     K+IFG+PGDFNL LL+ +YE      G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTL 117
           DG++R    + C+ITT+GVGELSALNG+AG++AE+V +LH+VGV   S++ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
            N   + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLV-DLKVPAKLLETP-IDL--SLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASR 224
            + V +L     LL TP IDL  SL   D     EV   I   I  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILS 284
           +D        I  T+   FTT  GK  IDE +P + G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIIEFHSDYTKIRNAT------FPGVQMKFVLRKLLASV 337
            G  +++ N G +++ YK    I+E H  Y +  +        F G+   FVL++L+  +
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 --ADAAKGY-----KPVAVPARVPENKACD-PSTPLAQEWMWNQCAKFFQEGDVIITETG 389
              +    Y     K  +   + PE+   D  ++ + Q  +      +   GD+++ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAA-------------FAAEEIDPKK 436
           +  F +   + P     +SQ  + SIG    A +G               F A + + K 
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKHL 496
           R+IL  GDG+ Q+TVQE+++MIR+ +   + + NN+GYT+ER I G    YNDI  W   
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 MLLETFGAKDYENHRVATTG-------EWDALMGDKEFNKNSRIRMIEVMLPVMDAPSNL 549
            L   FG  D+E     +T                 E N++  I M+EV L VMD P  L
Sbjct: 567 KLFAAFG--DFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDI-IEMVEVKLGVMDYPHQL 623

Query: 550 VQQAKITAATNAKQ 563
               +       +Q
Sbjct: 624 KHMVEAAKVRQVRQ 637

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  290 bits (742), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 196/597 (32%), Positives = 307/597 (51%), Gaps = 56/597 (9%)

Query: 3   EITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYE-----VPG-MRWAGNANELNAAY 56
            I  GKY+F RL     K++FG+PGD+NL+LL+++Y+      P  ++W G  NELNAAY
Sbjct: 37  RIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAAY 96

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH 115
           AADGY+R    + C+ITT+GVGELSA+NGIAG++ E+V +LH+VGV S          HH
Sbjct: 97  AADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFHH 156

Query: 116 TLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLG 166
            + N +        + +   M  N IS +T  + +IATA  + D  +R  +   +P +L 
Sbjct: 157 LIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFLF 216

Query: 167 LPANLVDLKVP-AKLLETP---IDLSLKPNDAEAEKEVVDTILSLIKD----AKNPVILS 218
           +P    +L V  A L   P   ++ S+ P  +    + +D +  + KD    +K P I+ 
Sbjct: 217 IPEEFSNLMVSDANLFLVPKITLEDSIIP--SPISYDSIDRLTQITKDLIYQSKRPAIIG 274

Query: 219 DACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVES 278
           D    R        +LI  T    F+T MGK  I+E +  + G++ G   + EV + +  
Sbjct: 275 DILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQ 334

Query: 279 ADLILSVGALLSDFNTGSFS---YSYKTKNIIEFHSDYTKIRNATFPGV----QMKFV-L 330
            DLIL  G   ++ N+G ++   Y  K   IIEFHS+Y KI++ +   V     + F+ +
Sbjct: 335 CDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIHV 394

Query: 331 RKLLASVADAAKGYKPVAVPARVPENKACDPSTP---LAQEWMWNQCAKFFQEGDVIITE 387
            K L  + D +K        ++  + +  D       + Q+++ +   K    GD+++ +
Sbjct: 395 LKRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLCD 454

Query: 388 TGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEE------------IDPK 435
           TGT  F +     P     ISQ  + SIG    A LG     ++            I  +
Sbjct: 455 TGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKTQ 514

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWKH 495
            ++IL  GDG+ Q+T+QEIST+IR+ +   +F+ NNDGYTIER I G    YNDIQ W  
Sbjct: 515 PKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWNW 574

Query: 496 LMLLETF--GAKDY-ENHRVATTGEWDALM---GDKEFNKNSRIRMIEVMLPVMDAP 546
            ML+++F    K + + ++V    E+  L+       FN++S +  IEV L  +D P
Sbjct: 575 TMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVP 630

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  281 bits (720), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 187/573 (32%), Positives = 292/573 (50%), Gaps = 33/573 (5%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEV--PGMRWAGNANELNAAYAA 58
           M+ + LG YLF RL+QV  KT+FG+PGDFNL+LL+ +Y      ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLL---HH 115
           DGY+RI    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ ++     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMVTD--IATAPAEIDRCIRTTYVTQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLKVPAKL-LETPIDLSLKPN-DAEAEKEVVDTILSLIKDAKNPVILSDACASRH 225
           P+NL D ++P  L  +   D   K   D  A  E+V   L  I  ++NP  + D    R 
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIVDQFM-RF 238

Query: 226 DVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSV 285
           D++ +    ++   F  + T   +G  DE  P F GV+   LS     E ++  D IL +
Sbjct: 239 DLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILHL 297

Query: 286 GALLSDFNTGSF----SYSYKTKNIIEFHSDYTKI--RNATFPGVQMKFVLRKLLASVAD 339
           G   ++ N  S+    S     K++I    DY ++        G+       +LL  +  
Sbjct: 298 G---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMNS 354

Query: 340 AAKGYKPVAVPARVPENKAC--DPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQ 397
                        +  N     D S  + Q  +    +   +E DVII E  +  F +  
Sbjct: 355 KTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFEMPN 414

Query: 398 SLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTM 457
             +      + Q  +GSIG+   A LGA+ A ++     RVILF GDGS Q+T+QE+++ 
Sbjct: 415 IKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQELASY 474

Query: 458 IRWNLKPYLFVLNNDGYTIERLIHGEKAGYND-IQNWKHLMLLETFGAKDYE---NHRVA 513
           IR+ + P +F+LNN GY++ER+I G    YND I +W    +L  FG ++ +   +++V 
Sbjct: 475 IRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSYKVE 534

Query: 514 TTGEWDALMGDKEFNKNSRIRMIEVMLPVMDAP 546
             GE   ++  +    + +I+M+E++L  MD P
Sbjct: 535 KLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  265 bits (677), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 172/565 (30%), Positives = 279/565 (49%), Gaps = 19/565 (3%)

Query: 5   TLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL Q  +K  F +PGD+NL LLDK+ E P +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVD-LKVPAKLLET 183
            + M+  I+     +     AP+ ID  IR     ++P Y+ +P N+   +  P   + +
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 184 PIDLSLKPND--AEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFP 241
            ++    P D  ++A    VD I S +K    P +L+       D +    +L +A +  
Sbjct: 183 LVNSVPTPKDVLSQAVNASVDFINSHLK----PTLLAGPKLKCADAQKAFLRLAEALKCA 238

Query: 242 AFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
               P  K    E HP+F GVY G +S  +    +E +DL +  G + +D++T  ++   
Sbjct: 239 VAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQ 298

Query: 302 KTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGY-KPVAVPARVPENKACD 360
            + + +E  +D  +    +F  + +   L  L   V++  K   +   +    P  KA D
Sbjct: 299 PSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAAD 358

Query: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420
           P   + ++ M  Q  +       +  ETG S F   Q   P  ++   ++ WG IG++  
Sbjct: 359 PKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSVP 418

Query: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480
           A LG A  A    P +R+I  +GDGS Q+T QE+S M+R      +F++NN GYTIE  I
Sbjct: 419 ASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVEI 474

Query: 481 HGEKAGYNDIQNWKHLMLLETFGAKD--YENHRVATTGEW-DALMGDKEFNKNSRIRMIE 537
           H     YN+I+NW +  L+E F A +   +  +  T GE  DA+  +K     S   +IE
Sbjct: 475 H--DGPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAI--EKAQANVSGPTLIE 530

Query: 538 VMLPVMDAPSNLVQQAKITAATNAK 562
           + +   D  + L+      A  NA+
Sbjct: 531 IQINRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  259 bits (661), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 170/567 (29%), Positives = 274/567 (48%), Gaps = 23/567 (4%)

Query: 5   TLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL++V ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 ID--LSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
           I+  L   P++ +     VD    LI     P +L+         +    +L +A     
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
              P  K    E HP++ GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARV----PENKA 358
             + IE  SD  K  +  +  +++   L  L   V   +K  K V    R+    P  KA
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKV---SKNDKSVVEYQRLRPVPPAIKA 357

Query: 359 CDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFT 418
            +PS  + ++ M  Q          +  ETG S F   Q   P  +    ++ WG IG++
Sbjct: 358 AEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 GGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIER 478
             A  G +  A    P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIHGEKAGYNDIQNWKHLMLLETFGAKD--YENHRVATTGEWDALMGDKEFNKNSR-IRM 535
            IH     YN+I+NW +  L+E F A D   +  +V T  E    +  K+   N+R   +
Sbjct: 474 EIH--DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAI--KKAKSNTRGPTL 529

Query: 536 IEVMLPVMDAPSNLVQQAKITAATNAK 562
           IE+ +   D  + L+      A  NA+
Sbjct: 530 IEIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  258 bits (659), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 170/567 (29%), Positives = 274/567 (48%), Gaps = 23/567 (4%)

Query: 5   TLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL++V ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 ID--LSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
           I+  L   P++ +     VD    LI     P +L+         +    +L +A     
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
              P  K    E HP++ GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARV----PENKA 358
             + IE  SD  K  +  +  +++   L  L   V   +K  K V    R+    P  KA
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKV---SKNDKSVVEYQRLRPVPPAIKA 357

Query: 359 CDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFT 418
            +PS  + ++ M  Q          +  ETG S F   Q   P  +    ++ WG IG++
Sbjct: 358 AEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 GGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIER 478
             A  G +  A    P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIHGEKAGYNDIQNWKHLMLLETFGAKD--YENHRVATTGEWDALMGDKEFNKNSR-IRM 535
            IH     YN+I+NW +  L+E F A D   +  +V T  E    +  K+   N+R   +
Sbjct: 474 EIH--DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAI--KKAKSNTRGPTL 529

Query: 536 IEVMLPVMDAPSNLVQQAKITAATNAK 562
           IE+ +   D  + L+      A  NA+
Sbjct: 530 IEIQINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  243 bits (620), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 171/560 (30%), Positives = 279/560 (49%), Gaps = 59/560 (10%)

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL--- 112
           ADG++R    + C+ITT+GVGELSALNGIAG+++E+V VLH+VGV  S+ S+++      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLKV-PAKLLETPIDLSLKPNDAEAEKEVVD----TILSLIKDAKNPVILS 218
           Y+ +P +  D+ V P+ L + P +++L+   + A   VVD     +L  I ++K P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVES 278
           D    R    +    LI  T    F T MGK  IDE +  + G+Y G  S   V E    
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIIEFHSDYTKIRNAT------FPGVQMKFVLR 331
           +DL+L  G  + + N G ++ +YK    +IEFHS+Y +  +A+      F GV    VL 
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLASVADAAKGYKPVAVPARVPENKACDPSTP-----LAQEWMWNQCAKFFQEGDVIIT 386
           +L+ ++      ++  +   +   ++   P+ P     + Q ++      +   GDV++ 
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVC 361

Query: 387 ETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEI-------------- 432
           ETG+  F I   + P+    I+Q  + SIG    A  G   A ++               
Sbjct: 362 ETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVE 421

Query: 433 ---DPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYND 489
              D + R+IL  GDG+ Q+T+QE+++M+R+ +   + +LNN+GYTIER I G    YND
Sbjct: 422 IPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYND 481

Query: 490 IQNWKHLMLLETFGAKDYENHRVATTG---EWDALMGDKEFNKNSR---IRMIEVMLPVM 543
           + +W    LLE FG  D++  R  +          M  K+     +   I ++E+ L  M
Sbjct: 482 VMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTM 539

Query: 544 DAPSNLVQQAKITAATNAKQ 563
           D P  L  Q+ + AA   ++
Sbjct: 540 DFPKQL--QSMVDAAAFTRK 557

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 87.8 bits (216), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 58/92 (63%), Gaps = 6/92 (6%)

Query: 386 TETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDG 445
           TETG S    NQ++   ++  ISQVLW  I F  GA L    +AE+IDP  R ILF GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATL----SAEDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTMIRWNLKPYLFVLNNDGYTIE 477
            L LTVQE+ T IRW LKPYLFV NND   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 132/564 (23%), Positives = 228/564 (40%), Gaps = 71/564 (12%)

Query: 7   GKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MS-CIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
            +  ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LKVPAKLL 181
              +S + ++   MV  +A  P  I+         +  PV + LP ++    L+ P  + 
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPIK 265

Query: 182 ET-PIDLSLKPNDAEA-EKEVVDTILSLIKDAKNPVI-LSDACASRHDVKAETKQLIDAT 238
            T PI   LK    EA   E ++    LI  AK PV+ + +   +  D     K+L D  
Sbjct: 266 STLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDRA 325

Query: 239 QFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFS 298
           Q P  TT  G G+ D++ P+   + +G         A+++ADL++++GA   D  TG   
Sbjct: 326 QIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTG--- 381

Query: 299 YSYKTKNIIEFHSDYTKIRNATFPGV--------QMKFVLRKLLASVADAAKGYKPVAVP 350
                 NI +F  +  +       G+         +  V+   +A   DAA     + +P
Sbjct: 382 ------NIAKFAPEARRAALEERGGIIHFEISPKNINKVVEAQVAVEGDAASNVSKL-LP 434

Query: 351 ARVPENKACDPSTPLAQEWMWNQCAKFFQEG-------DVIITETGTSAFGINQSLFPNN 403
              P  +  D    + Q W       + +E          +I++    A G  + +    
Sbjct: 435 LVFPVKERKDWFKQINQ-WKKEYPYSYMKETAESKIKPQTVISKLSKIANGTGKPVVVTT 493

Query: 404 SVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSL 447
            VG  Q +W                G +G T G  L AA  A+   P   VI   GD S 
Sbjct: 494 GVGQHQ-MWAAQHWTWKHPRSFITSGGLG-TMGYGLPAAIGAQVARPDAIVIDIDGDASF 551

Query: 448 QLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWKHLMLLETFG 503
            +T+ E+S+ ++  +   + +LNN+   +    + L +  +  +    N   + L +  G
Sbjct: 552 NMTLTELSSAVQAGVPIKILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFMKLADAMG 611

Query: 504 AKDYENHRVATTGEWDALMGDKEF 527
            K     RV   GE D  +  KEF
Sbjct: 612 LKGI---RVKNQGELDGAL--KEF 630

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 143/588 (24%), Positives = 233/588 (39%), Gaps = 89/588 (15%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDA------EAEKEVV----DTILSLIKDAKNPVILSDACASRH-DVK 228
           L  PI      P++A       A+ E V    +    LI  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P  TT  G GS D++ P+   + +G         AV++ADLI++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS-------------------YSYKTKNI-------IEFHSDYT----KIRN 318
             D  TG+ S                   +    KNI       I    D T    K+ +
Sbjct: 377 FDDRVTGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNLGKMMS 436

Query: 319 ATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFF 378
             FP  +      +  A +    K Y P A     P +K   P T      +  + +K  
Sbjct: 437 KIFPVKERS----EWFAQINKWKKEY-PYAYMEETPGSK-IKPQT------VIKKLSKVA 484

Query: 379 QE-GDVIITETGT---SAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDP 434
            + G  +I  TG      +      + N    I+    G++G+     L AA  A+   P
Sbjct: 485 NDTGRHVIVTTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYG----LPAAIGAQVAKP 540

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDI 490
           +  VI   GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +  +   
Sbjct: 541 ESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHRYSHTHQ 600

Query: 491 QNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
            N   + L E  G K     RV    E DA +  KEF       ++EV
Sbjct: 601 LNPDFIKLAEAMGLKGL---RVKKQEELDAKL--KEFVSTKGPVLLEV 643

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 141/577 (24%), Positives = 235/577 (40%), Gaps = 89/577 (15%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +A+ +V T+FG PG   L + D I+     ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV ++A  P  I+   +  T     PV + LP +     V A +
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAI 247

Query: 181 LETPIDL-SLKPNDAEAE-------KEVVDTI---LSLIKDAKNPVI-LSDACASRHDVK 228
           L TPI + S  P+ A  +       + V++ I     LI  AKNPV+ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L +  Q P  TT  G G+ D++ P+   + +G         AV+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVA 348
             D  TG         NI +F  +  K       G+    +  K +  V +A      VA
Sbjct: 367 FDDRVTG---------NITKFAPEARKAALEGRGGIIHFEITPKNINKVVEAQ-----VA 412

Query: 349 VPARVPEN--KACDPSTPLAQEWMW----NQCAKFF-------QEGDVIITETGTS---- 391
           V      N  K      P+ +   W    N+  K F         G  I  +T  +    
Sbjct: 413 VEGDAASNLSKLIPLVFPVKERPEWFEKINKWKKEFPYSYSLETPGSRIKPQTAIAKLSK 472

Query: 392 -AFGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDP 434
            A   ++ +     VG  Q +W                G +G T G  L +A  A+   P
Sbjct: 473 IANATSKEVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLG-TMGYGLPSAIGAQVAKP 530

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDI 490
              VI   GD S  +++QE+S+ ++ N    + VLNN+   +    + L +  +  +   
Sbjct: 531 DALVIDIDGDASFNMSLQELSSAVQANAPVKILVLNNEEQGMVTQWQSLFYEHRYSHTHQ 590

Query: 491 QNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEF 527
            N   + L E  G K     RV    E +  +  KEF
Sbjct: 591 LNPDFVKLAEAMGMKGM---RVKDQAELEKTL--KEF 622

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 119/498 (23%), Positives = 200/498 (40%), Gaps = 60/498 (12%)

Query: 9   YLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM- 67
           Y    L    V T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL GI  S +    +L + G    SS+A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 128 MSANISETTAMVTDIATAPAEI---DRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLETP 184
           +S  +         + ++  ++   D      Y T    YL +P NL+   V    L  P
Sbjct: 113 VSL-LKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSLP-P 170

Query: 185 IDLSLKPN---DAEAEKEVVDTILSLIKDAKNP--VILSDACASRHDVKAETKQLIDATQ 239
           +     P    D  A +EV D I       KNP  V++     + H    E +Q +D  Q
Sbjct: 171 VKNIYVPKSSPDPSAVQEVTDLI------RKNPENVLVVVGKGAVH-ASQEIRQFVDRFQ 223

Query: 240 FPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSY 299
            P   TPMGKG + + HP         +S    + A++ A ++L +GA L+     + + 
Sbjct: 224 LPFLPTPMGKGVVPDSHPL-------NVSSARSR-ALQEAKVVLVLGARLNWILHFASAP 275

Query: 300 SYKTKNI-IEFHSDYTKIRNATFPGVQMKF------VLRKLLASVAD-AAKGYKP----- 346
            +    + I+  SD T + +  F    +         +R + AS+ D  ++G  P     
Sbjct: 276 KWNPDALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSN 335

Query: 347 -VAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSV 405
                A++   ++   S+ L    ++        +   II   G +     +  FP +  
Sbjct: 336 IARNAAKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPTDYP 395

Query: 406 GISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPY 465
              Q L      T G  +G A AA+  +P K V++  GD +   +  +I T  R  L   
Sbjct: 396 --LQRLDAGTNATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGLALI 453

Query: 466 LFVLNNDGYTIERLIHGE 483
           + V+NN G     + HG+
Sbjct: 454 VIVMNNGG-----IYHGQ 466

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 122/516 (23%), Positives = 214/516 (41%), Gaps = 76/516 (14%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +A+ +V T+FG PG   L + D IY+    ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMSCII-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G   I+  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   M+ ++A  P  I+      T     PV + LP +     V A +
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 252

Query: 181 LE--TPIDLSLKPNDA------EAEKE-VVDTI---LSLIKDAKNPVI-LSDACASRHDV 227
           L    P+  SL P++A      +A+ E V+D I     LI  AKNPV+ +        D 
Sbjct: 253 LRDAIPVGSSL-PSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDG 311

Query: 228 KAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               KQL +  Q P  T+ +G G+ D++ P+   + +G         A+++ADLI+++G 
Sbjct: 312 PKLLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGT 370

Query: 288 LLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGV--------QMKFVLRKLLASVAD 339
              D  TG         NI +F  +  +       G+         +  V+   +A   D
Sbjct: 371 RFDDRVTG---------NIAKFAPEARRAALENRGGIIHFEISPKNINKVVEAQIAVEGD 421

Query: 340 AAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEG-------DVIITETGTSA 392
           A    + + +P   P  +  +    + +EW       + +E          +I++    A
Sbjct: 422 ATANLQSI-LPKIFPVKERTEWFAKI-KEWKTKYPYSYMKETPNSKLKPQTVISKLSKIA 479

Query: 393 FGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDPKK 436
               + +     VG  Q +W                G +G T G  L AA  A+   P  
Sbjct: 480 NATGKEVIVTTGVGQHQ-MWAAQHWTWKHPRTFITSGGLG-TMGYGLPAAIGAQVAKPDA 537

Query: 437 RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
            VI   GD S  +T+ E+S+ ++      + +LNN+
Sbjct: 538 LVIDIDGDASFNMTLTELSSAVQAGAPVKILLLNNE 573

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 135/581 (23%), Positives = 219/581 (37%), Gaps = 103/581 (17%)

Query: 7   GKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + +  V T+FG PG   L++ D IY      +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 196

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVD--LKVPAK 179
               +S + ++   MV  +   P  I+       V+ R  PV + LP ++    LK P  
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILKTPIP 255

Query: 180 LLET-PIDLSLKPNDAEAE---KEVVDTILSLIKDAKNPVI-LSDACASRHDVKAETKQL 234
           +  T P D   K   A A+   K  +  +  LI  AK P++ +      R D     +QL
Sbjct: 256 VNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKLLRQL 315

Query: 235 IDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSD--- 291
            D  Q P  TT  G G+ D++ P+   + +G         +V++ADLI+++GA   D   
Sbjct: 316 ADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDDRVT 374

Query: 292 FNTGSFS----------------YSYKTKNI-------IEFHSDYTKIRNATFPGVQMKF 328
            N   F+                +    KNI       +    D T       P V    
Sbjct: 375 LNVSKFAPEARQAALENRGGIVHFEISPKNINKVVEAQVAVEGDVTDNLELLLPMVNKVE 434

Query: 329 VLRKLLASVADAAKGY-------------KPVAVPARVPE-----NKACDPSTPLAQEWM 370
             ++ L  +    K Y             KP  V AR+ E      +    +T + Q  M
Sbjct: 435 ERKEWLGQIDAWKKEYPYDYQRETKGSLIKPQTVIARLSEIASGTGREVIVTTGVGQHQM 494

Query: 371 WNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAE 430
           W      ++     IT  G                       G++G+     L AA  A+
Sbjct: 495 WAAQHWTWRHPRSFITSGG----------------------LGTMGYG----LPAAIGAQ 528

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAG 486
              P   VI   GD S  +T+ E+S+ ++      + VLNN+   +    + L +  +  
Sbjct: 529 VAKPDALVIDIDGDASFNMTLMELSSAVQAGAPVKILVLNNEEQGMVTQWQSLFYEHRYS 588

Query: 487 YNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEF 527
           +    N   + L E  G K     R+    + DA +  KEF
Sbjct: 589 HTHQLNPDFVKLAEAMGLKGL---RLTEQKDMDATL--KEF 624

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 138/588 (23%), Positives = 230/588 (39%), Gaps = 89/588 (15%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDA----------EAEKEVVDTILSLIKDAKNPVILSDACASRH-DVK 228
           L  PI      P++A          E   + ++    LI  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L    Q P  TT  G GS D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS-------------------YSYKTKNI-------IEFHSDYT----KIRN 318
             D  TG+ S                   +    KNI       I    D T    K+ +
Sbjct: 377 FDDRVTGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNIEKMMS 436

Query: 319 ATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFF 378
             FP  +      +    +    K Y P A     P +K   P T      +  + +K  
Sbjct: 437 KIFPVKERS----EWFDQINKWKKKY-PYAFMKETPGSK-IKPQT------VIKKLSKIA 484

Query: 379 QE-GDVIITETGTSA---FGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDP 434
            + G  +I  TG      +      + N    I+    G++G+     L AA  A+   P
Sbjct: 485 NDTGRHVIVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYG----LPAAIGAQVAKP 540

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDI 490
           +  VI   GD S  +T+ E+S+ ++      + VLNN+   +    + L +  +  +   
Sbjct: 541 ESLVIDIDGDASFNMTLTELSSAVQAGTPVKILVLNNEEQGMVTQWQSLFYEHRYSHTHQ 600

Query: 491 QNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
            N   + L +  G K     RV    E DA +  KEF       ++EV
Sbjct: 601 LNPDFVKLADAMGLKGL---RVKKQEELDAKL--KEFVSTKGPVLLEV 643

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 207/519 (39%), Gaps = 82/519 (15%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + +  V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +S+ A        +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPMVVFTGQVSTTA--------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAK 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V A 
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 248

Query: 180 LLETPIDL-SLKPNDA--EAEKEVVDTIL--------SLIKDAKNPVILSDACASRHDVK 228
           +L  PI   S  P+DA  +  K  VD            LI  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 AE-TKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
            +  K+L +  Q P  TT  G G+ D++ P+   + +G         AV++ADLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPV 347
              D           T NI +F  +  K       G+    +  K +  V +A      V
Sbjct: 368 RFDD---------RVTCNISKFAPEARKAALEHRGGIVHFEISPKNINKVVEAQ-----V 413

Query: 348 AVPARVPEN--KACDPSTPLAQ--EWM-----WNQCAKF-FQ---EG-----DVIITETG 389
           AV   V  N  K     TP+ +  EW      W +   + +Q   EG       +I E  
Sbjct: 414 AVEGDVTRNLEKLIPLVTPVKERKEWFDQINEWREKYPYEYQKETEGSKIKPQTVIAELS 473

Query: 390 TSAFGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEID 433
             A    +++     VG  Q +W                G +G T G  L AA  A+   
Sbjct: 474 KMANATGKNVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLG-TMGFGLPAAIGAQVAK 531

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
           P   V+   GD S  +T+ E+S+ ++      + +LNN+
Sbjct: 532 PDAIVVDIDGDASFNMTLMELSSAVQARAPVKILLLNNE 570

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 133/582 (22%), Positives = 231/582 (39%), Gaps = 83/582 (14%)

Query: 7   GKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPAKLLET 183
              +S + ++   MV  +A  P  I+         +  PV + LP +     V A +L  
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPKD-----VTAAILRE 257

Query: 184 PIDL-SLKPNDA-------EAEKEVVDTI---LSLIKDAKNPVI-LSDACASRHDVKAET 231
           PI + S  P+           E  + D+I     LI  AK PV+ + +   +  D     
Sbjct: 258 PIPIKSTLPSGTLTQIKSIAQEDFLADSINRAADLINLAKKPVLYVGNGIFNNEDGPRLL 317

Query: 232 KQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSD 291
           K+L +  Q P  TT  G G+ D++ P+   + +G         A+++ADLI++VGA   D
Sbjct: 318 KELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGARFDD 376

Query: 292 FNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGV--------QMKFVLRKLLASVADAAKG 343
             TG         NI +F  +  +  N    G+         +  V+   +A   DAA  
Sbjct: 377 RVTG---------NIAKFAPEARRAANEGRGGIIHFEISPKNINKVVEAQVAVEGDAAAN 427

Query: 344 YKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQE-------GDVIITETGTSAFGIN 396
              + +PA  P  +  +    + Q W  +    + +E          +I++    A    
Sbjct: 428 IDKM-LPAIFPIKERTEWFKEINQ-WKKDYPYDYMKEVPGGKLKPQTVISKLSKVANATG 485

Query: 397 QSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDPKKRVIL 440
           + +     VG  Q +W                G +G T G  L +A  A+   P+  VI 
Sbjct: 486 RPVIVTTGVGQHQ-MWTAQHWTWKHPRSFITSGGLG-TMGYGLPSAIGAQVAHPEALVID 543

Query: 441 FIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWKHL 496
             GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +  +    N   +
Sbjct: 544 IDGDASFNMTLTELSSAVQAGTPVKIMILNNEEQGMVTQWQSLFYENRYSHTHQLNPDFM 603

Query: 497 MLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
            L +  G K     RV    E D  +  KEF       ++EV
Sbjct: 604 KLADAMGLKGI---RVKKQEELDGAL--KEFVSTPGPVLLEV 640

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 117/513 (22%), Positives = 205/513 (39%), Gaps = 70/513 (13%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 241

Query: 181 LETPIDL-SLKPNDA----------EAEKEVVDTILSLIKDAKNPVILSDACASRHDVKA 229
           L  PI + S  P++A          E  +E +    SLI  AK PV+        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              ++L +  Q P  T+ +G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVAD---AAKGYK 345
             D  TG         NI +F  +  +       G+    +  K +  V D   A +G  
Sbjct: 361 FDDRVTG---------NIAKFAPEARRAALENRGGIIHFEITAKNINKVVDTQVAVEGDA 411

Query: 346 PVAVPARVPENKACDPST---PLAQEWMWNQCAKFFQE-------GDVIITETGTSAFGI 395
              +   +P   A         L ++W       + +E          II +    A   
Sbjct: 412 AANLEKLLPNIFAVKERKDWFDLIEDWKQKYPYSYMKEEPGSRIKPQTIIAKLSKLANES 471

Query: 396 NQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDPKKRVI 439
           N+       VG  Q +W                G +G T G  L +A  A+   P   VI
Sbjct: 472 NRETIVTTGVGQHQ-MWAAQHWTWKHPRTFITSGGLG-TMGFGLPSAIGAQVAKPDSMVI 529

Query: 440 LFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
              GD S  +T+ E+++ ++ +    + +LNN+
Sbjct: 530 DIDGDASFNMTLMEMTSAVQASAPVKVLLLNNE 562

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 129/579 (22%), Positives = 214/579 (36%), Gaps = 114/579 (19%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +T G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LK 175
                    +S + ++   MV  +   P  I+         +  PV + LP ++    LK
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKDVTAAVLK 281

Query: 176 VPAKLLETPIDLSLKPN-----DAEAEKEVVDTILSLIKDAKNPVILSDA-CASRHDVKA 229
            P  +L   +  +   N       +   E +     LI  AK PVI + A   S  +   
Sbjct: 282 NPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGPT 341

Query: 230 ETKQLIDATQFPAFTTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKEAVESADLIL 283
             K+L + +Q P  TT    G+ D+Q P+        G  V  L       A+++ADLI+
Sbjct: 342 LLKELSERSQIPVTTTLQALGAFDQQDPKSLDMLGMHGSAVANL-------AIQNADLII 394

Query: 284 SVGALLSDFNTGSFS-------------------YSYKTKNI-------IEFHSDYTKIR 317
           ++G    D  TG+ S                   +    KNI       I    D T+  
Sbjct: 395 ALGGRFDDRVTGNISKFAPEARKAALEKRGGIVHFEISPKNINKVVETQIALEGDVTENL 454

Query: 318 NATFPGVQMKFVLRKLLASVADAAKGY-------------KPVAVPARVPE-----NKAC 359
               P ++      +  A +    K Y             KP  V +R+ +      K  
Sbjct: 455 EILLPLIKSVDERPEWFAQINQWKKAYPYEYMRETPGSKIKPQTVISRLSDIANSTGKKV 514

Query: 360 DPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTG 419
             +T + Q  MW      ++     IT  G                       G++G+  
Sbjct: 515 IVTTGVGQHQMWTAQHWTWRNPRTFITSGG----------------------LGTMGYGL 552

Query: 420 GAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI--- 476
            A +GA  A     P+  VI   GD S  +T+ E+S+ ++ N    + +LNN+   +   
Sbjct: 553 PAAIGAQVAF----PEALVIDIDGDASFNMTLTELSSAVQANTPIKIMLLNNEEQGMVTQ 608

Query: 477 -------ERLIHGEKAGYNDIQNWKHLMLLETFGAKDYE 508
                   R  H  +   N  Q     M L+    K+YE
Sbjct: 609 WQTLFYEHRYSHTHQMNPN-FQKLAEAMGLKAMKLKEYE 646

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 133/558 (23%), Positives = 220/558 (39%), Gaps = 77/558 (13%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D IY     ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP + V   V  + 
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKD-VTAAVLREA 266

Query: 181 LETPIDLSLKPNDAEAEKEVVDTILS--------LIKDAKNPVI-LSDACASRHDVKAET 231
           + T   L      A     V D  L+        LI  AK PV+ + +   +  D     
Sbjct: 267 IPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNEDGPRLL 326

Query: 232 KQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSD 291
           K+L D  Q P  TT  G G+ D++ P+   + +G         A+++ADLI++VGA   D
Sbjct: 327 KELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGARFDD 385

Query: 292 FNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPA 351
             TG         NI +F  +          G+    V  K +  V +A      VAV  
Sbjct: 386 RVTG---------NITKFAPEAKIAAQENRGGIIHFEVSPKNINKVVEAQ-----VAVEG 431

Query: 352 RVPENKACD-PST-PLAQEWMW-NQCAKFFQE----------GDVIITETGTS-----AF 393
              EN A   P   P+     W  Q  ++ Q+          G  I+ +T  +     A 
Sbjct: 432 DATENIATMLPKVFPVKHRAEWFKQIEQWKQKFPYAYMKETPGSKIMPQTVIAKLSKLAN 491

Query: 394 GINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDPKKR 437
              + +     VG  Q +W                G +G T G  L AA  A+   P   
Sbjct: 492 ASGRDVVVTTGVGQHQ-MWAAQHWTWKKPRTFVTSGGLG-TMGFGLPAAIGAQVAKPDAM 549

Query: 438 VILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNW 493
           VI   GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +  +   +N 
Sbjct: 550 VIDIDGDASFNMTLTELSSAVQAGTPVKILLLNNEEQGMVTQWQSLFYENRYSHTHQRNP 609

Query: 494 KHLMLLETFGAKDYENHR 511
               L E  G K  +  R
Sbjct: 610 DFQKLCEAMGVKPLKASR 627

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 139/571 (24%), Positives = 224/571 (39%), Gaps = 77/571 (13%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +++ A        +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPLVVFTGQVATSA--------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAK 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V A 
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 260

Query: 180 LLETPIDL-SLKPNDA--EAEKEVVDTIL--------SLIKDAKNPVILSDACASRHDVK 228
           +L  PI + S+ P+D   +  + VVD            LI  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 AE-TKQLIDATQFPAFTTPMGKGSID-EQHPRFGGVYVGTLSRPEVKEAVESADLILSVG 286
            +  KQL D  Q P  TT  G G+ + E H       VG         A+++ADLI+++G
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAIQNADLIIALG 378

Query: 287 ALLSD---FNTGSFS----------------YSYKTKNI-------IEFHSDYTKIRNAT 320
           A   D    N   F+                +    KNI       +    D T+     
Sbjct: 379 ARFDDRVTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVEGDVTRNLEKL 438

Query: 321 FPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQE 380
            P V+      +  A VA   + Y P A     P +K   P T +++           + 
Sbjct: 439 LPLVESVPERPEWSAQVAKWKQEY-PYAYQKETPGSK-IKPQTVISK-----LSDLVLKS 491

Query: 381 GDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVIL 440
           G   I  TG     +  +         S +  G +G T G  L AA  A+   P   VI 
Sbjct: 492 GRPAIVTTGVGQHQMWAAQHWTWKSPRSFITSGGLG-TMGYGLPAAIGAQVARPDAIVID 550

Query: 441 FIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWKHL 496
             GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +  +    N   +
Sbjct: 551 IDGDASFNMTLMELSSAVQARTPVKVLLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFV 610

Query: 497 MLLETFGAKDYENHRVATTGEWDALMGDKEF 527
            L E  G K     R++   + DA++  KEF
Sbjct: 611 KLAEAMGLKAL---RLSKQEDTDAIL--KEF 636

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 135/581 (23%), Positives = 225/581 (38%), Gaps = 75/581 (12%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDA----------EAEKEVVDTILSLIKDAKNPVILSDACASRH-DVK 228
           L  PI      P++A          E   + ++    LI  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P  TT  G G+ D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGAR 376

Query: 289 LSDFNT-------------------GSFSYSYKTKNI-------IEFHSDYTKIRNATFP 322
             D  T                   G   +    KNI       I    D T   +   P
Sbjct: 377 FDDRVTLNIAKFAPEARRAAAEGRGGIIHFEVSPKNINKVVETQIAVEGDATGNLDKMMP 436

Query: 323 GVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQE-G 381
            +       +    + +  K Y P A     P +K   P T      +  + +K   + G
Sbjct: 437 KIFPVKERSEWFGQINEWKKKY-PYAYMMETPGSK-IKPQT------VITKLSKIANDTG 488

Query: 382 DVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILF 441
             +I  TG     +  +         + +  G +G T G  L AA  A+   P   VI  
Sbjct: 489 RHVIVTTGVGQHQMWAAQHWTWKTPRTFITSGGLG-TMGYGLPAAIGAQVAKPDSLVIDI 547

Query: 442 IGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWKHLM 497
            GD S  +T+ E+S+ ++      + VLNN+   +    + L +  +  +    N   + 
Sbjct: 548 DGDASFNMTLTELSSAVQAGTPVKILVLNNEEQGMVTQWQSLFYENRYSHTHQLNPDFIK 607

Query: 498 LLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
           L +  G K     RV    E DA +  KEF       ++EV
Sbjct: 608 LADAMGLKGL---RVKKQEELDAKL--KEFVSTKGPVLLEV 643

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 133/584 (22%), Positives = 236/584 (40%), Gaps = 81/584 (13%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I++     +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPAK 179
                 +S + ++   MV  I   P  I+       V+ R  PV + LP +     V A 
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKD-----VTAA 251

Query: 180 LLETPI------------DLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDV 227
           +L+ PI             L+ +  D    + +V T   L+  AK PV+   A    +  
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTA-DLLNKAKTPVLYVGAGILNNPA 310

Query: 228 KAE-TKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVG 286
             +  K+L +  Q P  TT    G+ D+Q P+   + +G         A+++ADLIL+VG
Sbjct: 311 GPKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVG 369

Query: 287 ALLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGV--------QMKFVLRKLLASVA 338
           +   D           T NI +F  +  +       G+         +  V+   +A   
Sbjct: 370 SRFDD---------RVTLNISKFAPEARRAALENRGGIVHFEICPKNISKVVETQVAVEG 420

Query: 339 DAAKGYK---PVAVP--------ARVPENKAC--------DPSTPLAQEWMWNQCAKFFQ 379
           DAA   +   P+ VP        A++ E K           P + +  + + ++ +    
Sbjct: 421 DAASNIEKLLPLVVPVKERTEWFAQIEEWKEKYPYAYQKETPGSKIKPQTVISKLSDLAN 480

Query: 380 EGDV-IITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRV 438
           + D  +I  TG     +  + +       S +  G +G T G  L AA  A+   P   V
Sbjct: 481 KSDKEVIVTTGVGQHQMWAAQYWTWKSPRSFITSGGLG-TMGYGLPAAIGAQVAKPDALV 539

Query: 439 ILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWK 494
           I   GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +  +    N  
Sbjct: 540 IDIDGDASFNMTLMELSSAVQAKTPVKILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPD 599

Query: 495 HLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
            L L +  G K     R++   + DA +  KEF +     ++EV
Sbjct: 600 FLKLADAMGLKGL---RLSKQEDVDATL--KEFIETEGPVLLEV 638

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 139/594 (23%), Positives = 230/594 (38%), Gaps = 101/594 (17%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDA------EAEKEVVDTILS----LIKDAKNPVILSDA-CASRHDVK 228
           L  PI      P++A       A+ E V   +S    LI  AK PV+   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKEAVESADLI 282
              K+L +  Q P  TT  G GS D++ P+        G     L       AV++ADL+
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDMLGMHGCVTANL-------AVQNADLL 370

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAK 342
           ++VGA   D           T NI +F  +  +       G+    V+ K +  V +   
Sbjct: 371 IAVGARFDD---------RVTCNIAKFAPEARRAAAEGRGGIVHFEVVPKNINKVVETQ- 420

Query: 343 GYKPVAVPARVPEN--KACDPSTPLAQEWMW----NQCAKFFQ------------EGDVI 384
               +AV      N  K      P+ +   W    N+  K F             +   +
Sbjct: 421 ----IAVEGDATSNLDKMMPKIFPVKERSEWFGQINKWKKEFPYAYMMETPGSKIKPQTV 476

Query: 385 ITETGTSAFGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFA 428
           IT+    A    + +     VG  Q +W                G +G T G  L +A  
Sbjct: 477 ITKLSKIANDTGRHVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLG-TMGYGLPSAIG 534

Query: 429 AEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEK 484
           A+   P+  VI   GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +
Sbjct: 535 AQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHR 594

Query: 485 AGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEV 538
             +    N   + L E  G K     RV    E DA +  KEF       ++EV
Sbjct: 595 YSHTHQLNPDFIKLAEAMGLKGL---RVKKQEELDAKL--KEFVSTKGPVLLEV 643

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 125/515 (24%), Positives = 209/515 (40%), Gaps = 76/515 (14%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + +  V TIFG PG   L + D IY     ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 181 LETPIDL-SLKPNDA--EAEKEVVD-----TILS---LIKDAKNPVILSDACASRHDVKA 229
           L++PI + S  P++   E  + VVD     TI +   LI  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-KQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
           +  K+L +  Q P  TT  G G+ D+  P+   + +G         A+++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVA 348
             D  TG         N+ +F  +  K       G+    +  K +  V DA      VA
Sbjct: 379 FDDRVTG---------NVAKFAPEARKAAAEGRGGIVHLEISPKNINKVIDAQ-----VA 424

Query: 349 VPARVPENKA-----CDP--STP--LAQEWMWNQCAKFFQEGD---------VIITETGT 390
           V   V  N A      DP  + P  L Q + W +   +  + +          +I     
Sbjct: 425 VEGDVTANLAKILPLIDPVETRPEWLGQIYKWKEQYPYAYQKETPDSGIKPQTVIARLSE 484

Query: 391 SAFGINQSLFPNNSVGISQVL----------WGSIGFTGGAVLG----AAFAAEEIDPKK 436
            +    + +     VG  Q+           W  I   G   +G    AA  A+   P  
Sbjct: 485 ISNSTGKDVIVTTGVGQHQMWAAQHWQWKKPWSFITSGGLGTMGFGLPAAIGAQVARPNA 544

Query: 437 RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNN 471
            VI   GD SL +T+ E+ST ++      + +LNN
Sbjct: 545 LVIDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 121/544 (22%), Positives = 207/544 (38%), Gaps = 130/544 (23%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  I   P  I+      T     PV + LP +     V A +
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 259

Query: 181 LETPIDLSLK-PNDA----------EAEKEVVDTILSLIKDAKNPVI-LSDACASRHDVK 228
           L+TPI +    P++A          +  +  +     LI  AK P++ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P  TT    G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGAR 378

Query: 289 LSD---FNTGSFS----------------YSYKTKNI---IEFH--------SDYTKIRN 318
             D    N   F+                +    KNI   +E          ++ TK+  
Sbjct: 379 FDDRVTLNISKFAPEARRAALENRGGIIHFDISAKNINKVVETQVPIEGDAGANLTKLLP 438

Query: 319 ATF-----------------------------PGVQMKFVLRKLLASVADAA-KGYKPVA 348
           + F                             PG ++K   + ++A +++ A K  KP+ 
Sbjct: 439 SIFSVSEAERKEWMETIKTWKEKHPYTYQKESPGSKIK--PQTVIAKLSEIANKSGKPIV 496

Query: 349 VPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGIS 408
           V A V +++        AQ W W +   F   G +     GT  +G              
Sbjct: 497 VTAGVGQHQMW-----AAQHWTWKKPRTFISSGGL-----GTMGYG-------------- 532

Query: 409 QVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFV 468
                         L AA  A+   P   VI   GD S  +T+ E+S+ ++      + +
Sbjct: 533 --------------LPAAIGAQVARPDAIVIDIDGDASFNMTLTELSSAVQAGTPIKILL 578

Query: 469 LNND 472
           LNN+
Sbjct: 579 LNNE 582

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 126/522 (24%), Positives = 211/522 (40%), Gaps = 88/522 (16%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V TIFG PG   L + D I++    ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY---VTQR--PVYLGLPANLVDLKV 176
                 +S + ++   MV  +   P    RCI   +   ++ R  PV + LP +     V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKD-----V 255

Query: 177 PAKLLETPIDL-SLKPNDA----------EAEKEVVDTILSLIKDAKNPVILSDA-CASR 224
            A +L  PI + S  P+ A          E   E ++   +LI  AK PV+   A   + 
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNN 315

Query: 225 HDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILS 284
            D     K+L D  Q P  TT  G G+ D++ P+   + +G         AV++ADL+++
Sbjct: 316 VDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIA 374

Query: 285 VGALLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGY 344
           +G    D  TG         NI +F  +  +       G+    +  K ++ V +     
Sbjct: 375 LGTRFDDRVTG---------NITKFAPEARRAAMEGRGGIIHFEISPKNISKVVETQ--- 422

Query: 345 KPVAVPARVPEN--KACDPSTPLAQ--EW--MWNQCAKFFQ------------EGDVIIT 386
             VAV      N  K      P+ +  EW  M N+  K +             +   +IT
Sbjct: 423 --VAVEGDATANVEKMLTKIFPVRERNEWFGMINKWKKQYPYDYMRETPTSKIKPQTVIT 480

Query: 387 ETGTSAFGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAE 430
           +    A    + +     VG  Q +W                G +G T G  L AA  A+
Sbjct: 481 KLSKLANDSGRPVIVTTGVGQHQ-MWTAQHWTWKNPRSFISSGGLG-TMGYGLPAAIGAQ 538

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
              P+  VI   GD S  +++ E+S+ ++      + +LNN+
Sbjct: 539 VAKPEALVIDIDGDASFNMSLTELSSAVQAGTPVKVLILNNE 580

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 117/529 (22%), Positives = 207/529 (39%), Gaps = 55/529 (10%)

Query: 8   KYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM 67
           +Y  + L Q  V T+FG+ G   + L D +    G+++    NE +A+YAA  Y  + G 
Sbjct: 7   EYFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGK 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFH 126
              ++   G G + AL GI  S +    ++ + G    SS+         L  G F    
Sbjct: 66  PGVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAG----SSE--------DLHKGGFQELD 113

Query: 127 RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLETPID 186
           ++S  +S+       + T P  I+     TY   R    G P  +  +  P  L+   I+
Sbjct: 114 QVSL-LSDHLKFTGKLTTDPDVIELV---TYNAMRLTTTGTPG-VTYIDFPGSLISESIE 168

Query: 187 LSLKPNDAEA------EKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240
            S  P  + +      + E +  ++ L+   +N  IL        +   E ++LI+    
Sbjct: 169 RSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNL 228

Query: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-EAVESADLILSVGALLSDFNTGSFSY 299
           P  +TPM KG + + HP         L+    + +A++ A+++L +GA L+         
Sbjct: 229 PFLSTPMAKGVVPDSHP---------LNASSARSKALKEAEIVLVLGARLNWILHFGAPP 279

Query: 300 SYKTKNI-IEFHSDYTKIRNATFPGV------QMKFVLRKLLASVADAAKGYKPVAVPAR 352
            +    I I+   D   +      GV       +   ++ L+  +      Y+ ++   R
Sbjct: 280 KWDANTIFIQVDCDPESLGQNNQRGVGYSLCGDIGLTVKSLIEKLKLERWAYQGLSRELR 339

Query: 353 VP-----ENKACDPSTPLAQEWMWN---QCAK-FFQEGDVIITETGTSAFGINQSLFPNN 403
                  E  A            +N   QC + F  +   II   G +     +  FP +
Sbjct: 340 SAIKLNHEKLAKKEQIVHHGRLNYNKVYQCLRTFIDDSRTIIVSEGANTMDQARISFPTD 399

Query: 404 SVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLK 463
                  L      T G  LG A AA+   P K ++L  GD +   +  EI T +R  L 
Sbjct: 400 YP--KHRLDAGTNATMGIGLGYAIAAKIARPDKSIVLLQGDSAFGFSAMEIETAVRNRLG 457

Query: 464 PYLFVLNNDG--YTIERLIHGEKAGYNDIQNWKHLMLLETFGAKDYENH 510
             + V+NN G  + + + + G        Q+ ++ ++ +  GA  Y  H
Sbjct: 458 LVIIVMNNSGIYHGVGQKVEGSLPSTALSQDCRYDLVGQGLGAVGYIVH 506

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 117/522 (22%), Positives = 204/522 (39%), Gaps = 87/522 (16%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP +     V A +
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKD-----VTAAI 249

Query: 181 LETPIDL-SLKPNDAEAE----------KEVVDTILSLIKDAKNPVI-LSDACASRHDVK 228
           L  PI + S  P                KE ++    LI  AK PV+ +     +  +  
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFTKERIEKAAKLINIAKKPVLYVGGGILNNPEGP 309

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKEAVESADLI 282
              K L D  Q P  TT  G G+ D++ P+        G  V  LS       +++ADLI
Sbjct: 310 KLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDMLGMHGSAVANLS-------IQNADLI 362

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGV--------QMKFVLRKLL 334
           +++G    D  TG         N+++F  +  K       G+         +  +++  +
Sbjct: 363 IAIGTRFDDRVTG---------NLVKFAPEAKKAALENRGGIIHFDISAKNINKIVKVDV 413

Query: 335 ASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEG-DVIITETGTS-- 391
           A   DA    K + +P  +P  +  +       EW       + ++  D  I  T     
Sbjct: 414 AVEGDAGANLKEL-LPL-IPAVREREEWLTKIDEWKLKHSYDYMKDTPDSKIKPTNCDIQ 471

Query: 392 -----AFGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAE 430
                A    + +     VG  Q +W                G +G T G  L +A  A+
Sbjct: 472 SYTKLANASGREVIVTTGVGQHQ-MWAAQYWTWKHPRTFITSGGLG-TMGYGLPSAIGAQ 529

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
              P   VI   GD S  +++ E+S+ ++      + +LNN+
Sbjct: 530 VAKPDALVIDIDGDASFNMSLTELSSAVQAGTPVKILLLNNE 571

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 132/599 (22%), Positives = 229/599 (38%), Gaps = 113/599 (18%)

Query: 7   GKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + +  V T+FG PG   L++ D IY      +    +E  A + A+GYAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 195

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPAKLL 181
               +S + ++   MV ++   P  I+       V+ R  PV + LP +     V + +L
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPVLVDLPKD-----VTSAIL 249

Query: 182 ETPIDL-SLKPNDA------EAEKEV----VDTILSLIKDAKNPVI-LSDACASRHDVKA 229
            TPI + S  P++A       A KE     +     LI  AK P+I +      +     
Sbjct: 250 RTPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPK 309

Query: 230 ETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALL 289
             ++L +  Q P  TT  G G+ D++ P+   + +G         +V++ADLI+++GA  
Sbjct: 310 LLRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARF 368

Query: 290 SDFNT-------------------GSFSYSYKTKNI-------IEFHSDYTKIRNATFPG 323
            D  T                   G   +    KNI       +    D T       P 
Sbjct: 369 DDRVTCNVAKFAPEARKAALENRGGIIHFEISPKNINKVVEAQVAVEGDVTDNLERLIPL 428

Query: 324 VQMKFVLRKLLASVADAAKGY-------------KPVAVPARVPE-----NKACDPSTPL 365
           V      ++  A +    K Y             KP  + AR+ E      +    +T +
Sbjct: 429 VNNVKERKEWFAQIDAWKKEYPYDYQRETKDSKIKPQTLVARLSEVASSTGRDVIVTTGV 488

Query: 366 AQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGA 425
            Q  MW      ++     IT  G                       G++G+   + +GA
Sbjct: 489 GQHQMWAAQHWTWRHPRTFITSGG----------------------LGTMGYGLPSAIGA 526

Query: 426 AFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIH 481
             A     P   VI   GD S  +T+ E+S+ ++      + VLNN+   +    + L +
Sbjct: 527 QIA----RPDALVIDIDGDASFNMTLMELSSAVQAGAPVKIVVLNNEEQGMVTQWQSLFY 582

Query: 482 GEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540
             +  +    N   + L E  G K     R++   + D+++  KEF       ++EV++
Sbjct: 583 EHRYSHTHQLNPDFVKLAEAMGLKGM---RLSKQEDMDSVL--KEFVNTEGPVLLEVIV 636

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 121/516 (23%), Positives = 197/516 (38%), Gaps = 82/516 (15%)

Query: 7   GKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKLLET 183
              +S + ++   MV  +   P  I+      T     PV + LP +     V A +L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRS 241

Query: 184 PI------------DLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAE- 230
           PI             L+ +  D +  + + D    LI  A+ PV+   A         E 
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLADAS-RLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLS 290
            ++L +  Q P  TT    G+ D++  +   + +G          V++ADLI+++GA   
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFD 359

Query: 291 DFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVP 350
           D  TG         NI +F  +  +       G+    +  K +  V DA      VAV 
Sbjct: 360 DRVTG---------NIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVDAQ-----VAVE 405

Query: 351 ARVPEN--KACDPSTPLAQEWMW-NQCAKFFQE---------------GDVIITETGTSA 392
             V  N  K      P+A+   W  Q A +  E                  +IT     A
Sbjct: 406 GDVTANLEKLLPLIKPVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVITRLSEIA 465

Query: 393 FGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAEEIDPKK 436
               + +     VG  Q +W                G +G T G  L AA  A+   P  
Sbjct: 466 NATGKEVIVTTGVGQHQ-MWAAQHWTWKKPRTFITSGGLG-TMGFGLPAAIGAQVAKPDA 523

Query: 437 RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
            VI   GD SL +T+ E+S+ ++      + +LNN+
Sbjct: 524 IVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNNE 559

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 120/507 (23%), Positives = 204/507 (40%), Gaps = 65/507 (12%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T  +Y    L Q ++ T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGMSCIITTF-GVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           + G   ++    G G + AL GI  S +    ++ + G  S +S+  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMVTDIATAPAEIDRCIRTTYVTQRPV---YLGLPANLVD--LK 175
               ++S      + T  +  I    A  +      +  Q P+   Y+  P NL++   K
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFNAY---NFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 176 VPAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNP--VILSDACASRHDVKAETKQ 233
           V A+    P+ +  +   +     V +    +I+++ N   VIL       H    +  +
Sbjct: 176 VQAQPATNPVSIPRRVRCSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFHK---DINK 232

Query: 234 LIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-EAVESADLILSVGALLSDF 292
            I+    P   TPM KG + + H          L+    + +A++ A+++L +GA L+  
Sbjct: 233 FINTFNLPFLPTPMAKGILPDSH---------NLNVSSARSKALKDANIVLVLGARLNWI 283

Query: 293 NTGSFSYSYKTKNI-IEFHSDYTK--IRNATFPGVQMKFVLRKLLASVADAA-------K 342
                S  +  K I I+  +D +   + N T   + +   L   + S++DA        K
Sbjct: 284 LHFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLNWK 343

Query: 343 GYKPVAVPAR-----------VPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTS 391
             K ++   R             E +       L    ++    K   E   ++   G +
Sbjct: 344 YEKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEGAN 403

Query: 392 AFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAA--EEIDPKKR---VILFIGDGS 446
           +  I +  FP  S    Q L      T G  LG   AA   E+   KR   VIL  GD +
Sbjct: 404 SMDIARISFP--SSVPKQRLDAGTNATMGIGLGYGIAACLNELRNGKRGKDVILIQGDSA 461

Query: 447 LQLTVQEISTMIRWNLKPYLFVLNNDG 473
              +  EI T +R+ L   + V+NN G
Sbjct: 462 FGFSGMEIETAVRFKLGLIIVVMNNSG 488

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 123/537 (22%), Positives = 220/537 (40%), Gaps = 70/537 (13%)

Query: 8   KYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYARIK 65
           +Y  E L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDF 122
               +I   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  PGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAK-- 179
           + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P +  
Sbjct: 121 SPFLKFTGKLAPDNIRMITQKA-----LNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 180 -LLETPIDLSLKPN----DAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQL 234
             +   + + L PN    D    KEVV  IL   ++    VI   A  + H+V+    +L
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVR----RL 228

Query: 235 IDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNT 294
           I+    P   TPM KG + +  P    + V +       +A+++AD++L +GA L+    
Sbjct: 229 INKFNIPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADIVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNI-IEFHSDYTKI-RNATFPGVQMK------FVLRKLLASVADAAKGYKP 346
              S  + +++I I+F S+   +  N   PG  +         +  L+  V      +K 
Sbjct: 281 FGASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKY 340

Query: 347 VAVPARVPE----------NKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGIN 396
             +   + E           K     T L    ++        +    +   G +   I 
Sbjct: 341 SGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIA 400

Query: 397 QSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEIST 456
           +  FP N+    + L      T G  LG A A +   P+  V+L  GD +   +  EI T
Sbjct: 401 RVSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIET 458

Query: 457 MIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDI------QNWKHLMLLETFGAKDY 507
            +R  L   + V+NN G     + HGEK   +D+      +N ++ ++ +  GA  +
Sbjct: 459 AVRCQLALVIVVMNNSG-----IYHGEKDTGSDLPPTALSKNCRYDLVGKGLGANGF 510

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 123/522 (23%), Positives = 205/522 (39%), Gaps = 88/522 (16%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + DV T+FG PG   L + D I+E     +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + S+          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPAK 179
                  +S + ++   MV ++   P  I+         +  PV + LP +     V A 
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAA 268

Query: 180 LLETPIDL-SLKPNDAEAE--KEVVDTILS--------LIKDAKNPVILSDA-CASRHDV 227
           +L  PI   S  P+D+ A+  K   D   S        L+  AK P++   A   +  D 
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDG 328

Query: 228 KAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K+L +  Q P  TT  G G+ D++  +   + +G         A+++ADLIL+VGA
Sbjct: 329 PRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGA 387

Query: 288 LLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPV 347
              D           T NI +F  +  +       G+    +  K ++ V +       V
Sbjct: 388 RFDD---------RVTCNISKFAPEARRAALEGRGGIVHFEMTPKNISKVVETQ-----V 433

Query: 348 AVPARVPENKACDPSTPLA------QEWMWNQCAKFFQE---------------GDVIIT 386
           AV      N       PL       QEW +NQ +++ +E                  +I+
Sbjct: 434 AVHGDAATN--IQKLIPLVFGVKERQEW-FNQISQWKKEYPLDYMHETPGSKIKPQTVIS 490

Query: 387 ETGTSAFGINQSLFPNNSVGISQVLW----------------GSIGFTGGAVLGAAFAAE 430
           +    A    + +     VG  Q +W                G +G T G  L AA  A+
Sbjct: 491 KLSDIANATGKEVIVTTGVGQHQ-MWAAQHWTWKTPRSFITSGGLG-TMGYGLPAAIGAQ 548

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
              P   V    GD S  +T+ E+S+ ++      + VLNN+
Sbjct: 549 IAKPNALVFDIDGDASFNMTLTELSSAVQAKTPIKILVLNNE 590

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 127/571 (22%), Positives = 222/571 (38%), Gaps = 77/571 (13%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPAK 179
                 +S + ++   MV  +   P  I+       +++R  PV + LP +     V A 
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKD-----VTAA 259

Query: 180 LLETPIDLSLK-PNDAEAE----------KEVVDTILSLIKDAKNPVILSDA-CASRHDV 227
           +L  PI +    P+ A ++           E +     LI  AK PV+   A   +  + 
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEG 319

Query: 228 KAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K L    + P  TT  G G+ D++ P      +G         AV+++DLI++VG 
Sbjct: 320 PRILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVGT 378

Query: 288 LLSDFNTGSFS-------------------YSYKTKNIIEFHSDYTKIRNATFPGVQ--- 325
              D  TG+ S                   +    KNI +       +       ++   
Sbjct: 379 RFDDRVTGNISKFAPEARRAALEGNGGIIHFEISPKNINKVVEAQVAVEGDAAANIEKML 438

Query: 326 -MKFVLR---KLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQE- 380
            M F +R   + L ++    K + P       PE+K       L  + +  + +K     
Sbjct: 439 SMIFPVRARSEWLNTIKQWKKEF-PYDYMRETPESK-------LKPQTVITKLSKLANST 490

Query: 381 GDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVIL 440
           G  +I  TG     +  + +       S +  G +G T G  L AA  A+   P+  VI 
Sbjct: 491 GKPVIVTTGVGQHQMWTAQYWTWKNPRSFITSGGLG-TMGYGLPAAIGAQVAKPEALVID 549

Query: 441 FIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWKHL 496
             GD S  +++ E+S+ ++      + +LNN    +    + L +  +  +    N   +
Sbjct: 550 IDGDASFNMSLTELSSAVQAGTAVKVLILNNGEQGMVTQWQSLFYEHRYSHTHQLNPDFM 609

Query: 497 MLLETFGAKDYENHRVATTGEWDALMGDKEF 527
            L +  G K     RV    E D+ +  KEF
Sbjct: 610 KLADAMGLKGI---RVKKQNELDSAL--KEF 635

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 118/536 (22%), Positives = 219/536 (40%), Gaps = 68/536 (12%)

Query: 8   KYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM 67
           ++  + L +  + T+FG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDFT 123
              ++   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAK--- 179
            F + +  ++ +   MVT  A     ++ CI+ T       Y+ +PA+ ++ + P +   
Sbjct: 122 PFLKFTGKLTPDNVDMVTQKA-----LNHCIQGTAGVS---YIDVPADFIESEKPLEGND 173

Query: 180 LLETPIDLSLKPN----DAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLI 235
            +   + + L P     D    KE+V  IL    +    VI   A  + H    E ++LI
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSH----EIRRLI 229

Query: 236 DATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P    + V +       +A+++AD++L +GA L+     
Sbjct: 230 NKFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADVVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNI-IEFHSDYTKI-RNATFPGVQMK------FVLRKLLASVADAAKGYKPV 347
             S  +  ++I ++F S+   +  N   PG  +         +  L+  +   +  +K  
Sbjct: 282 GTSPKWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKYS 341

Query: 348 AVPARVPENKACDPSTPLAQEWMWNQCAKFFQ----------EGDVIITETGTSAFGINQ 397
            V   + E    + +  L +E +      + Q          +   I+   G +   I +
Sbjct: 342 GVNQAMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 SLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTM 457
             FP +     + L      T G  LG A A++    +  V+L  GD +   +  EI T 
Sbjct: 402 VSFPTDVP--RRRLDAGTNATMGIGLGYALASKASHLELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDI------QNWKHLMLLETFGAKDY 507
           +R  L   + V+NN G     + HGE    +D+      +N ++ ++ +  GA  +
Sbjct: 460 VRCQLALIIVVMNNSG-----IYHGENNTGSDLPPTALSKNCRYDLVGKGLGAHGF 510

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 119/540 (22%), Positives = 221/540 (40%), Gaps = 70/540 (12%)

Query: 5   TLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    ++   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKP-GVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA 178
              + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P 
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQKA-----LNYCIQGTAGVS---YIDVPADFIEYEKPL 169

Query: 179 K---LLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVIL----SDACASRHDVKAET 231
           +        + + L PN    +   +  ++ LI   KN  IL      A  + H    E 
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSH----EI 225

Query: 232 KQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSD 291
           ++L++    P   TPM KG + +  P    + V +       +A++ AD++L +GA L+ 
Sbjct: 226 RRLVNTFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKIADIVLVLGARLNW 277

Query: 292 FNTGSFSYSYKTKNI-IEFHSDYTKI-RNATFPGVQMK------FVLRKLLASVADAAKG 343
                 S  + +++I I+F S+   +  N   PG  +         +  L+  +      
Sbjct: 278 ILHFGTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSC 337

Query: 344 YKPVAVPARVPENKACDPSTPLAQE----------WMWNQCAKFFQEGDVIITETGTSAF 393
           +K   V   + E    + +  L +E           ++        +   I+   G +  
Sbjct: 338 WKYSGVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTM 397

Query: 394 GINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQE 453
            I +  FP ++    + L      T G  LG A A +   P+  V+L  GD +   +  E
Sbjct: 398 DIARISFPTDAP--RRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAME 455

Query: 454 ISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDI------QNWKHLMLLETFGAKDY 507
           I T +R  L   + V+NN G     + HGEK    D+      +N ++ ++ +  GA D+
Sbjct: 456 IETAVRCQLALVIVVMNNSG-----IYHGEKDIEGDLPPTALSKNCRYDLVGKGLGANDF 510

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 115/514 (22%), Positives = 196/514 (38%), Gaps = 70/514 (13%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 256

Query: 181 LETPIDLSLK-PNDA----------EAEKEVVDTILSLIKDAKNPVI-LSDACASRHDVK 228
           L  PI +    P++A          +  +  +     LI  AK P++ +     +  +  
Sbjct: 257 LRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGP 316

Query: 229 AETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P  TT    G+ D+  P+   + +G         A+++ADLI++VGA 
Sbjct: 317 RLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGAR 375

Query: 289 LSD---FNTGSFS----------------YSYKTKNI-------IEFHSDYTKIRNATFP 322
             D    N   F+                +    KNI       +    D         P
Sbjct: 376 FDDRVTLNISKFAPEARRAALENRGGIIHFDISAKNINKVVETQVPIEGDAATNLQQMIP 435

Query: 323 GV-QMKFVLRKLLASVADAAKGYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEG 381
            V  +    RK      +  K   P A     P +K   P T +A+    ++ A     G
Sbjct: 436 SVFSVTERERKEWLDTINNWKAKYPYAYQKETPGSK-IKPQTVIAK---LSEIAN--SSG 489

Query: 382 DVIITETGT---SAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRV 438
             I+  TG      +      +      IS    G++G+     L AA  A+   P   V
Sbjct: 490 KPIVVTTGVGQHQMWAAQHWTWKTPRTFISSGGLGTMGYG----LPAAIGAQVARPDAVV 545

Query: 439 ILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNND 472
           I   GD S  +++ E+S+ ++      + +LNN+
Sbjct: 546 IDIDGDASFNMSLTELSSAVQACTPIKILLLNNE 579

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 98/479 (20%), Positives = 190/479 (39%), Gaps = 48/479 (10%)

Query: 14  LAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           L Q  ++ +FG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      ++ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++     +L + G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLETPIDLSLKP 191
           +     MV             ++T  +     YL +P  L+++     L   P+D+    
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHVR 179

Query: 192 NDAEAEKEVVDTILSLIKDAKNP-VILSDACASRHDVKAETKQLIDATQFPAFTTPMGKG 250
           +  ++ +  V     L++D +N  V++   CA    V    +  ++  + P    PM KG
Sbjct: 180 SGPDSSR--VQGAAKLLQDGRNILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAKG 234

Query: 251 SIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLS-DFNTGSFSYSYKTKNIIE 308
            + + H          L+    +  A++ A+++L +GA L+   + GS          I+
Sbjct: 235 IVPDSH---------ELNVNGCRSLALKRAEIVLVLGARLNWILHYGSAPKWNADATFIQ 285

Query: 309 FHSDYTKIRNATFPGVQMKFV-----LRKLLASVADAAKGYKPV--AVPARVPENKA--- 358
              D   + +    GV    +         + +V   +  Y+ V   V  ++ EN     
Sbjct: 286 VDRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQYRGVDNEVLDKIRENGVKLQ 345

Query: 359 ----CDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGS 414
                 P +PL    +++   K   + + I++  G +    ++  F  +     + L   
Sbjct: 346 RKAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWFGTDYP--KRRLDAG 403

Query: 415 IGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
            G T G  +G A +A+  +P K V+   GD +   +  E+ T +R  +   + V+NN G
Sbjct: 404 TGATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVVVVMNNGG 462

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 99/488 (20%), Positives = 192/488 (39%), Gaps = 65/488 (13%)

Query: 14  LAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           L Q  V+ +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    ++ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANI 132
             G G + AL G+  S+     +L + G    SS+ +            F    ++S  +
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAG----SSENEYY--------EGFQELDQLSV-M 116

Query: 133 SETTAMVTDIATAPAE--IDRCIRTTYVTQRPVYLGLPANLVDLKVPAKLLETPIDLSLK 190
           S        I T      +   ++T+ +     Y+ +P  L++ K  +   E P  + + 
Sbjct: 117 SRWCKFYGRINTGNLSHLVYTAMKTSMLQNAVTYIDIPGGLIEEKAKSSD-ELPKKMEIA 175

Query: 191 PNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAFTTPMGKG 250
                 + + V  + ++++  K  +++    ++ +   AE +  ++  Q P   TPM KG
Sbjct: 176 HIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQLPFLPTPMAKG 233

Query: 251 SIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLS------------------- 290
            + + H          L+    +  A++SA+++L +GA L+                   
Sbjct: 234 IVPDTH---------ELNVNGARSLALKSAEVVLILGARLNWILHFGLEPKWSDDACFIQ 284

Query: 291 -DFNTGSFSYSYKTKNIIEFHSD---YTKIRNATFPGV-QMKFVLRKLLASVADAAKGYK 345
            D +  +   +         HSD   + +  +   P   +   V  K+L+ +    K  K
Sbjct: 285 VDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILSKIHSNGKAMK 344

Query: 346 PVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSV 405
              +   +PE  A      L    ++ +  +F  +   I+   G +   I +  FP +  
Sbjct: 345 EKEI---IPEGSA------LRYHGVYAKLREFIDDKSTIMVLEGANTMDIARVSFPTSYQ 395

Query: 406 GISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPY 465
                L      T G  +G A AA+  +P K V+   GD +   +  E+ T+ R  L   
Sbjct: 396 --KHRLDAGTSATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELETIARNKLGIV 453

Query: 466 LFVLNNDG 473
           + V+NN G
Sbjct: 454 VVVMNNGG 461

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 117/519 (22%), Positives = 212/519 (40%), Gaps = 79/519 (15%)

Query: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M+ I++  Y+   L + D+ T+FG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-----QLLLH 114
           Y  +      ++T  G G + AL GI  S   +  ++ + G   I SQ K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + ++ + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LKVPAKLLET-----PI---DLSLKPND---AEAEKEVVDTILSLIKDAKNPVILSDACA 222
             V   + ++     PI    L+  PND    E  K + D +    +D    VI+     
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRK--RDQNMLVIVGKGAI 223

Query: 223 SRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLI 282
                 +  +  I+    P   TPM KG I++ +     V  G         A++ AD+I
Sbjct: 224 G---ASSALRHFINCFNLPFLPTPMAKGIIEDSNEL--NVSSGR------SMALKDADVI 272

Query: 283 LSVGA----LLSDFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQMKFV------LRK 332
           L  GA    +L   +T  F  + K    I+  ++   I      G+Q   +      ++K
Sbjct: 273 LVFGAKLNWILHYGDTPKFKDNVK---FIQVDNNTKTIGLNNQRGLQNSLIGDIESTVKK 329

Query: 333 LLASVADAAKG----YKPV--AVPARVPEN--------KACDPSTPLAQEWMWN----QC 374
           L   +     G    YK +  A+  ++  N         A     P A    +N    + 
Sbjct: 330 LTMMINHLQNGQMITYKGLSKAIKEKILSNAIKLNEKENATPRVVPNANSLNYNVVFGRL 389

Query: 375 AKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDP 434
              F++ + I+   G +   + +  FP +     ++  G++  T G  LG A + +   P
Sbjct: 390 KTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLA-TMGIGLGYAISTKLSKP 447

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
            K V+L  GD +   +  E+ T +R+NL   + ++NN G
Sbjct: 448 NKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG 486

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 115/502 (22%), Positives = 206/502 (41%), Gaps = 65/502 (12%)

Query: 8   KYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM 67
           +YL E L    +  +FG+ G   + L D +     +++ G  NE  A+YAA  Y  + G 
Sbjct: 6   EYLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGR 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-QLLLHHTLGNGDFTVF 125
              ++   G G + AL G+  S +    ++ + G    S++   Q L    L     + +
Sbjct: 66  PGVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNRGGFQELDQIAL----LSKY 121

Query: 126 HRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAK---LLE 182
            + S+ +S +     D +   A     + T  V+    YL +PAN++D +V         
Sbjct: 122 VKYSSRLSNSN---VDQSFYDALRQAVLGTPGVS----YLDIPANVIDQEVEKNESFSRR 174

Query: 183 TPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPA 242
               +S +P DA  ++  V  +L+  +D KN + +    A+ +    + +  +D  Q P 
Sbjct: 175 HIAKISYQPTDAALQR--VAKLLNANRD-KNILCVIGKGATEN--AQQIRPFVDEFQLPF 229

Query: 243 FTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLSDFNTGSFSYSY 301
            +TPM KG + + H          L+    +  A++SAD++L +GA L+      F  + 
Sbjct: 230 LSTPMAKGVVPDSH---------ALNVSSARSLALKSADIVLVLGARLNWIL--HFGEAP 278

Query: 302 KTKN---IIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPV----------- 347
           K KN    I+  +   ++ +    G      L  L   +        P+           
Sbjct: 279 KWKNDAIFIQIDTTAEELGHNNGAG-----TLFSLCGDIGTTVAKLTPLLAGFSGRGLFG 333

Query: 348 AVPARVPEN------KACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFP 401
           ++  R+ +N      +  +PS  L    ++    K   + D II   G +   + +  FP
Sbjct: 334 SLETRIQQNEKRLRARENEPSPALTYNKVYATIRKQIVDKDTIIVSEGANTMDVARISFP 393

Query: 402 NNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWN 461
            +   +   +      T G  LG A AA+   P+K VI   GD +   +  E+ T  R+ 
Sbjct: 394 TDYPKLR--MDAGTNATMGVGLGYAIAAKIAHPQKNVIAIQGDSAFGFSGMELETASRYK 451

Query: 462 LKPYLFVLNNDGYTIERLIHGE 483
           L   + V+NN G     + HGE
Sbjct: 452 LGITVVVMNNSG-----IYHGE 468

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 120/541 (22%), Positives = 221/541 (40%), Gaps = 71/541 (13%)

Query: 5   TLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    ++   G G + +L GI  S +    +L + G  S +   K   Q L   +L  
Sbjct: 63  NDKP-GVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA 178
              + F + +  + S+   MVT  A     ++ CI+ T       Y+  PA+L++ +  +
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTRKA-----LNHCIQGTMGVS---YIDFPADLIENEKKS 169

Query: 179 ----KLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVIL----SDACASRHDVKAE 230
                 L   + + L PN    +   ++ I+ LI   ++  IL      A  + H    E
Sbjct: 170 LAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQNRDKNILIVIGKGAVKNSH----E 225

Query: 231 TKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLS 290
            ++L+ +   P   TPM KG + +  P    + V +       +A+++AD++L +GA L+
Sbjct: 226 IRRLVSSFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADIVLVLGARLN 277

Query: 291 DFNTGSFSYSYKTKNI-IEFHSDYTKI-RNATFPGVQMK------FVLRKLLASVADAAK 342
                  S  +  +++ I+F S    +  N T  G  +         +  L+  +A    
Sbjct: 278 WILQFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRP 337

Query: 343 GYKPVAVPARVPENKACDPSTPLAQEWMWNQCAKFFQEGDV----------IITETGTSA 392
            +K   V   + E    + +    +E M      + Q   V          I+   G + 
Sbjct: 338 RWKYSGVNNALREKIHVNETRLQEKEKMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANT 397

Query: 393 FGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQ 452
             I +  FP ++      L      T G  LG A A++   P+  V+L  GD +   +  
Sbjct: 398 MDIARVSFPTDAP--RHRLDAGTNATMGIGLGYALASKASRPELDVVLIQGDSAFGFSAM 455

Query: 453 EISTMIRWNLKPYLFVLNNDGYTIERLIHGEKAGYNDI------QNWKHLMLLETFGAKD 506
           EI T +R  L   + V+NN G     + HG K    D+      +N ++ ++ E  GA  
Sbjct: 456 EIETAVRCQLALVIVVMNNSG-----IYHGVKDAGADLPPTALSKNCRYDLVGEGLGAHG 510

Query: 507 Y 507
           +
Sbjct: 511 F 511

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/337 (23%), Positives = 140/337 (41%), Gaps = 51/337 (15%)

Query: 164 YLGLPANLV------DLKVPAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVIL 217
           Y+ +P NL+      + ++  K++ +P+  S  P        VV  +  LI + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 218 SDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AV 276
                   +   E ++ +D  Q P   TPM KG + + HP         L+    +  A+
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLAL 256

Query: 277 ESADLILSVGALLSDFNTGSFSYSYKTKNIIEF-HSDYT--KIRNATFPGVQMKF----- 328
             AD++L +GA L+      F    K K+ ++F   DYT  ++ +    G+         
Sbjct: 257 RKADVVLLLGARLNWIL--HFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIG 314

Query: 329 VLRKLLASVADAAKGYKPV--AVPARVPEN------KACDPSTPLAQEWMWNQC----AK 376
           +  + L S   A K Y+ +  A+  ++  N      K  +  T L     +NQ      +
Sbjct: 315 LSLEELGSKLHAFK-YRGLNNAIREKIDTNELKLRGKERETRTALLH---YNQVYALMRQ 370

Query: 377 FFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKK 436
           +  + + I+   G +   + +  FP +     + L      T G  LG A AA+  D  K
Sbjct: 371 YITDDETILVTEGANTMDVARISFPTDYP--KRKLDAGTNATMGIGLGYALAAKASDTTK 428

Query: 437 RVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
            VI   GD +   +  E+ T +R +L   + V+NN G
Sbjct: 429 TVICIQGDSAFGFSAMELETAVRCSLPLVVVVMNNSG 465

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 105/495 (21%), Positives = 193/495 (38%), Gaps = 49/495 (9%)

Query: 9   YLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM- 67
           ++ + LA   + T+FG+ G   + + D I     +R+ G  NE  A+YAA  Y  + G  
Sbjct: 9   HISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASAYGYLTGKP 68

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL G+  S +    +L + G    SS+         L  G F    +
Sbjct: 69  GVLLVVGGPGLIHALAGVYNSISNKWPLLVLAG----SSE--------DLNRGGFQALDQ 116

Query: 128 MSANISETTAMVTDIATAPAE--IDRCIRTTYVTQRPV-YLGLPANLVDLKVPAKLLETP 184
           + A +S      + +  +     +   +R + V    V YL +P +L++  V  +     
Sbjct: 117 I-AVLSRYVKFSSRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSVEKEKYNCV 175

Query: 185 IDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQFPAFT 244
            +++    + +  K+ +  +  LI +     +L        D   E ++ I+  Q P   
Sbjct: 176 RNIT--KVEYQPSKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIERFQLPFLP 233

Query: 245 TPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLSDFNTGSFSYSYKT 303
           TPM KG + + HP         L+    +  A+ SAD++L +GA L+          +  
Sbjct: 234 TPMAKGVVPDSHP---------LNVSSARSLALRSADIVLVLGARLNWILHFGEPPKWNQ 284

Query: 304 KNI---IEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVP----ARVPEN 356
             I   ++  +D     N+          +   L S+    K +K   +      +V +N
Sbjct: 285 NAIFVQVDTSADELGFNNSAGTLYSSCGHIGATLQSLTPMLKKFKYCGLSRSMLQQVEQN 344

Query: 357 KA------CDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQV 410
           K          +  L    ++    +   + +  I   G +   I +  FP +   +   
Sbjct: 345 KVRLRAKETQKTLTLNYNQVYAAMREHMVDRNTFIVSEGANTMDIARVSFPTDYPKLR-- 402

Query: 411 LWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLN 470
           L      T G  +G A AA+   P+K V+   GD +   +  E+ T  R+ L     V+N
Sbjct: 403 LDAGTNATMGVGIGYAIAAKLAHPEKSVVCIQGDSAFGFSGLELETASRYQLGIVFVVMN 462

Query: 471 NDGYTIERLIHGEKA 485
           N G     + HGE +
Sbjct: 463 NSG-----IYHGEDS 472

>Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON}
           (141784..143499) [1716 nt, 572 aa]
          Length = 571

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 114/504 (22%), Positives = 208/504 (41%), Gaps = 68/504 (13%)

Query: 8   KYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARIKGM 67
           +++ + L + D+ TIFG+ G   + L D  +    +R+    NE +A+YAA  Y  +   
Sbjct: 9   QHITDILLKYDIDTIFGIVGIPVVELADS-FIANNIRFISFRNEQSASYAASVYGYLNNK 67

Query: 68  SCIITTFG-VGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDFT 123
             I+ T G  G + +L GI  S      ++ + G    + Q K   Q L H +L      
Sbjct: 68  PGILLTVGGPGLIHSLAGIYNSIENKWPLIVLTGSIESTDQYKHGFQELDHVSL------ 121

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRC----IRTTYVTQRPV-YLGLPANLVDLKVPA 178
             HR   +I+ T  +  +       IDRC    +R + +  + V ++ +P +L    +  
Sbjct: 122 -LHR---HINFTAKLSLE------NIDRCFYEAMRNSCLINKGVSFIEIPGDLFHSTIST 171

Query: 179 KLLET-----PIDLSL---KPNDAEAEKEVVDTILSLIKDAKNP-VILSDACASRHDVKA 229
            +++      PI   L   +P D    K     + ++ K+ KN  V++ D      D   
Sbjct: 172 DVIDKSIVHQPISKKLIEYQPTDELITKVSKFLLENINKNKKNCLVVIGDGAM---DDSQ 228

Query: 230 ETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALL 289
           +  + +     P  TTPM +G +    P    + V +        A+++A+++L +G  L
Sbjct: 229 KLTKFLTHFNLPFITTPMARGIV----PDSSKLNVASARSL----ALKNAEIVLLIGTKL 280

Query: 290 S-DFNTGSFSYSYKTKNIIEFHSDYTKIRNATFPGVQ------MKFVLRKLLASVADAAK 342
           +   + GS S   +    I+  +  + +      G++      +   L KL  S+    K
Sbjct: 281 NWILHFGSSSKWNENTLFIQIDNSPSNLGLNNSKGLEYSLFGNISVTLDKLSRSLIKFNK 340

Query: 343 GYK-----PVA-VPARVPEN------KACDPSTP-LAQEWMWNQCAKFFQEGDVIITETG 389
             +     P   +  ++ EN      K  + ST  L    ++    K   + + II   G
Sbjct: 341 NKQWRYQGPTENIKIKIKENEINLKKKESNHSTSQLNYNEVYGSLRKILNDRETIIVMEG 400

Query: 390 TSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQL 449
            +   I +  F  +     ++  G++  T G  LG A +A+   P K V+L  GD +   
Sbjct: 401 ANTMDIARISFKTDYPQ-HRLDCGNLA-TMGVGLGYAISAKLSRPDKTVVLIQGDSAFGF 458

Query: 450 TVQEISTMIRWNLKPYLFVLNNDG 473
           +  EI T +R  L   + V+NN G
Sbjct: 459 SGMEIETAVRNKLGLIIIVMNNSG 482

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 112/271 (41%), Gaps = 43/271 (15%)

Query: 4   ITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T+ + +   L   +V  +FG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLH------HTL 117
           + G   ++    VG    ++ +AG Y             SI+++   ++L       H  
Sbjct: 62  LTGKPGVLLV--VGGPGLIHSLAGVYN------------SINNRWPLIVLAGSNDHGHDQ 107

Query: 118 GNGDFTVFHRMS--ANISETTAMVTDIATAPAEIDRCIRTTYV-----TQRPVYLGLPAN 170
             G F    ++S      + +  +T+       +D  + + Y      T+   Y+ +P N
Sbjct: 108 YRGAFQELDQISLLKPYVKFSGKLTE-----GNVDHVLFSAYNIALQGTKGVTYVDIPGN 162

Query: 171 LVDLK-----VPAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRH 225
           L++ +      P  L   P     +P     +   V  + SLI + ++  +L        
Sbjct: 163 LIETQAVCAGTPGLLPPVP-----QPIKCSPDPHTVKRVASLILENRDKKVLVVVGKGSQ 217

Query: 226 DVKAETKQLIDATQFPAFTTPMGKGSIDEQH 256
              A  ++ ID   FP   TPMGKG + ++H
Sbjct: 218 GAFAAVRRFIDEFNFPFLPTPMGKGVVPDEH 248

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 12/103 (11%)

Query: 418 TGGAVLGAAFAAEEIDPKKR-VILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTI 476
           T G  LG A AA+      R V+L  GD +   +  E+ T++R+ +   + ++NN G   
Sbjct: 424 TMGVGLGYAMAAKLSSGAARDVVLIQGDSAFGFSGMELETLVRFQVGVVVMIMNNSG--- 480

Query: 477 ERLIHGEKAGYND--IQNWKHLMLLETFGAKDYENHRVATTGE 517
             + HG   G +    +  ++ ++    G + +    + TTGE
Sbjct: 481 --IYHGNGVGLSTKLSEQCRYDVMARGLGCRAH----LVTTGE 517

>KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 74/343 (21%), Positives = 134/343 (39%), Gaps = 50/343 (14%)

Query: 194 AEAEKEVVDTILSLIKDAKN---PVILSDACASRHDVKAETKQLIDATQFPAFTTPMGKG 250
           +  ++  V  I  LI DAK+    V++     S +   +E +  ID    P   TPM KG
Sbjct: 189 SSPDQTTVSKISRLIVDAKSQDKKVLVVIGKGSVY-YSSEVRTFIDKFNLPFLPTPMAKG 247

Query: 251 SIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKTKNI-IEF 309
            + + H       +  +S      A+ +AD+IL  GA L+     + S  +KT  I I+ 
Sbjct: 248 VVPDNH-------MCNVSSAR-SFALANADIILVFGARLNWILHYAESPKWKTSAIFIQC 299

Query: 310 HSDYTKIRNATFPGVQMKF----------VLRKLLASVADAAKGYKPVAVPARVPEN--- 356
            +D   + +     V +            +  +L+    D         + +++  N   
Sbjct: 300 DNDPETLGHNNMNHVNLSLLGDLDLTITSITEELVKKYPDYKHNTPSKELISKIESNRSK 359

Query: 357 -----KACDPSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVL 411
                K  D +  L    ++ + +    +   ++   G +     +  F + S  + ++ 
Sbjct: 360 LQELEKPKDETAELNYNTVYGKISPLIDDESTMLIFEGANTMDKARISF-STSFPLRRLD 418

Query: 412 WGSIGFTGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNN 471
            G+ G T G  LG   A+   +P    IL  GD +   +  EI T+ R+ L   + ++NN
Sbjct: 419 AGTNG-TMGVGLGYLMASRLANPNLDNILIQGDSAFGFSGMEIETLCRFKLGSVIIIMNN 477

Query: 472 DGYTIERLIHGEKAGYNDIQNWKHL-------MLLETFGAKDY 507
            G     + HG     ND+ +   L       +L +  GAK Y
Sbjct: 478 SG-----IYHG-----NDVNSATKLGEKTRYDLLAQGLGAKGY 510

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 418 TGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
           T G  LG A AA+   P+  ++   GD +   +  EI T +R+ L     ++NN G
Sbjct: 420 TMGVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIETAVRYRLGIIFIIMNNSG 475

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 16/91 (17%)

Query: 204 ILSLIKDAKNP---VILSDACASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFG 260
           + SLIK+ ++    V+L   C +        +  I+   FP   TPM KG + + H    
Sbjct: 196 VTSLIKEHQDKNILVVLGKGCINS---SLALRHFIEEFNFPFLPTPMAKGILPDSH---- 248

Query: 261 GVYVGTLSRPEVK-EAVESADLILSVGALLS 290
                 L+    + +A++SADL+L  GA L+
Sbjct: 249 -----RLNVSAARSQALKSADLVLVFGARLN 274

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K   +RM+E     M+ P N+V Q KI A TNAK
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAK 158

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K   +RM+E     M+ P N+V Q KI A TNAK
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAK 158

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
           SMC3Subunit of the multiprotein cohesin complex required
           for sister chromatid cohesion in mitotic cells; also
           required, with Rec8p, for cohesion and recombination
           during meiosis; phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1230

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K   +RM+E     M+ P N+V Q KI A TNAK
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAK 158

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 69/340 (20%), Positives = 123/340 (36%), Gaps = 46/340 (13%)

Query: 164 YLGLPANLV--DLKVPAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDAC 221
           Y+  P +L+  +++VP       I  ++K   + A+  V   +  L++   +  +L    
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIPRAIK---SSADPLVTKEVAQLLRRNSDQNVLVIIG 219

Query: 222 ASRHDVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AVESAD 280
               +        I   QFP   TPMGKG I +  P         L+    +  A+  +D
Sbjct: 220 KGAVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP---------LNVSSARSSALSKSD 270

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNIIEF---HSDYTKIRNATFPGVQMKFV-------- 329
           ++L  GA L+      F    K K+ ++F    +D   I N     +    +        
Sbjct: 271 IVLVFGARLNWL--LHFGKPPKWKSTVKFILCDNDPHAIGNNNMQSINYSLLGDIGLIIN 328

Query: 330 -LRKLLASVADAAKGYKPVAVPARV-----------PENKACDPSTPLAQEWMWNQCAKF 377
            L + L  V +       V    R             E+++      L    ++    + 
Sbjct: 329 ELTEELDRVENEWGRKYGVTKELRSEILKNQFKLQEKESRSNTNGALLNYHVVYRTLREM 388

Query: 378 FQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGGAVLGAAFAA----EEID 433
               +  +   G +   I +  FP  S+   Q L      T G  LG   AA    + + 
Sbjct: 389 LDLKNTFLVTEGANTMDIARISFP--SLKPKQRLDAGTNATMGVGLGYGIAARLSQDYMK 446

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
            K  +++  GD +   +  EI T +R+ L   + V+NN G
Sbjct: 447 SKPDILVIQGDSAFGFSAIEIETAVRFKLGLIIIVINNSG 486

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K   +RM+E     M+ P N+V Q KI A TNAK
Sbjct: 115 DYQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAK 158

>TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.450
           YEL020C
          Length = 582

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 418 TGGAVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDG 473
           T G  +G A A++   P K  +L  GD +   +  E+ T+ R+ L   + ++NN G
Sbjct: 433 TMGIGIGYAIASKLAVPDKLTVLIQGDSAFGFSGMELETISRFKLGIVVIIMNNSG 488

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K   +RM+E     M  P N+V Q KI A TNAK
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAK 158

>Skud_4.735 Chr4 (1303900..1304865) [966 bp, 321 aa] {ON} YDR460W
           (REAL)
          Length = 321

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 32/117 (27%)

Query: 173 DLKVPAKLLETPIDLSLKPNDAEAEKEVVDTILSLIKD-------AKNPVILSDACASRH 225
           ++K+  +LLE  I++  K N    +KE+V+ + +  +D        KN V L  + A R 
Sbjct: 167 EMKLKKRLLEKQIEVEEKMNKEWTKKEIVNRLSTSTQDVNETIEGVKNTVKLKKSSARRK 226

Query: 226 ----------------DVKAETKQLIDATQFPAFTTPMGKGSIDEQHPRF---GGVY 263
                           +V  +  +L DA  F  F          E HPRF   G VY
Sbjct: 227 LEELNRVLKNNPYFNSNVNVQNSRLKDAAPFTPFNGDR------ETHPRFTLKGSVY 277

>NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {ON}
           
          Length = 205

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 9/124 (7%)

Query: 98  VVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY 157
           +V   +++ +  ++     L  G       + A+ +     +TDI  +  EI   +   Y
Sbjct: 1   MVAFKAVTPKKARVAADEPLEKGVLRFLVSIGASYTTRPEFLTDIVDSTTEIIDTVGNKY 60

Query: 158 VTQRPVYLGLPANLVDLKVPAKLLETPID---------LSLKPNDAEAEKEVVDTILSLI 208
            + +  YL +  N+ DLK+   ++++P D           LKP +  AE       LS+ 
Sbjct: 61  ESTQFGYLNIKTNVKDLKIKTYVIKSPEDKDDVVVLSEYDLKPYEIFAEYGQEGAKLSMG 120

Query: 209 KDAK 212
           +DAK
Sbjct: 121 EDAK 124

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1227

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K+  +RM+E     M  P N+V Q +I A TNAK
Sbjct: 114 DYQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK 157

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K   +RM+E     M+ P N+V Q +I A TNAK
Sbjct: 114 DYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAK 157

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
           YJL074C
          Length = 1119

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   +   IRM+E +   M  P N+V Q KI A TNAK
Sbjct: 42  DYQINDRNITRGDMIRMLESVGFSMSNPYNIVPQGKIIALTNAK 85

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1225

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K+  +RM+E     M +P N+V Q +I A TNAK
Sbjct: 114 DYQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAK 157

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
           complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K+  +RM+E     M  P N+V Q +I A TNAK
Sbjct: 114 DYQVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAK 157

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1216

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 519 DALMGDKEFNKNSRIRMIEVMLPVMDAPSNLVQQAKITAATNAK 562
           D  + D+   K+  +RM+E     M  P N+V Q +I A TNAK
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAK 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,576,941
Number of extensions: 2465221
Number of successful extensions: 6485
Number of sequences better than 10.0: 154
Number of HSP's gapped: 6381
Number of HSP's successfully gapped: 193
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)