Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D050705.443ON1227122761640.0
YOR124C (UBP2)5.443ON1272126633320.0
Suva_8.1765.443ON1270122833280.0
NCAS0H021005.443ON1269123633170.0
Smik_15.3015.443ON1272124033110.0
TDEL0D025805.443ON1272122833090.0
Skud_15.2865.443ON1278124632950.0
KNAG0B041905.443ON1262123632290.0
SAKL0G02728g5.443ON1237122332100.0
Kpol_1062.235.443ON1266123431760.0
NDAI0C015505.443ON1295123031280.0
Kwal_55.213935.443ON1233121430230.0
TBLA0A064705.443ON1320128529880.0
KLTH0F15862g5.443ON1241121329590.0
TPHA0E017105.443ON1283124029140.0
CAGL0K10252g5.443ON1267128028460.0
Ecym_45145.443ON1246125328000.0
KLLA0E02377g5.443ON1220125027420.0
ZYRO0G01606g5.443ON130581922220.0
ACL164C5.443ON138979217400.0
Kpol_1016.15.443ON1251122616360.0
TPHA0J026205.443ON1225125414880.0
TBLA0C012001.369ON5031221541e-09
ZYRO0G01188g1.369ON500531442e-08
TDEL0D024001.369ON494781424e-08
SAKL0D10120g1.369ON492471406e-08
KLLA0A10791g1.369ON4841051334e-07
Kwal_34.162681.369ON449341325e-07
KLTH0H13354g1.369ON495951326e-07
KNAG0C019401.369ON499551282e-06
TPHA0A025101.369ON505581272e-06
NCAS0D006001.369ON493551245e-06
AEL029W1.369ON446501245e-06
KAFR0C045201.369ON499581221e-05
Smik_7.3141.369ON499701201e-05
Ecym_27171.369ON483881183e-05
Skud_6.941.369ON499711148e-05
NDAI0H035501.369ON502531149e-05
YFR010W (UBP6)1.369ON499531131e-04
Suva_6.831.369ON500691131e-04
Kpol_2001.541.137ON1223391132e-04
Kpol_534.231.369ON496341112e-04
CAGL0K10494g1.369ON495531094e-04
TDEL0C056401.137ON1178461085e-04
TPHA0A025401.137ON1286521040.002
Kwal_33.136281.137ON1160431040.002
YJL197W (UBP12)1.137ON1254801040.002
Ecym_81401.137ON1264391020.003
Smik_2.497.390ON745351010.003
SAKL0C04246g1.137ON1297871020.003
Smik_10.371.137ON1247431020.003
Skud_10.221.137ON1255431020.003
KLLA0C03476g1.137ON1252701010.004
Suva_6.2761.137ON1256431010.005
ZYRO0C17908g1.137ON120439980.010
Ecym_46857.390ON77831970.012
KAFR0F015601.137ON117130950.020
KLTH0F03674g1.137ON119843940.025
NDAI0B004801.137ON125339940.029
AFR627C1.137ON128734940.030
Kpol_1045.417.390ON71235920.038
KAFR0L017307.390ON70173920.042
KNAG0C021801.137ON123134920.043
TBLA0J006001.137ON146239920.046
TBLA0E017605.712ON121232920.047
NDAI0A036808.188ON111676910.052
YBL067C (UBP13)7.390ON74731910.053
CAGL0L01639g1.137ON114734910.056
Suva_2.507.390ON75032910.062
KLLA0A00396g5.712ON101232900.081
NCAS0I031401.137ON1201102890.10
Kpol_1032.288.188ON88281890.11
Kwal_55.196455.712ON97032880.12
Kwal_27.108427.390ON71135880.12
AGR370W7.390ON74032880.12
TPHA0E008707.390ON71535880.12
NCAS0G001705.712ON103034880.13
TBLA0E025703.270ON78577880.13
Skud_2.387.390ON74831880.14
TDEL0B020805.712ON102532880.14
Ecym_40095.712ON151732870.17
KAFR0D021605.712ON84659860.21
KNAG0B023707.390ON75332860.22
TBLA0D010708.742ON48339850.24
Skud_5.2237.390ON74835850.24
CAGL0I06765g8.188ON88782850.26
TPHA0D046605.712ON104549850.26
Smik_5.2447.390ON74935850.26
KLTH0B09944g5.18ON118929850.27
KLTH0E00814g5.712ON97432850.28
KNAG0L022005.712ON116132850.29
YDL122W (UBP1)2.307ON80973850.30
TBLA0D006207.390ON117158850.33
Suva_5.2177.390ON75435840.35
SAKL0D03322g3.270ON76523840.35
TBLA0C070205.18ON124748840.36
Smik_9.135.712ON106088840.36
YER098W (UBP9)7.390ON75435840.38
CAGL0H06721g5.712ON108146840.38
CAGL0G05247g8.188ON94772840.41
CAGL0G02563gsingletonON63130830.42
NDAI0F002005.712ON110532840.42
KLLA0E10275g8.188ON79672830.47
KLLA0E20351g7.390ON69731830.50
SAKL0E15136g5.712ON103732830.52
NCAS0A143707.390ON72935820.55
TPHA0C027708.188ON97068830.56
AFR296C5.712ON116934830.56
KLTH0A06534g6.331ON558152820.58
YIL156W (UBP7)5.712ON107132820.61
Kwal_26.95985.18ON119129820.64
Kpol_1018.937.390ON75531820.68
ZYRO0C09812g2.69ON70237810.73
Skud_9.125.712ON106488820.73
Skud_11.3385.712ON71232810.75
Suva_9.305.712ON106232820.75
KAFR0H001505.712ON65630810.76
KLTH0C07326g3.270ON762110810.80
NCAS0B042808.188ON92268810.86
KAFR0C004103.270ON76929810.86
TPHA0P006807.390ON72747810.89
AGL357W5.18ON116622810.89
Ecym_56715.18ON117622810.90
Skud_13.4785.18ON123148810.91
Smik_13.5215.18ON123148810.95
NCAS0E026107.390ON71735800.96
SAKL0F12430g7.390ON75435800.96
KAFR0K018107.390ON71455800.97
Kpol_1064.488.742ON46639800.99
YMR304W (UBP15)5.18ON123048801.0
SAKL0H00418g5.18ON119029801.0
KLTH0C06732g7.390ON71435801.0
Suva_13.4955.18ON123048801.1
TBLA0F036108.188ON114469801.1
TDEL0G023702.307ON74743801.1
Klac_YGOB_Anc_5.18b5.18ON116636801.1
NCAS0D023905.18ON121129801.2
NDAI0I025305.18ON119729801.3
TPHA0L022905.18ON119329791.3
ZYRO0B03300g7.390ON81350791.4
KAFR0C025908.188ON97868791.4
ZYRO0D07062g5.18ON119338791.5
KAFR0I026005.18ON121329791.5
KNAG0C035807.390ON77635791.6
ZYRO0A05962g8.742ON46543781.6
CAGL0A04477g7.390ON77031781.6
Kpol_513.255.18ON119029791.7
CAGL0I05522g7.390ON72451781.8
NCAS0A039108.188ON79568781.9
CAGL0M13783g5.18ON1196135781.9
KNAG0E012905.18ON119629781.9
Smik_4.1152.307ON79075781.9
ZYRO0G06798g8.188ON87769782.0
Skud_4.1332.307ON78772782.1
Kpol_1070.24.9ON66263772.1
Suva_14.1562.69ON78868782.1
NDAI0B034302.307ON85641782.1
Ecym_34242.625ON13377722.4
Kwal_56.230843.270ON76243772.4
Smik_13.4318.742ON47139772.4
NCAS0B061302.307ON77054772.4
YKR098C (UBP11)5.712ON71798772.6
TDEL0B042208.188ON82572772.6
Suva_11.3355.712ON72487772.7
TDEL0G004105.18ON118622772.8
Suva_4.2953.270ON782108772.8
ZYRO0B16544g5.712ON104439772.8
Kwal_26.91518.742ON45439762.8
KLLA0F18700g3.270ON77040762.8
TDEL0C015707.390ON76535763.0
KLTH0H07678g8.188ON86134763.2
SAKL0H18986g8.188ON89341763.3
NDAI0A016707.390ON84635754.0
Kpol_1044.242.69ON72495754.1
TPHA0G008502.307ON78254754.2
SAKL0B03036g8.97ON47230744.3
CAGL0H05335g8.540ON483117744.4
Skud_2.1773.270ON78243754.4
ZYRO0F01276g3.270ON77621744.9
KLTH0E09702g2.390ON60753745.1
NDAI0E008108.742ON49339745.2
KLTH0B07150g2.69ON75681745.5
ZYRO0C13068g8.160aON21672725.9
Kwal_33.144302.69ON51181736.1
KLTH0G10934g2.307ON75865736.8
AFR007W8.188ON84896728.6
Ecym_61848.188ON85172729.3
Suva_4.1252.307ON793437210.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D05070
         (1227 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  2378   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1288   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1286   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1282   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1280   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1279   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1273   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1248   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1241   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1228   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1209   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1169   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1155   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1144   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1127   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1100   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1083   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1060   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...   860   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   674   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   634   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   577   0.0  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    64   1e-09
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    60   2e-08
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    59   4e-08
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    59   6e-08
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    56   4e-07
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    55   5e-07
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    55   6e-07
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    54   2e-06
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    54   2e-06
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    52   5e-06
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    52   5e-06
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    52   1e-05
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    51   1e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    50   3e-05
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    49   8e-05
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    49   9e-05
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    48   1e-04
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    48   1e-04
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    48   2e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   2e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    47   4e-04
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    46   5e-04
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    45   0.002
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    45   0.002
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    45   0.002
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    44   0.003
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    44   0.003
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    44   0.003
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    44   0.003
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    44   0.003
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    44   0.004
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    44   0.005
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    42   0.010
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    42   0.012
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    41   0.020
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    41   0.025
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    41   0.029
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    41   0.030
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    40   0.038
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    40   0.042
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    40   0.043
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    40   0.046
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    40   0.047
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              40   0.052
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    40   0.053
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    40   0.056
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    40   0.062
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    39   0.081
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    39   0.10 
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    39   0.11 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    39   0.12 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    39   0.12 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.12 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    39   0.12 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      39   0.13 
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    39   0.13 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    39   0.14 
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.14 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.17 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    38   0.21 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.22 
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    37   0.24 
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    37   0.24 
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    37   0.26 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    37   0.26 
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    37   0.26 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    37   0.27 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    37   0.28 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    37   0.29 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    37   0.30 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.33 
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    37   0.35 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.35 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    37   0.36 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.36 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    37   0.38 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    37   0.38 
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    37   0.41 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.42 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.42 
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    37   0.47 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.50 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.52 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    36   0.55 
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    37   0.56 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    37   0.56 
KLTH0A06534g Chr1 (543130..544806) [1677 bp, 558 aa] {ON} weakly...    36   0.58 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    36   0.61 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    36   0.64 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    36   0.68 
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    36   0.73 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    36   0.73 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    36   0.75 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    36   0.75 
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    36   0.76 
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    36   0.80 
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     36   0.86 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    36   0.86 
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    36   0.89 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    36   0.89 
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    36   0.90 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    36   0.91 
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    36   0.95 
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    35   0.96 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    35   0.96 
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    35   0.97 
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    35   0.99 
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    35   1.0  
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    35   1.0  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   1.0  
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    35   1.1  
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    35   1.1  
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    35   1.1  
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    35   1.1  
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    35   1.2  
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    35   1.3  
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    35   1.3  
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    35   1.4  
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    35   1.4  
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    35   1.5  
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    35   1.5  
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    35   1.6  
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    35   1.6  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    35   1.6  
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    35   1.7  
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    35   1.8  
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     35   1.9  
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    35   1.9  
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    35   1.9  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    35   1.9  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    35   2.0  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    35   2.1  
Kpol_1070.2 s1070 complement(3357..5345) [1989 bp, 662 aa] {ON} ...    34   2.1  
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    35   2.1  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     35   2.1  
Ecym_3424 Chr3 complement(798948..799349) [402 bp, 133 aa] {ON} ...    32   2.4  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    34   2.4  
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    34   2.4  
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    34   2.4  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    34   2.6  
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...    34   2.6  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    34   2.7  
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    34   2.8  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    34   2.8  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    34   2.8  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    34   2.8  
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    34   2.8  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    34   3.0  
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    34   3.2  
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    34   3.3  
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    33   4.0  
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    33   4.1  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    33   4.2  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    33   4.3  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    33   4.4  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    33   4.4  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    33   4.9  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...    33   5.1  
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    33   5.2  
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    33   5.5  
ZYRO0C13068g Chr3 complement(1036937..1037587) [651 bp, 216 aa] ...    32   5.9  
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    33   6.1  
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    33   6.8  
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    32   8.6  
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    32   9.3  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    32   10.0 

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 2378 bits (6164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1164/1227 (94%), Positives = 1164/1227 (94%)

Query: 1    MLQQDTEQSIEAHAGDSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLID 60
            MLQQDTEQSIEAHAGDSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLID
Sbjct: 1    MLQQDTEQSIEAHAGDSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLID 60

Query: 61   DIVYDLAFINDSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESI 120
            DIVYDLAFINDSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESI
Sbjct: 61   DIVYDLAFINDSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESI 120

Query: 121  SCPDHNRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYH 180
            SCPDHNRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYH
Sbjct: 121  SCPDHNRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYH 180

Query: 181  LITELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXH 240
            LITELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLIL                    H
Sbjct: 181  LITELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEH 240

Query: 241  ITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNS 300
            ITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNS
Sbjct: 241  ITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNS 300

Query: 301  HMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAF 360
            HMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAF
Sbjct: 301  HMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAF 360

Query: 361  WGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNN 420
            WGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNN
Sbjct: 361  WGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNN 420

Query: 421  YHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDV 480
            YHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDV
Sbjct: 421  YHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDV 480

Query: 481  VGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIK 540
            VGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIK
Sbjct: 481  VGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIK 540

Query: 541  LMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALY 600
            LMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALY
Sbjct: 541  LMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALY 600

Query: 601  TIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWG 660
            TIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWG
Sbjct: 601  TIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWG 660

Query: 661  QKILNEYDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCY 720
            QKILNEYDQ            SEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCY
Sbjct: 661  QKILNEYDQLLILKAALTKIASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCY 720

Query: 721  LNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLR 780
            LNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLR
Sbjct: 721  LNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLR 780

Query: 781  DLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASEVERTTVDLPFDKEGDIXXXXXX 840
            DLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASEVERTTVDLPFDKEGDI      
Sbjct: 781  DLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASEVERTTVDLPFDKEGDIDLVDLS 840

Query: 841  XXXXXXXXXAQEVTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNV 900
                     AQEVTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNV
Sbjct: 841  NDNLNTTNNAQEVTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNV 900

Query: 901  LYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISD 960
            LYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISD
Sbjct: 901  LYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISD 960

Query: 961  HPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIE 1020
            HPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIE
Sbjct: 961  HPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIE 1020

Query: 1021 PLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYL 1080
            PLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYL
Sbjct: 1021 PLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYL 1080

Query: 1081 ETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDE 1140
            ETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDE
Sbjct: 1081 ETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDE 1140

Query: 1141 FRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNT 1200
            FRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND                GNT
Sbjct: 1141 FRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFTEGNT 1200

Query: 1201 ATPYFLVFVKDYYKGDIEPLKRIIADD 1227
            ATPYFLVFVKDYYKGDIEPLKRIIADD
Sbjct: 1201 ATPYFLVFVKDYYKGDIEPLKRIIADD 1227

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1288 bits (3332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1266 (51%), Positives = 859/1266 (67%), Gaps = 55/1266 (4%)

Query: 1    MLQQDTEQSIEAHAGDSDEQSVSSTTADEKSLPPN-DDGKQLLYPAVGLNLPFKTPDRLI 59
            +L QD E + + +    ++  +  T+ +++S P + DDGK LLYP +  NLP KT DRL+
Sbjct: 19   LLNQDKENA-DRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLLYPDIATNLPLKTSDRLL 77

Query: 60   DDIVYDLAFINDSDLSS-----EFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTK 114
            DDI+ D  F+N +D        + +GILK S L+YS  R  +RP+  LG+  DQ+  QTK
Sbjct: 78   DDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIRPNC-LGSLTDQVVFQTK 136

Query: 115  YEYESISCPDHNRINVFFGVLIDSNM--ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKK 172
             EY+SISCP +N+I+VF  V+ + ++  +  ++FD + + PIYHLKV+VK R +LE LKK
Sbjct: 137  SEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKVRQELERLKK 196

Query: 173  HVGISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXX 232
            HVG++ +H +  LH +D+ DL TFD SD NL+D+  YVS DTNKLIL             
Sbjct: 197  HVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEE 256

Query: 233  XXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTIN 292
                    I  RY  +C + +SL+    PSQVDCF TLF++FKGPL RKS   +P KTI+
Sbjct: 257  HESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKGPLTRKSK-AEPTKTID 315

Query: 293  ATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYT 352
            + N ALN+H++ +WL SKYGFQ +S  + E N+   EY PPD++D+ ND + RK+R+S+ 
Sbjct: 316  SGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVDYVNDLETRKIRESFV 375

Query: 353  RKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARR--LQQD 410
            RKCLQL FWG+LS  LL+  +  K  KS +  + + T  ST   F +  +S  R  L  +
Sbjct: 376  RKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWFHLLGESRARILLNSN 435

Query: 411  DTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQ 470
            + + SPLD   HFINLS S+YYTDRDII+NYE+L ++D  N G+YFDALTYIAN KG+YQ
Sbjct: 436  EQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQ 495

Query: 471  LISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQE-QNASRGDMQRLT 529
            LI+YCGKQD++GQE L+N+L +  ++    +I  LN++ L SIYK E  N S+     LT
Sbjct: 496  LIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYKYETSNKSQVTSNHLT 555

Query: 530  ELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSP 589
             LK+A+R++ K  +S KL+F++DHEPY  +  AY+ L IDESVD+DI++TAY+++INDSP
Sbjct: 556  NLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSP 615

Query: 590  GLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDE 649
            GLK+DCD+ALYTIAI  RS+ LFNFL E+CP F  YYGP+ L +Q+AL LLQVNENA+DE
Sbjct: 616  GLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDE 675

Query: 650  LVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWP 709
             ++KIF+Q+W  + + E DQ             E+NS LI+ FL TG ID N L PENWP
Sbjct: 676  TILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWP 735

Query: 710  IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNK---RRIGGREVSE 766
             G+NNIGNTCYLNSLLQYYFSIAPLR Y+L Y+ ++ N+  D  SN    RRIGGRE+S 
Sbjct: 736  TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFN-DHLSNSGHIRRIGGREISR 794

Query: 767  NEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAA---------- 816
             EVERSIQF+YQLR+LF  M++++ RC+TP  ELAYLAFAPSN+EVEF            
Sbjct: 795  GEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTG 854

Query: 817  --SEVERTTVDLPFDKE----------------GDIXXXXXXXXXXXXXXXAQEVTSDIS 858
              S+ ++ T D  F  +                GD+                 E      
Sbjct: 855  VLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNESNDAEVSE------ 908

Query: 859  VATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFE 918
               ED     + T+ AKISSDQLENALEMGRQQDVTECIGNVL+Q+ES S+PI+ DED E
Sbjct: 909  --NEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNE 966

Query: 919  QYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFL 978
            QYDL+K+LFYG TKQ IVPLS  +K RTK E F SLL+NI DHP+DIYDA +S F  E+L
Sbjct: 967  QYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL 1026

Query: 979  KMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDN 1038
             M+EYGDV RTV++T FP ILQ+QIQRVYYDRER MPFKSIEPLPF   IYMDRYA  +N
Sbjct: 1027 TMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTEN 1086

Query: 1039 ELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLS 1098
             LL  KK ET+E++ KLK +K RQ ELL+R++ GL+RK+++LE+I  L  + T+    L 
Sbjct: 1087 PLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESD-TIKKTPLK 1145

Query: 1099 VLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEA 1158
            +     +I+ LR  + NID+EL ++Y++IN +E KI HQFD+F++ GYSLF+VFIHRGEA
Sbjct: 1146 IEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEA 1205

Query: 1159 SYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYYKGDIE 1218
            SYGHYW+YIKD  R+GIWRKYND                GNTATPYFLV+VK   +GDIE
Sbjct: 1206 SYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQEGDIE 1265

Query: 1219 PLKRII 1224
            PLKRI+
Sbjct: 1266 PLKRIL 1271

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1286 bits (3328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1228 (53%), Positives = 842/1228 (68%), Gaps = 51/1228 (4%)

Query: 36   DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSS-----EFKGILKSSPLTYS 90
            DDGK LLYP +   LP KT DRL+DDI+ D AF N +D S      +  GILK S L+YS
Sbjct: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113

Query: 91   KRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNM--ENPTSFDA 148
              R  +RP   LG+  DQ+ LQTK EY+SISCP +N+I V   V+ + ++  +   +FD 
Sbjct: 114  NFRSRIRPD-ALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDD 172

Query: 149  VAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAA 208
            + + PIYHLKVTVK R +LE LKKHVG++ +H +  LH +D  DL TFD SD NL D+  
Sbjct: 173  IVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGI 232

Query: 209  YVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFR 268
            YVS DTNKLIL                     I  RY  VC + +SLN +  PSQ DCF 
Sbjct: 233  YVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFY 292

Query: 269  TLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGL 328
            TLF++FKGPL RKS   DPIKTI++ N  LN+H++ +WL SKYGFQ +S  + E N+   
Sbjct: 293  TLFKIFKGPLARKST-ADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351

Query: 329  EYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMH 388
            EY PPD++D+  DWKIRK+R+SY RKCLQL FWG+LS  LL+  ++ K  KS +  + + 
Sbjct: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQ 411

Query: 389  THTSTTALFQIFNDSARR--LQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCN 446
            T  S    FQ+  +S  R  L  ++ + SPLD   HFINLS S+YYTDRDII+NYE L +
Sbjct: 412  TSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSS 471

Query: 447  IDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLN 506
            +D  N G+YFDALTYIAN KG+YQ+I+YCGKQD++GQE L+N+L V  +D    DI  LN
Sbjct: 472  LDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELN 531

Query: 507  DSLLFSIYKQE-QNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNL 565
            ++ L SIYK E  N ++     LT LK+A+R++ K  +S KL+F++DHEPY  +  AY+ 
Sbjct: 532  EATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 566  LDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITY 625
            L IDESVD+DI++TAY+I+INDSPGLK+DCD+ALYTIAI  RS+ LFNFL ++CP F  Y
Sbjct: 592  LAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNY 651

Query: 626  YGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKN 685
            YGP+ L +Q+AL LLQVNENA+DE ++KIF+ +W  + + E DQ             E+N
Sbjct: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERN 711

Query: 686  SKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSI 745
            S LI+ FL TG ID N L PENWP G+NNIGNTCYLNSLLQYYFSIAPLR YILNY+ ++
Sbjct: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771

Query: 746  SNYEIDETSNK---RRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAY 802
            +N+  D  SN    RR+GGRE+SE EVERSIQF++QLR+LF  M++S+ RC+TP  ELAY
Sbjct: 772  NNFN-DHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAY 830

Query: 803  LAFAPSNIEVEF-----------------------AASEVERTTVDLPFDKE--GDIXXX 837
            LAFAPSN+EVEF                       A +E +   +D   D+   GD+   
Sbjct: 831  LAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKD 890

Query: 838  XXXXXXXXXXXXAQEVTSDISV-ATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTEC 896
                            ++D+ +  T+D     + T+ AKISSDQLENALEMGRQQDVTEC
Sbjct: 891  ENNHEKTE--------SNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTEC 942

Query: 897  IGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLV 956
            IGNVL+Q+ES S+PI+ DED EQYDLIK+LFYG TKQ IVPLS   K RTK E F SLLV
Sbjct: 943  IGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLV 1002

Query: 957  NISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPF 1016
            NI DHP+DIYDA +S F  E+L M EYGDV+RTV++T FP ILQ+QIQRVYYDRERFMPF
Sbjct: 1003 NIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPF 1062

Query: 1017 KSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRK 1076
            KSIEPLPF   IYMDRYA  DN  L  KK ET++L+ K K +K RQ ELLNR+  GL+RK
Sbjct: 1063 KSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRK 1122

Query: 1077 ESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDH 1136
            +++LETI  L + + V +  L++ ++  +I+ L+  +++ID+EL  +Y +IN +E+KI H
Sbjct: 1123 DAFLETIKLL-ESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISH 1181

Query: 1137 QFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXX 1196
            QFD+F++ GYSLF+VFIHRGEASYGHYW+YIKD  ++G+WRKYND               
Sbjct: 1182 QFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFN 1241

Query: 1197 XGNTATPYFLVFVKDYYKGDIEPLKRII 1224
             GNTATPYFLV+VK   + DIEPLKRI+
Sbjct: 1242 EGNTATPYFLVYVKQGQEADIEPLKRIL 1269

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1282 bits (3317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1236 (53%), Positives = 848/1236 (68%), Gaps = 54/1236 (4%)

Query: 36   DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFIND--------SDLSSEF-KGILKSSP 86
            DDGKQLLYP V  + P KT +RLIDDI+ DL+F+           D+ +    GILK S 
Sbjct: 36   DDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLGNGILKQSM 95

Query: 87   LTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSF 146
            L YSK + +   S+ +G+ IDQ+TLQTKYEY+S++CP+ N++ VFFGVL + N    T+ 
Sbjct: 96   LNYSKVKNQ-PGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFN-NSTQITNL 153

Query: 147  DAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDF 206
            D V + PIYHLKVTVKTR  LE  KKH G++ +HL+ +LH +DKQD+ TF+  D NL+D+
Sbjct: 154  DEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPEDPNLLDY 213

Query: 207  AAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDC 266
            A YVS+DTNKLIL                    +I  RYQ  CEQ+D+LN +  P+Q+DC
Sbjct: 214  AIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQLDC 273

Query: 267  FRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQ 326
              TLF+VFKGPL RKS+D +P KTI++TNK LNSH++ +WL SKYGF     ++     Q
Sbjct: 274  LNTLFKVFKGPLSRKSSD-EPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNAQQ 332

Query: 327  GLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNK 386
             +EYEPP+L+++  D+++R+LR++Y R+CLQL FWGKLS  L       K  KSY+  N 
Sbjct: 333  SVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSINA 392

Query: 387  MHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCN 446
            + T+ + T L Q+F  S +       S SPLD N+HFINLS+ Y+YTDRD+I+NYE LC+
Sbjct: 393  LQTNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRNYERLCH 452

Query: 447  IDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLN 506
            +D  N G+YFDAL YIANTKGSYQLI+YCGKQD+VGQE L  +L+   LD   VDI  +N
Sbjct: 453  LDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITKIN 512

Query: 507  DSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLL 566
            DS+L ++YK E   S  D   +  LK+AMR+  K+  S KL+F+IDHEPY  V  AY  L
Sbjct: 513  DSVLLTLYKNELKISTSD---IPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYETL 569

Query: 567  DIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYY 626
            DIDESVDDDIVQTAY I++ DSPGL MDCD+ALYTIAI  RS+ LF FL+E+CPDF  YY
Sbjct: 570  DIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQEYY 629

Query: 627  GPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNS 686
             PD  ++  ALS+ QVNENA DEL+IK FQ RW  + + E +              ++NS
Sbjct: 630  CPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQRNS 689

Query: 687  KLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSIS 746
             LIS FL+TG ID N L  ++WP G+NNIGNTCYLNSLLQYYFSIAPLR Y+L Y  +I 
Sbjct: 690  SLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKTIE 749

Query: 747  NYEIDE--TSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLA 804
            +++  E   S  RRIGGREVS NEVERSIQF+YQLRDLF+ M+YS  RC+TP+ ELAYLA
Sbjct: 750  DFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAYLA 809

Query: 805  FAPSNIEVEFAASE---------VERTTVDLPFDKE--------GDIXX--------XXX 839
            FAPSNIEVEF  +E          E TT +L  DK+        GDI             
Sbjct: 810  FAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDISMSDNITPKDAEE 869

Query: 840  XXXXXXXXXXAQEVTSDISVATEDKVMTN----------TSTKTAKISSDQLENALEMGR 889
                       Q+V++ +S  T+D +MT+          TSTK AKISSDQLENALEMGR
Sbjct: 870  EEDQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVVSNEGTSTKVAKISSDQLENALEMGR 929

Query: 890  QQDVTECIGNVLYQMESASKPIKLDE-DFEQYDLIKELFYGKTKQEIVPLSDISKTRTKY 948
            QQDVTECIGNVL+Q+ES S+P+ L E D EQ DL+K+LFYG+ +Q IVPL++  + R K 
Sbjct: 930  QQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLANPDQRRPKL 989

Query: 949  EGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYY 1008
            E F SLLVNI DHPRDIYDAL+  F  E+LKM+EYGDV+RTV++T FP ILQIQIQRVYY
Sbjct: 990  ERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPTILQIQIQRVYY 1049

Query: 1009 DRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNR 1068
            DRE+FMPFKSIEPLPF   IYMDRY+  DN  L  +KNET  ++ KL  LK +Q +LL+R
Sbjct: 1050 DREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVELKKKQRDLLSR 1109

Query: 1069 NELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEIN 1128
            N +GLS+K+SY+E    LS ++ + SQG+ +  + +++  L+   + ID EL+Q+Y EI+
Sbjct: 1110 NSVGLSKKDSYIELGKLLSSDS-LESQGIILPEKDEMVSSLKTLTAGIDDELNQLYAEIS 1168

Query: 1129 LIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXX 1188
             +E  I+ QF+EF+ IGYS+FAVFIHRGEASYGHYW+YIKD  ++GIWRKYND       
Sbjct: 1169 QLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDETVSEVP 1228

Query: 1189 XXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRII 1224
                     GNTATPYFLV+VK+  + +IEPLKRII
Sbjct: 1229 EEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRII 1264

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1280 bits (3311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1240 (52%), Positives = 854/1240 (68%), Gaps = 36/1240 (2%)

Query: 18   DEQSVSSTTADEKSLPPN-DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSS 76
            +E  +  T+A  +S P + DDGK LLYP +  +LP KT DRL+DDI+ D  F+N +D S 
Sbjct: 35   EECPLYETSASHQSAPVDFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSV 94

Query: 77   -----EFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVF 131
                 +  GIL+ S L+YS  R  +RP+  LG+  DQ+ +QTK EY+S SCP +N+I+VF
Sbjct: 95   IEKGLQTTGILRESMLSYSSFRSSIRPN-ALGSVTDQVVIQTKIEYDSYSCPKYNKIHVF 153

Query: 132  FGVLIDSNM--ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFD 189
              V+++ ++  ++ +SFD + + PIYHLKVTVK R +LE LKKHVG++ +H I  LH +D
Sbjct: 154  QAVILNPSLTEQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYD 213

Query: 190  KQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVC 249
            + D  TFD SD NL+D+  YVS DTNKLIL                     I  RY  +C
Sbjct: 214  RVDFSTFDSSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMC 273

Query: 250  EQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVS 309
               +SL+ +  PSQ DCF TLF++FKGPL RKS   +P+KTI++ N ALN+H++ +WL S
Sbjct: 274  LNNESLDKNNTPSQADCFYTLFKIFKGPLTRKSK-TEPVKTIDSGNLALNTHLNPEWLTS 332

Query: 310  KYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLL 369
            KYGFQ +S  + E N++  EY PPD++D+ +D K+RK+R+S+ RKCLQL FWG+LS  LL
Sbjct: 333  KYGFQVSSEIDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLL 392

Query: 370  SKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDS-ARRLQQDDTSASPLDNNYHFINLSS 428
            +  +  K  KS +  + + T  S+   F +  +S +R L   + S SPLD   HF+NLS 
Sbjct: 393  APNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSV 452

Query: 429  SYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQN 488
            S+YYTDRDII+NYE+L ++D  N G+YFDALTYIAN KG+YQLI+YCGKQD++GQE L+N
Sbjct: 453  SHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALEN 512

Query: 489  SLRVLGLDATSVDIKSLNDSLLFSIYKQE-QNASRGDMQRLTELKSAMRVMIKLMRSKKL 547
            +L V  ++    +I  LN++ L SIYK E  N S+     LT LK+A+R++ K  +S KL
Sbjct: 513  ALLVFKIEPKECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKL 572

Query: 548  QFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTR 607
            +F++DHEPY  +  AY+ L IDESVD+DI++TAY+++INDSPGLK+DCD+ALYTIAI  +
Sbjct: 573  KFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKK 632

Query: 608  SITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEY 667
            S+ LFNFL ++CP F+TYYG + L +Q+AL LLQVNENA+DE ++KIF+Q+W  + + E 
Sbjct: 633  SLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEP 692

Query: 668  DQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQY 727
            DQ             E+NS LIS FL TG ID N L PENWP G+NNIGNTCYLNSLLQY
Sbjct: 693  DQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 752

Query: 728  YFSIAPLREYILNYKGSISNY--EIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFND 785
            YFSIAPLR YIL+Y+ ++ N+   +  + + RRIGGR++S+ EVERS+QF+YQLR+LF  
Sbjct: 753  YFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYA 812

Query: 786  MIYSKSRCITPKHELAYLAFAPSNIEVEF----------AASEV---ERTTVDLPFDKEG 832
            M++S+ RC+TP  ELAYLAFAPSNIEVEF          AA  +   E  T +    KE 
Sbjct: 813  MVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKEN 872

Query: 833  DIXXXXXXXXXXX--------XXXXAQEVTSDISVATEDKVMTNTSTKTAKISSDQLENA 884
            D                          E  +   V  +D    N+ T+ AKISSDQLENA
Sbjct: 873  DPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENA 932

Query: 885  LEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKT 944
            LEMGRQQDVTECIGNVL+Q+ES S+PIK DED EQYDL+K+LFYG TKQ IVPLS  +K 
Sbjct: 933  LEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKV 992

Query: 945  RTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQ 1004
            RTK E F SLL+NI DHP+DIYDA +S F  E+L M+EYGDV RTV++T FP ILQ+QIQ
Sbjct: 993  RTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQ 1052

Query: 1005 RVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVE 1064
            RVYYDRERFMPFKSIEPLPF   IYMDRYA  +N LL  KKNET+E++ KL+ +K RQ E
Sbjct: 1053 RVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRE 1112

Query: 1065 LLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIY 1124
            LL+R+  GL+RK+++LE+I  L + + V    L    +  +I  LR  ++NID+EL  +Y
Sbjct: 1113 LLSRDNSGLTRKDAFLESIKLL-ESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLY 1171

Query: 1125 DEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXX 1184
            + IN +E KI HQFD+F++ GYSLF+VFIHRGEASYGHYW+YIKD   +G+WRKYND   
Sbjct: 1172 NNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETV 1231

Query: 1185 XXXXXXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRII 1224
                         GNTATPYFLV+VK   + DIEPLKRI+
Sbjct: 1232 SEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1279 bits (3309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1228 (52%), Positives = 852/1228 (69%), Gaps = 40/1228 (3%)

Query: 31   SLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSD----LSSEFKGILKSSP 86
            +L   D GK++LY  V    PFKT DRL+DD+++DLAFIN  D     S    GILK+  
Sbjct: 54   TLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPV 113

Query: 87   LTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSF 146
            L YS+R  +L P Y  GT +DQITLQT +EY SISCP HN++NV+ GVLID   +   + 
Sbjct: 114  LAYSRRISQLYP-YSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITS 172

Query: 147  DAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITE--LHPFDKQDLLTFDESDENLI 204
              ++E  +YHLKVTVKTR+ LEH KK  G++HYH I+E  LH FD+QDL  FD +D  L+
Sbjct: 173  STLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLV 231

Query: 205  DFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQV 264
            D A YVSSDTNKL+L                     I +RY   C+++D+L+   IP+Q 
Sbjct: 232  DHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQA 291

Query: 265  DCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEAN 324
            DC  TL ++F+GPL+R++++ +P+KTIN+ N  LNS ++  WL SKYGF+ +  ++    
Sbjct: 292  DCINTLLKIFRGPLNRQNSE-EPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTG 350

Query: 325  DQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFF 384
            +   E+EPP+L ++  D K+R+LR+S+ RKC++L F GK + +LL K + +   K YR F
Sbjct: 351  ESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGK-DAKTTSKVYRTF 409

Query: 385  NKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETL 444
            N +    S T  F++  +       +  SASPLD NY+FINLS+ +YY DRDII+NYE  
Sbjct: 410  NAIQIAFSKTTWFKMLGEHRSIFSFE--SASPLDANYNFINLSACFYYIDRDIIKNYEAQ 467

Query: 445  CNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKS 504
            C +D  N GIYFDALTYIAN KG+YQL++YCGKQDVVGQE L  +L++ G+D+  VD+ +
Sbjct: 468  CALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVAT 527

Query: 505  LNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYN 564
            ++DSLL SIYK E  A+  +  R T+LK+A+R++ K  +S KL+FF D+EPY NV  AY 
Sbjct: 528  IDDSLLVSIYKSETMANPNE-NRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYE 586

Query: 565  LLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFIT 624
            +L++DESVDDDI++TAY+I INDSPGLK+DCD+ALYTI +R RS+ L N+L++QCPDF  
Sbjct: 587  ILEVDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQL 646

Query: 625  YYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEK 684
            YYGP  L + +ALS+LQ+NENA DE V+++FQ++W Q+   E D              E+
Sbjct: 647  YYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIER 706

Query: 685  NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
            NSKLI +F++TG IDA+ L  +NWP GLNNIGNTCYLNSLLQYYFS+APLR Y+L Y+ +
Sbjct: 707  NSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET 766

Query: 745  ISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLA 804
            + ++     +  RRIGGREVSE EVERS+QF+YQLRDLF  MIYSK RC+TP+ ELAYLA
Sbjct: 767  MEHFRHHTGNELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLA 826

Query: 805  FAPSNIEVEFAASEV----------ERTTVDLPF---------DKEGDIXXXXXXXXXXX 845
            FAPSN EVEF  + V          E T  D+           D+ G I           
Sbjct: 827  FAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDI 886

Query: 846  XXXXAQEVTSD------ISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGN 899
                 +E + +      +S A +D +++ TST+ AKISSDQLENALEMGRQQDVTECIGN
Sbjct: 887  DVSMTKEPSEEYKEDIPMSDAEKDNIIS-TSTRVAKISSDQLENALEMGRQQDVTECIGN 945

Query: 900  VLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNIS 959
            VL+Q+ESAS PI LDED EQ DL+K+LFYGK KQ I+PL+  ++ +TK E + SLLVNI 
Sbjct: 946  VLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIG 1005

Query: 960  DHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSI 1019
            DHP+DIYDAL+S F+ E L M EYGDV+RTV++T FP ILQIQIQRVYYDRERFMPFKSI
Sbjct: 1006 DHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSI 1065

Query: 1020 EPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESY 1079
            EPLPF+  +YMDRY+   +  +  KK E+++L+ +L  LK RQ ELL+ NELGLSRK +Y
Sbjct: 1066 EPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAY 1125

Query: 1080 LETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFD 1139
            +ETIN+L  +  + SQ L  LN   +IE+L+++I++ID EL+ +Y +I  +EN ID QF+
Sbjct: 1126 METINYLKSDL-IKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFE 1184

Query: 1140 EFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGN 1199
            EF+ IGYSLFAVFIHRGEASYGHYWVYIKD  ++G WRKYND                GN
Sbjct: 1185 EFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGN 1244

Query: 1200 TATPYFLVFVKDYYKGDIEPLKRIIADD 1227
            TATPYFLV+V+  ++ DIEPLKRII  D
Sbjct: 1245 TATPYFLVYVRQGHEHDIEPLKRIIDRD 1272

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1273 bits (3295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1246 (52%), Positives = 844/1246 (67%), Gaps = 42/1246 (3%)

Query: 18   DEQSVSSTTADEKSLP-PNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSS 76
            D+  +  T A  +S P   DDGK LLYP +  +LP KT DRL+DD++ D  F+N +D + 
Sbjct: 35   DDSPLYGTRASLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNV 94

Query: 77   -----EFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVF 131
                 +  GIL+ S L+YS  R  +RP+  LG+  DQ+T+QTK EY+SISCP +N+I VF
Sbjct: 95   IEKGLQTSGILRESMLSYSSFRSSIRPN-ALGSLTDQVTIQTKTEYDSISCPRYNKIYVF 153

Query: 132  FGVLIDSNM--ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFD 189
              V+++ ++  +  +SFD +   PIYHLKVTVK R +LE LKKHVG++ +H +  LH +D
Sbjct: 154  QAVILNPSLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYD 213

Query: 190  KQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVC 249
            + DL TFD SD  L+D+  YVS DTNKLIL                     I  RY  +C
Sbjct: 214  RVDLSTFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLC 273

Query: 250  EQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVS 309
             + +SLN    PSQ DCF TLF++FKGPL RKS + +PIKTI++ N  LN+H++++WL S
Sbjct: 274  LKNESLNKKEAPSQPDCFYTLFKIFKGPLTRKSKE-EPIKTIDSGNLVLNTHLNAEWLTS 332

Query: 310  KYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLL 369
            KYGFQ +S  + E ND   EY PPD++ +  DW  RK+R+S+ +KCLQL FWG+LS  LL
Sbjct: 333  KYGFQASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLL 392

Query: 370  SKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARR--LQQDDTSASPLDNNYHFINLS 427
            +  +  K  KS +  + + T  ST+  F +  +S  R  L  ++ + SPLD   HFINLS
Sbjct: 393  TPNSSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLS 452

Query: 428  SSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQ 487
             S+YYTDRDII+NYE L ++D +N G+YFDALTYIAN KG+YQLI+YCGKQ+++GQE L+
Sbjct: 453  VSHYYTDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALE 512

Query: 488  NSLRVLGLDATSVDIKSLNDSLLFSIYKQE-QNASRGDMQRLTELKSAMRVMIKLMRSKK 546
            N+L    +D    +I  LN++ L SIYK E  N S+     LT  K+A+R++ K  +S K
Sbjct: 513  NALVTFKIDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDK 572

Query: 547  LQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRT 606
            L+F++DHEPY  +  AY+ L IDESVD+DI++TAY+I+INDSPGLK+DCD+ALYTIAI  
Sbjct: 573  LKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISK 632

Query: 607  RSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNE 666
            RS+ LFNFL ++CP F+ YYGP+ L +Q+AL LLQVNENA+DE V+KIF+Q+W  + + E
Sbjct: 633  RSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFE 692

Query: 667  YDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQ 726
             DQ             E+NS LI+ FL TG ID N L PENWP G+NNIGNTCYLNSLLQ
Sbjct: 693  PDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQ 752

Query: 727  YYFSIAPLREYILNYKGSISNY--EIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFN 784
            YYFSIAPLR YIL Y+ ++ N+   +  + + RRIGGRE+S  EVERSIQF+YQLR+LF 
Sbjct: 753  YYFSIAPLRRYILEYQKTLDNFNDHLSNSGHVRRIGGREISRGEVERSIQFIYQLRNLFY 812

Query: 785  DMIYSKSRCITPKHELAYLAFAPSNIEVEF--AASEVERTTVDLPFDKEGDIXXXXXXXX 842
             M++S+ RC+TP  ELAYLAFAPSN+EVEF    ++V      +  D +G++        
Sbjct: 813  AMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTS 872

Query: 843  XXX---------------------XXXXAQEV--TSDISVATEDKVMTNTS-TKTAKISS 878
                                        A E    +DI +   + +    S T+ AKI S
Sbjct: 873  EEKDPSLIDLEMEDKTNSDVDKDIENVKANEANEANDIEITVGENITDLASPTRVAKIGS 932

Query: 879  DQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPL 938
            DQLENALEMGRQQDVTECIGNVL+Q+ES S+PI+ DED EQYDLIK+LFYG TKQ IVPL
Sbjct: 933  DQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPL 992

Query: 939  SDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKI 998
            S   K RTK E F SLLVNI DHP+DIYDA +S F  E+L M+EYGDV+RTV++T FP I
Sbjct: 993  SATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTI 1052

Query: 999  LQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTL 1058
            LQ+QIQRVYYDRERFMPFKSIEPLPF   IYMDRY+  +N LL  KK ET++++  LK +
Sbjct: 1053 LQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVM 1112

Query: 1059 KARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDS 1118
            K RQ ELL+R+E GL+RK+++LE+I  L     VT    S  N+  +I  L+  I +ID+
Sbjct: 1113 KNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNK-DVIRILKSNIIDIDN 1171

Query: 1119 ELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRK 1178
            EL  +Y++IN +E+KI HQFD+F + GYSLF+VFIHRGEASYGHYW+YIKD    G+WRK
Sbjct: 1172 ELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRK 1231

Query: 1179 YNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRII 1224
            YND                GNTATPYFLV+VK   + DIEPLKRI+
Sbjct: 1232 YNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQESDIEPLKRIL 1277

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1248 bits (3229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1236 (51%), Positives = 839/1236 (67%), Gaps = 39/1236 (3%)

Query: 16   DSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSD-- 73
            D D +S   + +    LP  DDGK LLY  +    P KT DRLIDDI+ DL+    S   
Sbjct: 34   DVDMESSLKSVSPTDQLP--DDGKHLLYTDLKNGSPMKTSDRLIDDILCDLSLNGQSQCL 91

Query: 74   LSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFG 133
            LS + +GILK  P+ YSK+RQ+L+    LG+ +DQ+  QTK+EY S+SCP HN++ VF G
Sbjct: 92   LSEQSQGILKLLPIIYSKQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLG 151

Query: 134  VLID--SNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQ 191
            VL++  S+ E   S D V  +P++HLKVTVKTR++LE  KKH G+S +  +  LH +DK+
Sbjct: 152  VLLNVSSSFE---STDDVVRSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKE 208

Query: 192  DLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQ 251
            DL TFD  D  LID+A YVSSDTNKL+L                     I  RY   C +
Sbjct: 209  DLGTFDPEDTRLIDYAIYVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSR 268

Query: 252  YDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKY 311
             DSLN + IP+Q DC  TL++ FK P+++      P++TI A+N  LNSHM++ WL  +Y
Sbjct: 269  LDSLNPEDIPNQFDCLNTLYKTFKNPINKTDPSA-PLQTIKASNPILNSHMNANWLTERY 327

Query: 312  GFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLL-- 369
            GF   +    E  D   EYEPP+   +  D K+RK+++ Y RKCLQL FW KL  +++  
Sbjct: 328  GF---TLLPGENEDDEDEYEPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDN 384

Query: 370  -SKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSS 428
              ++ +    KS++  + +    ++  L+Q+F +S       +      D NYHFI LS+
Sbjct: 385  TQRSKLAASSKSFKSLSGIAVQNTSKPLYQLFGESKNAFLNSNDQNYMWDTNYHFIALSA 444

Query: 429  SYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQN 488
            SY+Y DRDII NYET   ID  N GIYFDA+ +IAN KGSYQL++YCGKQ++VG E L+ 
Sbjct: 445  SYHYNDRDIIMNYETYSVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEA 504

Query: 489  SLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQ 548
            ++R   LD  ++DI  L+ SLL S+YK EQ  S  +   L++LK+A+RV+ K   ++ ++
Sbjct: 505  AMRAFKLDPAAIDINKLDISLLLSMYKHEQ-ISNQNTSHLSDLKNALRVLAKFKDNRFVK 563

Query: 549  FFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRS 608
            F++DHEPY  V  AYN L++DESVDDDI+QTAY+I++NDSPGLK++C +ALYTIAI  RS
Sbjct: 564  FYVDHEPYKTVSQAYNELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRS 623

Query: 609  ITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYD 668
            + LFN+L+E+CP+F  +YGP+  S++QAL+++QVNENA+DE++++IFQ++W  + L EYD
Sbjct: 624  MALFNYLIEECPEFQDFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYD 683

Query: 669  QXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYY 728
            Q             EKNSKLIS+FL TG+ID + L  ENWPIGLNNIGNTCYLNSLLQYY
Sbjct: 684  QFLSLKAALLKLCIEKNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYY 743

Query: 729  FSIAPLREYILNYKGSISNYEIDETSNK--RRIGGREVSENEVERSIQFMYQLRDLFNDM 786
            F+IAPLR YI +Y+ +  ++E  +T  K  RRIGGR+V  +EVERSIQF YQLRDLFN M
Sbjct: 744  FAIAPLRNYICSYQSTTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGM 803

Query: 787  IYSKSRCITPKHELAYLAFAPSNIEVEFAAS----------------EVERTTVDLPFDK 830
            I+S SRC++P  ELAYLAF+PSNIEVEF A                 + +    D+P ++
Sbjct: 804  IFSNSRCVSPTQELAYLAFSPSNIEVEFDAGSGIASESGGTFSLNGKDTDAPLTDMPLNE 863

Query: 831  EGDIXXXXXXXXXXXXXXXAQEVTSDISVATED--KVMTNTSTKTAKISSDQLENALEMG 888
              D+                  V +D+ V      K + N+STK AKI SDQLENALE+G
Sbjct: 864  --DVTMTEAGEPQLDDTGLLAPVEADVPVDQMKLAKEVINSSTKVAKIGSDQLENALELG 921

Query: 889  RQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKY 948
            RQQDVTECIGNVLYQ+ESAS PIKLDED EQYDLIK LFYGKT+Q+IVPLS+ +  R+KY
Sbjct: 922  RQQDVTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKY 981

Query: 949  EGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYY 1008
            E F SLLVN+SDHP+DIYDAL+S F  E+L ++EYGDV+RTV+IT FP ILQIQIQRVYY
Sbjct: 982  ERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYY 1041

Query: 1009 DRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNR 1068
            DRERFMPFKSIEP+PF++T+YMDRYAA D+ ++ TK+ ET EL+ +L+  K RQ ELL+R
Sbjct: 1042 DRERFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSR 1101

Query: 1069 NELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEIN 1128
            N++GLSRKE+Y ET+  L  +       +   ++  ++  L   +++ID EL Q+Y EI 
Sbjct: 1102 NDMGLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIG 1161

Query: 1129 LIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXX 1188
             +E +IDHQFD F+ +GYSLFAVFIHRGEASYGHYWVY+KD + SGIWRKYND       
Sbjct: 1162 QLETQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVP 1221

Query: 1189 XXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRII 1224
                     GN ATPYFLV VK  ++ DIEPL RII
Sbjct: 1222 EEEVFNFTEGNNATPYFLVLVKQTHEQDIEPLHRII 1257

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1241 bits (3210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1223 (52%), Positives = 843/1223 (68%), Gaps = 38/1223 (3%)

Query: 30   KSLPPN-DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSD----LSSEFKGILKS 84
            + +PP  DDGK LLYP V LN PFKT DRL+DDI  D+ F+N  +     S    G+L+ 
Sbjct: 27   QEVPPVIDDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRL 86

Query: 85   SPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPT 144
              L YS R++  +P   +G  +DQ+TL+TKYEYES +CP+ N+INVF GVL+D ++  P 
Sbjct: 87   PMLEYS-RKKTTQPC-SVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHI-RPE 143

Query: 145  SFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLI 204
            S D V   PIYHLK+TVKTR  LE +KKHVG++HYHLI +LH FDKQD+    ES E L+
Sbjct: 144  SLDDVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIFMTTES-EQLV 202

Query: 205  DFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQV 264
            D A YVSSDTN+L L                     +  RY   CE++  L+  ++P+QV
Sbjct: 203  DSATYVSSDTNRL-LRIEIFKPEFTKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQV 261

Query: 265  DCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEAN 324
            +C  TLF++FKGPL+R+S++ D +KTI+A NK LNS +D  WL  KY F+     + E  
Sbjct: 262  ECLNTLFKIFKGPLNRRSSE-DILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETG 320

Query: 325  DQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFF 384
            +   E+EPPDL D+  DW +R  R+SYTRKCL+L F GK S +LL K  + K  KS R F
Sbjct: 321  ELIREFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS-RSF 379

Query: 385  NKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETL 444
            N   T+ ST+  F +  D   R  QD     P DN+YHFINLS+S YY+D+DII+NYET 
Sbjct: 380  NLYQTNFSTSFWFHLLGDG--RNFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQ 437

Query: 445  CNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKS 504
             ++D  N GIYFDAL YIANTKG YQLI+YCGKQ++VG+E L  +L V G+D+   D+KS
Sbjct: 438  ISLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKS 497

Query: 505  LNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYN 564
            + D LL SIYK E  A+   +Q+ T+LK+A+R++ K   SKKL+F +D+EPY +   AY 
Sbjct: 498  ITDELLLSIYKNELKAA--SVQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQ 555

Query: 565  LLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFIT 624
            LL+I ESVD DI+QTAYTIR+ D+PGLK+DCD+ALYT+A+  RS+ LFNFL ++CP F  
Sbjct: 556  LLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQE 615

Query: 625  YYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEK 684
            +Y  D  S+++ALSLLQVNENATD+++++IFQ++W Q+ +   DQ             E+
Sbjct: 616  FYNIDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIER 675

Query: 685  NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
            NSKLI+ F++TG++D + L   NWP GLNNIGNTCYLNSLLQYYFSI+PLR+Y+LNY+  
Sbjct: 676  NSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKM 735

Query: 745  ISNY-EIDETS----NKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHE 799
            ++ + +I++ +    +KRRIG REVS+ EVERS+QF+YQLRDLF DM+++K R +TP  E
Sbjct: 736  LNCFRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKE 795

Query: 800  LAYLAFAPSNIEVEFAASEV---------ERTT----VDLP---FDKEGDIXXXXXXXXX 843
            LAYLAFAPSNIEVEF A  +         ERT     +DL     D E +          
Sbjct: 796  LAYLAFAPSNIEVEFEAPTITTVAPEDLDERTNKLDIIDLAADGIDNETEKGSKSSLLDV 855

Query: 844  XXXXXXAQEVTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQ 903
                   ++    I   T+++   N S + AKISSDQLEN LE+GRQQDVTECIGNVL+Q
Sbjct: 856  HNQQKPEEQTEDIIMGGTQEEEAVNASMRVAKISSDQLENTLELGRQQDVTECIGNVLFQ 915

Query: 904  MESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPR 963
            +ESAS P  L+ED EQ+DLIKELFYGK KQ ++P+ + SK RTK E F SLLVNI DHP+
Sbjct: 916  LESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIERFVSLLVNIGDHPK 975

Query: 964  DIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLP 1023
            DIYDAL+  F  + L++DE G+V+RTV++TN PKILQIQIQRVYYDRERFMPFKSIEPLP
Sbjct: 976  DIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYDRERFMPFKSIEPLP 1035

Query: 1024 FSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETI 1083
            FS TIYMDRY   D+ ++  K+++TK+L+ +L+ LK RQ +LL++N+ GLS K S L+T 
Sbjct: 1036 FSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKNDTGLSFKGSLLQTK 1095

Query: 1084 NFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRD 1143
             FL  E  +    ++V N+G ++  +   I+ ID ELS +Y +I  +E +I +QF+EF  
Sbjct: 1096 KFLQSEV-LDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITALEVQIANQFNEFTK 1154

Query: 1144 IGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATP 1203
            IGYSLFA FIHRGEASYGHYW+YIKD +++GIWRKYND                GNTATP
Sbjct: 1155 IGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTEGNTATP 1214

Query: 1204 YFLVFVKDYYKGDIEPLKRIIAD 1226
            YFLV++K+ ++ +IEPLKR+I +
Sbjct: 1215 YFLVYIKEGHEDEIEPLKRVIKE 1237

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1228 bits (3176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1234 (50%), Positives = 842/1234 (68%), Gaps = 42/1234 (3%)

Query: 25   TTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSSEFK----G 80
            +  D  S+   DDGKQLLYP      PFKT +RL+D+I+  + +I  S+    F     G
Sbjct: 41   SCGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNG 100

Query: 81   ILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNM 140
            +LK   L+YSK R  ++P + +GT +DQI LQTK+EY+S +CP+ N I V  GVLID+N 
Sbjct: 101  LLKKQLLSYSKSRHNVQP-FSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNH 159

Query: 141  ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESD 200
            +  ++FD VA+  IYHLK+TVK R+ LE  K+HVG+  YHL+  LHPFD+QDLL FD  D
Sbjct: 160  QPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKD 219

Query: 201  ENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTI 260
              L+D A YVS DTNKL+L                     I  R+    ++YD+L+ D I
Sbjct: 220  PKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEI 279

Query: 261  PSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQN 320
            P+Q+DC  T+F++FKGPL RKS D +P+KT+++ N  LNS M+ KWLV+KYGFQE     
Sbjct: 280  PTQIDCINTMFKIFKGPLTRKSND-EPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETE 338

Query: 321  PEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKS 380
             E  +Q ++Y PP+L+D + D  +RK R++ TRKCL+L + GK+S  L++    +   KS
Sbjct: 339  EETEEQLIDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKS 398

Query: 381  YRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQN 440
             R FN + T  ST    QI +++       +     LD  YH I+LS+SY+YTDRDIIQN
Sbjct: 399  LRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLD--YHLIDLSASYHYTDRDIIQN 456

Query: 441  YETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSV 500
            YE  C +D  N GIYFD+L +IAN +GSY LI YC KQD+VGQE L+ +L+   LD  ++
Sbjct: 457  YELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTI 516

Query: 501  DIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVM 560
            D+   ND++  +IYK E      D  RLT L++A+R++ K   S +L+F++D+EPY ++ 
Sbjct: 517  DLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQ 576

Query: 561  DAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCP 620
             A+N+L++DESVDDDI+QTAY+I++ND+PGLK+DCD+ALYT+A+  RS+ L NFL ++CP
Sbjct: 577  RAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECP 636

Query: 621  DFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXX 680
             F  +YGPD  ++ +AL  LQVNENA D+ +++IFQ+RW    + + D+           
Sbjct: 637  PFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKI 696

Query: 681  XSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILN 740
              E+NSKLIS +LETGV++   L  +NWP GLNNIGNTCYLNSLLQYYF I+PLR Y+ +
Sbjct: 697  AFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756

Query: 741  YKGSISNYE--IDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKH 798
            Y+ ++   E  +++  +KRRIGGRE+++ EVERS+QF+YQLRDLFN+MI+S SRC+TP  
Sbjct: 757  YQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTK 816

Query: 799  ELAYLAFAPSNIEVEF-AASEVERTTVDLPFDKEGDIXXXXXXXXXXXXXXXA-QEVTSD 856
            ELAYLAFAPSN+EVEF   +E++    +   D +GDI                  E  S 
Sbjct: 817  ELAYLAFAPSNVEVEFDQPNELQSGNGE---DVDGDIVFIDEDISEPKGKSLVLDEENSK 873

Query: 857  ISVATEDKVM--------------------------TNTSTKTAKISSDQLENALEMGRQ 890
            +  + E++++                          T+TST+ AKIS DQLENALE+GRQ
Sbjct: 874  VENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQ 933

Query: 891  QDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEG 950
            QDVTECIGNVL+Q+ESAS PI L+ED EQYDLIK+LFYGKTKQ I+PL + ++ R K E 
Sbjct: 934  QDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIER 993

Query: 951  FSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDR 1010
            F SLLVN+SDHP+D+YDAL+  F+ E+L MDEYG+V++++++T FP ILQIQIQRVYYDR
Sbjct: 994  FVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDR 1053

Query: 1011 ERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNE 1070
            ERFMPFKSIEPLPFS TIYMDRY    +  L  KK+ET EL+ +L  ++ RQ ELL+RNE
Sbjct: 1054 ERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNE 1113

Query: 1071 LGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLI 1130
            LGLSRKE+++ET  FLS +A +  QG+   N+  +I++L  A+ +ID EL+++Y++I  I
Sbjct: 1114 LGLSRKEAFMETRKFLSSDA-LEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNI 1172

Query: 1131 ENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXX 1190
            E KID QFD+F++IGYSLFAVFIHRGEASYGHYWVYIKD  ++GIWRKYND         
Sbjct: 1173 EAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEA 1232

Query: 1191 XXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRII 1224
                   GNTATPYFLV+VK     +IEPLKRI+
Sbjct: 1233 EVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1209 bits (3128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/1230 (52%), Positives = 839/1230 (68%), Gaps = 50/1230 (4%)

Query: 36   DDGKQLLYPAVG-LNLPFKTPDRLIDDIVYDLAFINDSDLSSEFK-GILKSSPLTYSKRR 93
            D G  LLYP +G  N P KT +R+IDDI+ DL+FIN  +LS  FK GIL+ S + YSK R
Sbjct: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS--FKNGILQESMIMYSKER 133

Query: 94   QELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLID--SNMENPTSFDAVAE 151
                 +Y  G+ +DQ+ LQTKYEY S++CP +N++ V FG+L++  SN+ N    + +++
Sbjct: 134  IN-NQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVD--EIISK 190

Query: 152  TPIYHLKVTVKTRTKLEHLKKHVGISHYHLI--TELHPFDKQDLLTFDESDENLIDFAAY 209
             PIYHLK+TVKTR  LE  KK  GI+ YHL+   +LH FDK+DL+TFD  + +L+D+A Y
Sbjct: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250

Query: 210  VSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFRT 269
            VSSDTN+LIL                     I SRYQ  C+++D+L+ + +P+ +DC  T
Sbjct: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310

Query: 270  LFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLE 329
            + ++ K PL RK+ + D I+T+++ N  L+SH + +WL+ KY F ++   +     + LE
Sbjct: 311  VLKLLKQPLTRKNNN-DKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLE 369

Query: 330  YEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKAN--IQKYEKSYRFFNKM 387
            YEPPDLI +   +K+R LR+ Y R+CLQL FWGK   +L    +    +  KSYR FN +
Sbjct: 370  YEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLL 429

Query: 388  HTHTSTTALFQIFNDSARRL---QQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETL 444
            +T TST  L+Q+ NDS        ++D+ +  LD N+HFINLS+S YYTDRDII+NYE L
Sbjct: 430  NTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERL 489

Query: 445  CNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKS 504
              +D  N G YFDAL+YIAN KGSYQLI+YCGKQDVVGQE +  +L+   +D   V+++S
Sbjct: 490  IALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLES 549

Query: 505  LNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYN 564
            ++DSLL SIYK E      D      LK+AMR+  K+  S +L+F++DHEPY NV  AY 
Sbjct: 550  IDDSLLLSIYKNESVKEGAD---FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYE 606

Query: 565  LLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFIT 624
             L+ID SVDDDI+QTAY+I+  D+PGLK+DCD+ALYTIAI+ RS+ LFNFL+E C +F  
Sbjct: 607  TLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQA 666

Query: 625  YYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEK 684
            YY      ++QAL +LQVNENA DE+++K FQ +W  + ++E DQ             E+
Sbjct: 667  YYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLER 726

Query: 685  NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
            NSKLI+ FL  GVID + L  ENWP G+NNIGNTCYLNSLLQYYFSI+PLREY+L Y  +
Sbjct: 727  NSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKT 786

Query: 745  ISNYEIDETSNK--RRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAY 802
              ++   + + K  RRIGGREV +NEVERSIQF+YQLRDLF  MIY+  RC+TP+ ELAY
Sbjct: 787  YEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAY 846

Query: 803  LAFAPSNIEVEF------AASEV-----ERTTVDLPFDKEGDIXXXXXXXXXXXXXX--- 848
            LAFAPSN+EVEF      A  +V     ++T+  L    EGD                  
Sbjct: 847  LAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIY 906

Query: 849  -------XAQEVTSDISV---ATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIG 898
                    A + T  I+    +TE+ +    STK AKISSDQLENALEMGRQQDVTECIG
Sbjct: 907  MTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIG 966

Query: 899  NVLYQMESASKPIKLD-EDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVN 957
            NVLYQ+ES S+P++++ ED EQ DL+K+LFYG+ KQ+I+PLS + +TR K E F SLLVN
Sbjct: 967  NVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVN 1026

Query: 958  ISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFK 1017
            + DHPRDIYDAL+  F  EFL MDEYG+V+RTV+IT FP ILQ+QIQRVYYDRERFMPFK
Sbjct: 1027 VGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFK 1086

Query: 1018 SIEPLPFSNTIYMDRYA-ALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRK 1076
            SIEPLPFS  IYMDRY    D E+L+T++  T +++ +L  LK RQ ELL+RNE+GLSRK
Sbjct: 1087 SIEPLPFSAKIYMDRYVDTADPEILETRE-RTAKMKAELVQLKKRQQELLSRNEVGLSRK 1145

Query: 1077 ESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDH 1136
            E+Y ET+NFL   A +  QG+    + ++   L+KA ++ID ELS IY++I  +E  I H
Sbjct: 1146 EAYSETVNFLQSNA-LQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISH 1204

Query: 1137 QFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXX 1196
            QF++F+ +GYSLFAVFIHRGEASYGHYWVYIKD  ++GIWRKYND               
Sbjct: 1205 QFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT 1264

Query: 1197 XGNTATPYFLVFVKDYYKGDIEPLKRIIAD 1226
             GNTATPYFLV+VK+  + DIEPLKRII +
Sbjct: 1265 EGNTATPYFLVYVKEGSEKDIEPLKRIIEE 1294

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1214 (49%), Positives = 812/1214 (66%), Gaps = 36/1214 (2%)

Query: 33   PPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSD---LSSEF-KGILKSSPLT 88
            P  D GK LLY   G   PFKT +RL+DDI  +LA+ N  +   L SE  KG+L+   L 
Sbjct: 33   PIKDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELHKGVLRLPILE 92

Query: 89   YSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSFDA 148
            YS++  +    Y++G  +DQ+ L+T+YEY+S +CP  N+I VF GVL++S+ + P  +D 
Sbjct: 93   YSRKPTD--DVYNIGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLNSS-QMPKIYDD 149

Query: 149  VAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAA 208
            V +  +YHLKVTVKTR  LE  +K  G+  YHL+ ELHPFDK+DLL  D  D +LID   
Sbjct: 150  VTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLTDAEDPHLIDSVM 209

Query: 209  YVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFR 268
            YVSSDTNKLI                      I  RY   C++Y  L+ D IPSQ +CF 
Sbjct: 210  YVSSDTNKLICIEIFKPEFSQADLTEFCPDA-IKKRYSSACDKYPDLDPDMIPSQAECFS 268

Query: 269  TLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGL 328
            TL ++FKGPL+R+  + D +KTI+A NK LNS +D KWL  K+ F+     + +     +
Sbjct: 269  TLLKIFKGPLNRRGPE-DVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGSAM 327

Query: 329  EYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMH 388
            E++PPDL ++ +D  +R+LR+SYTRKCL+L F GK+S+ L++K +I K  ++ R F    
Sbjct: 328  EFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRA-RSFQLYQ 386

Query: 389  THTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNID 448
            T  S +  F + N++   +   D  +  +D NY+F+NLSS YYYTD+DII+NYET   +D
Sbjct: 387  TSNSLSFFFHLLNETRGVM---DYGSQEIDRNYNFMNLSSCYYYTDKDIIKNYETQALLD 443

Query: 449  TNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDS 508
              N GIYFDALTYIAN KGSY LI+YC KQDVVG+E L ++L + G+D +   + ++ D 
Sbjct: 444  RENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMTIPDE 503

Query: 509  LLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDI 568
            LL  +Y++E   S+G  Q+   LK+A+R++ K   S  LQF+  +EPY NV  AY+LL++
Sbjct: 504  LLLGVYRKE--CSQGSTQKHATLKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAYSLLEV 561

Query: 569  DESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGP 628
            DESVD D++QTAYTI++ DSPGLK+DCD+A+YT+A+  RS+ LFNFL+EQCP F  +Y  
Sbjct: 562  DESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFEEFYSA 621

Query: 629  DCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKL 688
            D L++  ALSLLQVNENA+D++++++FQ++W  + +   DQ              +NS L
Sbjct: 622  DKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQVRNSLL 681

Query: 689  ISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNY 748
            I+ +LETG ID   L   NWP GLNNIGNTCYLNSLLQYYF I+PLR++I++Y+ +++ +
Sbjct: 682  INRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAEF 741

Query: 749  E--IDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFA 806
               I    +KRRIGGREVSE+EVERS+QF+YQLRDLF DMI+++SR +TP+ ELAYLAFA
Sbjct: 742  HDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELAYLAFA 801

Query: 807  PSNIEVEFAA----------SEVERTTVDLPFDKEG----DIXXXXXXXXXXXXXXXAQE 852
            PSNIEVEF            SE +   +DL  + E     D+                ++
Sbjct: 802  PSNIEVEFEGTPTVEPAKENSENDVEVIDLTAEGEASEDVDMLKPAESETQVVTTQLNED 861

Query: 853  VTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIK 912
               +  +ATE  V   +ST+ AKIS+DQLENALEMGRQQDVTECIGNVL+Q+ESAS PI 
Sbjct: 862  TVMNDVIATEPMV---SSTRVAKISTDQLENALEMGRQQDVTECIGNVLFQLESASDPIN 918

Query: 913  LDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESS 972
            LD D EQ DLIKELF+GK KQ++ PL D SK RTK E F SLLVN+ DHP+++YDAL+  
Sbjct: 919  LDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVSLLVNVGDHPKNVYDALDQY 978

Query: 973  FASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDR 1032
            F  + L++++ GDV+RT++I   P +LQIQIQRVYYDRE+FMPFKSIEPLPF +TIYMDR
Sbjct: 979  FKDDVLQLED-GDVKRTLAIKELPVVLQIQIQRVYYDREKFMPFKSIEPLPFRDTIYMDR 1037

Query: 1033 YAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATV 1092
            Y    +  +Q K+ E  + +N+L++LK RQ  LL +N  G+S K S LET  FL +   +
Sbjct: 1038 YMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGMSFKTSLLETERFL-ESGVL 1096

Query: 1093 TSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVF 1152
                + +  +   ++ +   +  ID+ELS+IY  I  ++ K+   FD F+++GYSLFAVF
Sbjct: 1097 EQNAIEIQKKDSALKAIESMLLKIDNELSEIYSRITALDQKLSSHFDNFKELGYSLFAVF 1156

Query: 1153 IHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDY 1212
            IHRGEASYGHYW+YIKD  R+GIWRKYND                GNTATPYFLV+VK+ 
Sbjct: 1157 IHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNFTEGNTATPYFLVYVKNG 1216

Query: 1213 YKGDIEPLKRIIAD 1226
            ++ +I+PL R+IA+
Sbjct: 1217 HESEIQPLHRVIAN 1230

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1285 (47%), Positives = 828/1285 (64%), Gaps = 87/1285 (6%)

Query: 18   DEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFI--NDS--- 72
            +E+  +  + D   +P  DDGK +LY +   +  FKT DRL+DD++ DL+++  N+S   
Sbjct: 44   NEELANQLSQDSNIIPEVDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEH 103

Query: 73   --------------------------DLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFI 106
                                      ++ +   GIL+     YSK R   + ++ +GT +
Sbjct: 104  INDNNNNNDNNHNNNNNTSNSNNDTNEIKTYINGILRLPSHQYSKDRYS-KFTFAMGTIV 162

Query: 107  DQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTK 166
            DQI LQT++E++S++CP+ N ++V  GVL+D+  + P         P+YH K+TVKTR+ 
Sbjct: 163  DQINLQTRFEFKSVTCPEFNDVHVLLGVLMDNRSQAPLG----TFLPVYHFKITVKTRSY 218

Query: 167  LEHLKKHVGISHYHLIT--ELHPFDKQDL--LTFDESDENLIDFAAYVSSDTNKLILXXX 222
            LE  KKHVGISH+HLI   +LH FDK+DL     D + ++L+D A ++S DTNKL++   
Sbjct: 219  LEKTKKHVGISHFHLIDFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEI 278

Query: 223  XXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKS 282
                              I  RY   C ++ +L+   IP+Q++C  T+F++FKGPL+ K+
Sbjct: 279  FKPEFNELEEIESFSQESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKN 338

Query: 283  ADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDW 342
             + +P+K INA N  LNSH +  WL++KYGF E    NP+  ++  EY PP+L D+ ND 
Sbjct: 339  IN-EPLKAINADNPLLNSHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDI 397

Query: 343  KIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFND 402
              R LR+SY RKCL+L F  K +  L+   ++Q   K+ R FN + T  +T+   Q   +
Sbjct: 398  NTRALRESYIRKCLELIFISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYE 457

Query: 403  SARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYI 462
               +L     + + LD  YH+INL +S+YYT+RDII+NY  L  +D  N GIY+DAL YI
Sbjct: 458  HKPQLD----TYNKLDYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYI 513

Query: 463  ANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDAT-SVDIKSLNDSLLFSIYKQEQNAS 521
            A +K SYQLIS+  KQDV+GQE L  +L +  +D   S  I +L +S++F+IYK E+  +
Sbjct: 514  AQSKNSYQLISFVSKQDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQA 573

Query: 522  RGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAY 581
                 RL E+K+A+R++ K   S +L+F+ D+EPY +    YN L++DESVDDDI+QTAY
Sbjct: 574  NISSARLAEMKNALRLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAY 633

Query: 582  TIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQ 641
            TI++ND+PGLK+DCD+AL T+A R +S+ LF FL+++CP F  +YG D   + QAL+ LQ
Sbjct: 634  TIKVNDAPGLKIDCDRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQ 693

Query: 642  VNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDAN 701
            VNENATDE +++IFQQRW      +YD              EKNSKLIS F++TG++D  
Sbjct: 694  VNENATDETILEIFQQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPT 753

Query: 702  LLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNK----- 756
             L  ENWP GLNNIGNTCYLNSLLQYYFSI PLR++IL Y+ ++ +++ +   NK     
Sbjct: 754  CLPVENWPAGLNNIGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKR 813

Query: 757  RRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAA 816
            RRIGGREV+E EVERS+QF+YQ+RDLF +MI+S+ RC++P+ ELAYLAF PSNIEVEF +
Sbjct: 814  RRIGGREVNELEVERSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFES 873

Query: 817  SEVERTTVD--------LPFDKEGDIXXXXXXXXXXXXXXXAQEVTSDISVATED--KVM 866
            +  E    D        +  D+  +                A +V++     T D  +++
Sbjct: 874  ASTEDDMGDKSNAQDAVVLQDEAKNDTDINLTEVNLIDLEPATKVSTSNDQPTMDAIEIL 933

Query: 867  TNT------------------------STKTAKISSDQLENALEMGRQQDVTECIGNVLY 902
            TN+                        ST+ AKISSDQLENA EMGRQQDVTECIGNVL+
Sbjct: 934  TNSDNKSKELSKTNPFREVSPNEDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLF 993

Query: 903  QMESASKPIKLD-EDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDH 961
            Q+E+   PI LD ED EQYDL+KELFYGKTKQ I+PL+  S  R K E F SLLVNI+DH
Sbjct: 994  QLETGFDPISLDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDH 1053

Query: 962  PRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEP 1021
            P+DIYDAL   FA EFL M+EYGDV++T+S+T +PKILQIQIQRVYYDRERFMPFKSIEP
Sbjct: 1054 PKDIYDALNQYFADEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEP 1113

Query: 1022 LPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLE 1081
            LPF   IYMDRYA   +  L +KK ET +L+ KLK  +ARQ ELL++NELGLSRKE+ +E
Sbjct: 1114 LPFEQVIYMDRYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMME 1173

Query: 1082 TINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEF 1141
            TI FL     +   G+   N+  ++ +L++ +  I++ELS +Y++IN ++N+IDHQFD+F
Sbjct: 1174 TIKFLK-SPVILENGIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDF 1232

Query: 1142 RDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTA 1201
            + + YSLFAVFIHRGEASYGHYWVYIKD  ++GIWRKYND                GNTA
Sbjct: 1233 KKLAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTA 1292

Query: 1202 TPYFLVFVKDYYKGDIEPLKRIIAD 1226
            TPYFLV+VK     DIEPLKRII +
Sbjct: 1293 TPYFLVYVKQDSLSDIEPLKRIIQN 1317

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/1213 (47%), Positives = 806/1213 (66%), Gaps = 38/1213 (3%)

Query: 36   DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFIN----DSDLSSEFKGILKSSPLTYSK 91
            D+GK LLYP  G   PFKT +RL+D+I  +LA+ N    D   S+   G+LK   L YS 
Sbjct: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYS- 94

Query: 92   RRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSFDAVAE 151
             R+ +   + +G  +DQ+ L+T+YEYES +CP  N+++VF GVL+  ++  P   + +A 
Sbjct: 95   -RKPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSI-VPREPEDLAA 152

Query: 152  TPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVS 211
             PIYHLK+TVKTR  LEH +K  G+  YH+++ELHP DKQDL   +ESD +L+D A YVS
Sbjct: 153  APIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVS 212

Query: 212  SDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLF 271
            SDTNKL+                      I  R+   C ++  L+ + +PSQ +CF TL 
Sbjct: 213  SDTNKLVCIEIFKPEFSHEDLATFSPDS-IRRRFAEACGKFPDLDPEKVPSQAECFSTLL 271

Query: 272  RVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYE 331
            ++FKGPL+R+S D D +KTI+A NK LNS ++  WL  ++ FQ    Q  E  +  LEY+
Sbjct: 272  KIFKGPLNRRSPD-DVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQ 330

Query: 332  PPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHT 391
            PPDL D+ N+  +RKLR+ YTRKCL+L F GK++  L+SK ++ +  ++ R F+      
Sbjct: 331  PPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA-RSFHLYQISY 389

Query: 392  STTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNN 451
            S +  F +  ++   +   D     +D NYHFINLS+ +YY+D+DII+NYET   +D  N
Sbjct: 390  SPSFFFHLLGETRGVM---DYGTQEIDKNYHFINLSACHYYSDKDIIKNYETQARLDPEN 446

Query: 452  KGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLF 511
             GIYFDAL +IAN KGSYQLI+YC KQDVVG+E L ++L + G+DA+  D+ ++ D LL 
Sbjct: 447  IGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLL 506

Query: 512  SIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDES 571
             IY++E  +S+   Q+ + LK+++R++ K  +S+ LQF+  +EPY N   AY+LL+++ES
Sbjct: 507  GIYRKE--SSQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNES 564

Query: 572  VDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCL 631
            VD DI+QTAYT+++ DSPGLK+DCD+A+YTIA+  RS+ LFNFL EQCP F  +Y  D L
Sbjct: 565  VDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKL 624

Query: 632  SFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKLISY 691
            ++Q+AL+LLQVNENA+D++++++FQ++W Q+ ++  DQ              +NS LI+ 
Sbjct: 625  TYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLINR 684

Query: 692  FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE-- 749
            +LETG+ID + L   NWP GLNNIGNTCYLNSLLQYYF I+PLR+ I+ Y+ ++S +   
Sbjct: 685  YLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQS 744

Query: 750  IDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSN 809
            I    +KRRIGGREVSE EVERSIQF+YQLRDLF DM+++++R +TP  ELAYLAFAPSN
Sbjct: 745  IGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSN 804

Query: 810  IEVEFAASEVERTTVDLPFDKEGDIXXXXXXXXXXXXXXXAQEVTSDISVATEDKVMT-- 867
            IEVEF  +    +  +   ++EG I                Q++     V +E +++   
Sbjct: 805  IEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLTSVPNAEQDIEMLDPVPSESEMIVEQ 864

Query: 868  -----------------NTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKP 910
                              TST+ AKISSDQLENALEMGRQQDVTECIGNVL+Q+ESAS+P
Sbjct: 865  FVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEP 924

Query: 911  IKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALE 970
              LD D EQ DLIK+LF+GK +Q + PL+D +K RTK E F SLLVN+ DHP+D+YDAL+
Sbjct: 925  TCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALD 984

Query: 971  SSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYM 1030
              F ++ L++++ GDV R+V+I   P +LQIQIQRVYYDRERFMPFKSIEPLPF ++IYM
Sbjct: 985  QYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYM 1043

Query: 1031 DRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEA 1090
            DRY   ++ ++  K+ E   L+ +L TLK +Q  LL++N  G+S K S LET  FL  + 
Sbjct: 1044 DRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLDKNGSGMSFKSSLLETKRFLQSD- 1102

Query: 1091 TVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFA 1150
             + +  +   N+ Q I+ +   +  ID EL+ +Y  I  +E K+   FD+F+  GYSLFA
Sbjct: 1103 VLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFA 1162

Query: 1151 VFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVK 1210
            VFIHRGEASYGHYW+YIKD  ++GIWRKYND                GNTATPYFLV+VK
Sbjct: 1163 VFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVK 1222

Query: 1211 DYYKGDIEPLKRI 1223
            +  +  IEPL R+
Sbjct: 1223 NGQESQIEPLHRV 1235

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1240 (48%), Positives = 819/1240 (66%), Gaps = 36/1240 (2%)

Query: 17   SDEQSVS-STTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAF---INDS 72
            SDE  V  S   +E  L   DDG +LLY  +    P KT +R++DDI+ ++     IN  
Sbjct: 48   SDEIQVPVSVIGNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSK 107

Query: 73   DLSSEFK-------GILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDH 125
            +  +  +        ILK   + YSK R  + P   +G+ +DQI +Q+K+EY+S++CP+H
Sbjct: 108  ENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPD-SIGSIVDQIVIQSKFEYKSVTCPNH 166

Query: 126  NRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITEL 185
            N+I VF GVLIDS  +   + D ++   I H+K+TVKTRT LE  ++ +G+S +HL+ EL
Sbjct: 167  NKIEVFMGVLIDST-QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKEL 225

Query: 186  HPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRY 245
            HPFD++DLLTFD++  NLID A YVS DTNKLIL                     I  RY
Sbjct: 226  HPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRY 285

Query: 246  QLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSK 305
                 + +  +++ IP+ ++C  TLF+VFKGPL RKS++ DPIK IN+ N  L  HM+ +
Sbjct: 286  LHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSN-DPIKRINSDNPILRLHMNPE 344

Query: 306  WLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLS 365
            WLVSKYGF     ++ E  D+  EYEPPDL D+ ++ + RK+R+S TRKCL+L F+GK+ 
Sbjct: 345  WLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMM 404

Query: 366  NKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFIN 425
              LLSK  ++K  KS R FN + T  ST+    +  +    L  ++ S   +D  YHFIN
Sbjct: 405  INLLSKEELEKSSKSLRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNID--YHFIN 462

Query: 426  LSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEV 485
            LS SY+Y++RDIIQ +E +  +D +N G Y+D+L +IAN KGSYQLI+YC K D+VGQE 
Sbjct: 463  LSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQES 522

Query: 486  LQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSK 545
            L+ +++   LD +   + SL DS++ SIY+ E        +R   L++A++V+    +SK
Sbjct: 523  LETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSK 582

Query: 546  KLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIR 605
            KL+FF+D+EPY N   AYN+L+IDES+DDDI+QTAY+I++ND+PGLK+DCD+ALYTIAI 
Sbjct: 583  KLKFFVDYEPYLNTRTAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIA 642

Query: 606  TRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILN 665
             RSI+LFNFL+E    F  YY  D  S+  ALSLLQVNENA+DE ++++FQ++W ++ + 
Sbjct: 643  RRSISLFNFLLENNLIFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMV 702

Query: 666  EYDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLL 725
             +D              ++NSKLIS FLETGVID + L  ENWP GLNNIGNTCYLNSLL
Sbjct: 703  AFDHLLKLKAALTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLL 762

Query: 726  QYYFSIAPLREYILNYKGSISNYE--IDETSNKRRIGGREVSENEVERSIQFMYQLRDLF 783
            QYYF+I+PLR+ I+NY  ++ + E  +      RR+GGR  +  EVERS+QF+YQLRDLF
Sbjct: 763  QYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLF 822

Query: 784  NDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASE-------VERTTVDLPFDKEGD--- 833
            ++MIYS SRC+TPK ELAYLAFAPSN+EVEF + +       +   TVD+  D + D   
Sbjct: 823  SEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLL 882

Query: 834  IXXXXXXXXXXXXXXXAQEVTSDIS--VATEDKVMTN-----TSTKTAKISSDQLENALE 886
            +                 ++ S+IS  +  E+    N     TST+ AKIS DQLENALE
Sbjct: 883  VDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALE 942

Query: 887  MGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRT 946
            MGRQQDVTECIGNVL Q+ESAS P+ LD+D EQ DL+K  F  KTKQ I+PL      R 
Sbjct: 943  MGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRN 1002

Query: 947  KYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRV 1006
            K E F SLLVNI DHP++IYDAL+  F  E L+M+EYG+V++T+SIT FP ILQIQIQRV
Sbjct: 1003 KIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRV 1062

Query: 1007 YYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELL 1066
            YYDRE+F+PFKSIEPLPF N +YMDRYA LDN+ L   KN+ + ++ +L  +K RQ ELL
Sbjct: 1063 YYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELL 1122

Query: 1067 NRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDE 1126
            +RNELGLSRKES +ET   L  +  + + G+ V  +  +I ++   +  ID EL+ +++ 
Sbjct: 1123 SRNELGLSRKESLIETKRLLMSDV-LDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNN 1181

Query: 1127 INLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXX 1186
            I  +E  I + F EF+ I Y+LFAVFIHRGEASYGHYW YIKD +++ IWRKYND     
Sbjct: 1182 IRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITE 1241

Query: 1187 XXXXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRIIAD 1226
                       GNTATPYFLV+VK+    DIEPLKRI++D
Sbjct: 1242 VPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSD 1281

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1280 (47%), Positives = 816/1280 (63%), Gaps = 75/1280 (5%)

Query: 2    LQQDTEQSIEAHAG----DSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDR 57
            +  D    +  H G    ++D Q     +AD  ++   DDG+QLLYP +G +LP KT DR
Sbjct: 3    MNDDAVTGMGVHFGGDPPEADLQGEPIPSADVTNI--EDDGRQLLYPNIGTHLPLKTSDR 60

Query: 58   LIDDIVYDLAFINDSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEY 117
            L+DDI+  + F+     S + K IL S+ L YSK+R  ++ S  +G F DQ+ +QTKYEY
Sbjct: 61   LLDDILCSVGFLT----SGDNKSILNSNTLEYSKQRPHIKGS-AVGFFQDQVIIQTKYEY 115

Query: 118  ESISCPDHNRINVFFGVLIDSNM---ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHV 174
             S SCP+HN+I V  G+LI ++            V E PIYH+K++VK R+ LE+ KK V
Sbjct: 116  PSKSCPEHNKIFVIMGILIGTDYLEKAEKKQISEVTEIPIYHVKISVKVRSILENSKKLV 175

Query: 175  GISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXX 234
            G+S Y+ + +LH +D+ D  ++D +D  L+D A Y + DTNK++L               
Sbjct: 176  GVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSALYATDDTNKIVLIEIYKPEFDPEDKDL 235

Query: 235  XXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINAT 294
                  I +R+    E++  L  +  P+Q+D   TLF++FKGPL RKS D  P K+I A 
Sbjct: 236  SVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSINTLFKLFKGPLKRKSDDA-PQKSIEAE 294

Query: 295  NKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRK 354
            +  L S+M+   LV+ +GF   ++ N   N  G EY  PDL+++  D  I+KLRD++TRK
Sbjct: 295  HPLLISNMNPSALVTHFGF---TYTN--ENIPGGEYMAPDLVNYLGDPNIQKLRDTFTRK 349

Query: 355  CLQLAFWGKLSNKLLSK--ANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARR------ 406
            CL+L  +G +    L +   +  ++ K YR    +    S  +  Q+  D   R      
Sbjct: 350  CLELIAYGNIIISSLPQNITSTAEFSKKYRILRTIQPEFSLFSWLQLLGDFKSRNIELLN 409

Query: 407  --------LQ--QDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYF 456
                    LQ  Q     SP D + +F NLS   +Y +RDIIQNYE L  +D  N GIYF
Sbjct: 410  VNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLHYAERDIIQNYERLITLDEPNIGIYF 469

Query: 457  DALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQ 516
            D+L+ +AN KGSYQL+SYCGKQDV+GQE LQNSL V G+D T V ++SL+++LL S+YK 
Sbjct: 470  DSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLAVFGIDYTKVTLESLDENLLLSVYKH 529

Query: 517  EQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDI 576
            E   +  D  R+++LK+A+R++ K   S  L+F++D+EPY  +  AY+LL+IDESVD+DI
Sbjct: 530  EWKEN-PDNNRISDLKNALRLLAKYFTSDYLKFYVDYEPYRIIQKAYDLLEIDESVDEDI 588

Query: 577  VQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQA 636
            +QTAYTI+IND+PGLK+DCD+ALYTIA   RS+ LFNFL +QCP+F  YYG   L + Q+
Sbjct: 589  IQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQS 648

Query: 637  LSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKLISYFLETG 696
              +LQ+NEN T+  ++ +FQQ+W   +L E DQ             E+NS L+  FLETG
Sbjct: 649  FEILQINENITEPNLLHVFQQKWKNTLLEEPDQLLKYRAALTKIALERNSNLLLNFLETG 708

Query: 697  VIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETS-- 754
             I+ N L  ENWP G+NNIGNTCYLNSLLQ+YF+I+PLREYI+ Y+ +I++   +  S  
Sbjct: 709  NINPNSLPAENWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSII 768

Query: 755  NKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEF 814
            +KRRIGGR+V +NE+ERS+QF+YQLRDL+NDMI+S  RC+TPK ELAYLAFAPS+I+VEF
Sbjct: 769  SKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVEF 828

Query: 815  AASEVER----------TTVDLPFDKEGDIXXXXXXXXXXXXXXXAQEVTSDISVATEDK 864
              ++ +           TT   P    G+                 +E+ S  ++ + D 
Sbjct: 829  ENAKTKSPISNIEGSNSTTDSQPMPSTGE--NIDHNMDIEQEERNNEEINSTNNIESNDL 886

Query: 865  VMTN--------------------TSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQM 904
            V  N                    T+ K AKI  +QLENALE+GRQQDVTECIGNVL+Q+
Sbjct: 887  VSNNHDIEMLDTDKENEGNMEIEDTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQL 946

Query: 905  ESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRD 964
            ES+S P  L ED EQ DLIKELF+G+T Q I PL   S TRTK E F SLLVNI+DHP+D
Sbjct: 947  ESSSSPTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPKD 1006

Query: 965  IYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPF 1024
            +YDAL+  F  E+L M+EYG+V+R ++I  FP ILQIQIQRVYYDRERFMP+KSIEPLPF
Sbjct: 1007 VYDALDLYFKEEYLTMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPF 1066

Query: 1025 SNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETIN 1084
             + IY+DRYA  D+  L  K+ ET EL+ +L++ K RQ ELL+RNELGLSR+++Y ET N
Sbjct: 1067 ESDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETAN 1126

Query: 1085 FLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDI 1144
            FL  E  + +  +S+ +   +  KL ++ S +  ELS +Y +I  +E KI+HQFD+F + 
Sbjct: 1127 FLRSEV-LQNTNISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEH 1185

Query: 1145 GYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPY 1204
            GY+LFAVFIHRGEASYGHYWVYIKD   S IWRKYND                GNTATPY
Sbjct: 1186 GYTLFAVFIHRGEASYGHYWVYIKDFVNS-IWRKYNDETVTEVPEEEVMNFTEGNTATPY 1244

Query: 1205 FLVFVKDYYKGDIEPLKRII 1224
            F+VFVK  ++ DIEPLKR+I
Sbjct: 1245 FIVFVKKGHEKDIEPLKRMI 1264

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/1253 (46%), Positives = 796/1253 (63%), Gaps = 54/1253 (4%)

Query: 11   EAHAGDSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFIN 70
            +  A D   + V +   + +S    + GK +LYP V  N PFKT DRL+DDI   L+F+ 
Sbjct: 3    QEQADDGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVL 62

Query: 71   DSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCP------D 124
            +    +   G+LKS  L YSK R ELR ++ +G  +DQ+ LQT YEY S+          
Sbjct: 63   EGVRGN---GVLKSPMLDYSKERGELR-AWSIGYLLDQVLLQTSYEYASLGGSGGGGGDK 118

Query: 125  HNRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITE 184
            H++INVF G+L D  M    S D +     YHL+VTVKTR  LE  K+  GI+ YHL+ +
Sbjct: 119  HSKINVFMGLLCDP-MVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVND 177

Query: 185  LHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSR 244
            LHP DKQDL  F++ DE +ID A YVSS TN+L+                      I  R
Sbjct: 178  LHPADKQDLCFFEDDDECVIDSATYVSSGTNRLV-RIEILKPEFTAEEWSEFTPDSIRKR 236

Query: 245  YQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDS 304
            Y  +CE+Y  LN + +P+Q +C  TLF+VFK PL R+ +D D +KTI+A NK LNS +D 
Sbjct: 237  YLSICEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSD-DELKTISAENKVLNSQLDP 295

Query: 305  KWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKL 364
             WLV K+GF+    Q  +   +  EY+PPD  ++ NDW +R LR+ Y RK L+L F GK 
Sbjct: 296  NWLVDKFGFELCEVQEEDGRKE-YEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQ 354

Query: 365  SNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFI 424
            S +LL K  +    K  R F    TH S T  FQ+  +  R    +     P D N HFI
Sbjct: 355  SIRLLPKEVVAASSK-LRSFQLYQTHFSHTFWFQLLGEFDRN-DFNQQQQHPYDTNPHFI 412

Query: 425  NLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQE 484
            NLS +YYY DRDII+NYE+   +D  N GIY+D LT+IAN KGS+QL+++  KQ++VGQE
Sbjct: 413  NLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQE 472

Query: 485  VLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRS 544
             L ++LR+  +D +  D K + D +L S YK+E     G+ ++  +L++A+R++ K  +S
Sbjct: 473  ALNSALRLFHIDPSETDPKQIPDEMLLSCYKEE--CKYGNTRQHADLRNALRLLAKYKQS 530

Query: 545  KKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAI 604
            +KL+F+++ EP+     AY++L+IDESVD DI++TAYTI+++D+PGLK+DCD+ALYT+AI
Sbjct: 531  EKLKFYVELEPFQQESQAYSILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAI 590

Query: 605  RTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKIL 664
              RS+ LFN+L+++CP F  +Y     S+  AL  LQVN NATD+L+++IF+++W ++ +
Sbjct: 591  AKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPV 650

Query: 665  NEYDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSL 724
               DQ             E+NSKLI++FLETG+ID N L   NWP GLNNIGNTCYLNSL
Sbjct: 651  ISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSL 710

Query: 725  LQYYFSIAPLREYILNYKGSIS----NYEIDETSNKRRIGGREVSENEVERSIQFMYQLR 780
            LQYYF+I+PLR+YI NY+ + S    N        KRRIGGR V++ EVERS+QF+YQLR
Sbjct: 711  LQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLR 770

Query: 781  DLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEF-AASEV--ERTTVDL---PFDKEGDI 834
            DLFNDM +SK RC+TP  ELAYL+F+PS   VEF +A++V    TT+ L   P +++ ++
Sbjct: 771  DLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEV 830

Query: 835  XXXXXXXXXXXXXXXAQEVTSDISVATEDKV-----------------MTN--------T 869
                           A+++ +D ++ T+D+                  M+N        T
Sbjct: 831  FDISIEGSNVETEAAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPIT 890

Query: 870  STKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYG 929
            ST  AKIS DQLEN LE+GRQQDVTECIGNVLYQ+ESAS P+  DE  EQYDL+K+LFYG
Sbjct: 891  STCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYG 950

Query: 930  KTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKM-DEYGDVQR 988
            K KQ+++P+ +  K RTK+E F SLLVN+ DHP+DIYDAL+  F  + L + D+   V+R
Sbjct: 951  KLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRR 1010

Query: 989  TVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNET 1048
            +V++   P ILQIQIQRVYYDRE+ MPFKS EPLPF   +YMDRY A     L  KK E+
Sbjct: 1011 SVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQES 1070

Query: 1049 KELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEK 1108
             +L   L+ +K R+ ++L++N+ GL+ K+S  ET  FL       S+G   + +  +I++
Sbjct: 1071 LQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQ 1130

Query: 1109 LRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIK 1168
            L      ID ELS + D+I  +EN I H+FD+F + GY+LFAVFIHRGEASYGHYWVYIK
Sbjct: 1131 LDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIK 1190

Query: 1169 DPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLK 1221
            D + SGIWRKYND                 NTATPYFLV++KD ++ +IEPLK
Sbjct: 1191 DRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1060 bits (2742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1250 (45%), Positives = 792/1250 (63%), Gaps = 71/1250 (5%)

Query: 7    EQSIEAHAGDSDEQSVSSTTADEKSLPP----NDDGKQLLYPAVGLNLPFKTPDRLIDDI 62
            E ++E +    D  S ++     KSL       DDGK LLY  +  + PFKT DR++DDI
Sbjct: 6    EPALELNGEQRDSVSETAEVLRSKSLESFSDLVDDGKTLLYGDISKSFPFKTCDRILDDI 65

Query: 63   VYDLAFINDSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISC 122
                 F+     S     ++K   L YS+ RQ+L+P ++L   IDQ+ L+++Y+Y+S++C
Sbjct: 66   RISPWFLKKFGSS-----VMKQPMLQYSRERQQLQP-WNLVHLIDQVNLRSRYDYDSMTC 119

Query: 123  PDHNRINVFFGVLIDSNMENPTSFDAVAETP--IYHLKVTVKTRTKLEHLKKHVGISHYH 180
            P  N I+V F +L+D N   P  FD + + P   +HLK+TVK R+ LE+  +HVGI+HYH
Sbjct: 120  PGKNTISVMFALLVDPNF-TPNDFDDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYH 178

Query: 181  LIT--ELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXX 238
            ++    LHPFDK+D+   +E D  L+D + +VS+DTNKLIL                   
Sbjct: 179  VLEPESLHPFDKRDIFIMEEKDCRLVDQSIFVSADTNKLILVEIIKPEFNSENLAEYRTA 238

Query: 239  XHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKAL 298
              I  RY+  C+++D LN D IPSQ +C +TLF +FK PL RKSA+ +  K I+  + AL
Sbjct: 239  K-IEERYKNACQEFDLLNPDDIPSQAECLKTLFMIFKNPLQRKSANSE-FKIISRDSVAL 296

Query: 299  NSHMDSKWLVSKYGFQENSFQNPEANDQ---GLEYEPPDLIDHKNDWKIRKLRDSYTRKC 355
            NS +++ WL + + F   S Q     D    G EY+PPDL+D+  D+K+R +R++YTRK 
Sbjct: 297  NSQINTDWLTTMFDF---SLQKTAVEDNVQSGEEYKPPDLVDYITDFKVRGIREAYTRKS 353

Query: 356  LQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSAS 415
            +++   GK S  L ++   +K +   + F+  H   S T  F I N              
Sbjct: 354  MEVVLIGKQSMLLENELGTEK-KTVAKCFSNQHFSASHTWWFNILN-------HQHIEPF 405

Query: 416  PLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYC 475
            P D NYHFINLS ++ Y D+DII+NYET   +D  N   YFDAL Y+ N KGSYQLI+YC
Sbjct: 406  PYDINYHFINLSVAFKYIDKDIIKNYETQIALDQENISHYFDALQYVTNAKGSYQLIAYC 465

Query: 476  GKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAM 535
            GKQDVVG E L N+L+V GLD T +D   L+ + +   Y      S  D QR  +L++A+
Sbjct: 466  GKQDVVGYEDLNNALQVFGLDPTDIDASLLDANTMIEYYNSHLLRS-SDNQR-KDLRNAL 523

Query: 536  RVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDC 595
            RV+ K + S+K+ F +++EPY NV  AY LL +DE+VDDDI+QTAYTI I D+PGLK D 
Sbjct: 524  RVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVDETVDDDIIQTAYTINIADAPGLKKDY 583

Query: 596  DKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIF 655
            D+A++TIA+  RSI L N L ++CP+F  YY    +S+ +AL++++++ NA+D++++++F
Sbjct: 584  DRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCTDISYDEALNIIEIDMNASDDVILEVF 643

Query: 656  QQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNI 715
            Q++W   I+   D               +NSKLI++FL+TG++D + L    WP G+NN+
Sbjct: 644  QKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNV 703

Query: 716  GNTCYLNSLLQYYFSIAPLREYILNYKG-SISNYEIDETSNKRRIGGREVSENEVERSIQ 774
            GNTCYLNSLLQ++F+I PLR++ILNY   S    +  E  ++RRIGGREVS+ E  RS+Q
Sbjct: 704  GNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDASEYHSRRRIGGREVSKQEELRSVQ 763

Query: 775  FMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASEV-ERTTVDLPFDKEGD 833
            F+Y LRDLFNDMI++ SRC+TP  EL YLAFAPSN+EVEF    V ++  +DL  D   D
Sbjct: 764  FVYHLRDLFNDMIHTNSRCVTPTKELVYLAFAPSNVEVEFGDDTVAQKELIDLTTDVVED 823

Query: 834  IXXXXXXXXXXXXXXXAQEVTSDISVATEDKVMTNT------------------STKTAK 875
                              + T  ++   +D +M  +                  S + AK
Sbjct: 824  ----------------PTDTTRHLASCDDDIIMCQSPVALPEHKTSSEAGTQQYSVQVAK 867

Query: 876  ISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEI 935
            IS+DQLEN LE+GRQQDVTECIGNVL Q+E AS+P+ L++D EQ DL+K+LFYG+ KQ++
Sbjct: 868  ISADQLENTLEIGRQQDVTECIGNVLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDL 927

Query: 936  VPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNF 995
            +P++D +  RTKYE F SLLVN  DHP+DIYDAL+  F +++L ++EYGDV+RTVSI+  
Sbjct: 928  IPVNDEASVRTKYERFLSLLVNTGDHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISEL 987

Query: 996  PKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKL 1055
            P +LQIQIQRVYYDRE+FMPFKSIEPLPF  T+YMDRY A ++  L  +  +  EL+ KL
Sbjct: 988  PAVLQIQIQRVYYDREKFMPFKSIEPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKL 1047

Query: 1056 KTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISN 1115
            + LK RQ +LL++NE+GL+ K S +ET  FL    T+ +  +   N    I  +   I+N
Sbjct: 1048 QDLKQRQRKLLSQNEIGLTLKSSLIETKKFLQ-SGTLKAHDIDADNIPSSIAYIDILINN 1106

Query: 1116 IDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGI 1175
            ID EL  ++++I  +E  I  QF EF+ IGYSLFAVFIHRGEASYGHYWVYIKD  ++GI
Sbjct: 1107 IDEELKSLFNKITDLETTISQQFSEFKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGI 1166

Query: 1176 WRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYYKGD-IEPLKRII 1224
            WRKYND                GNTATPYFLV+V++  + + IEPLKRI+
Sbjct: 1167 WRKYNDDSVTEVPQSEVFNFTEGNTATPYFLVYVREGQEQETIEPLKRIL 1216

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/819 (50%), Positives = 575/819 (70%), Gaps = 11/819 (1%)

Query: 19  EQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSSEF 78
           E  +S      + L   D GK  LYP      PFKT DRL+DDI++DL+FIN  D S  +
Sbjct: 41  ESEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILY 100

Query: 79  K----GILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGV 134
                GILKS  L+YS++  + R +Y+LG+ +DQ+ LQTK+EY+S+SCP HN + VF GV
Sbjct: 101 SDLSNGILKSPVLSYSRKVGKTR-AYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGV 159

Query: 135 LIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLI--TELHPFDKQD 192
           LID   +N  +F+ +A  PI+HLKVTVKTR  LE  KK  GI+HYH +  +E+HP+DKQD
Sbjct: 160 LIDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQD 219

Query: 193 LLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQY 252
           LLTFD  D  L+D+A YVSSD+NKLIL                     I +RY++ C ++
Sbjct: 220 LLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRF 279

Query: 253 DSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYG 312
           DSL+   IP+Q DC  TLF++FKGPL+RKS++ +P KTIN  N +LNSH+D  WL SKYG
Sbjct: 280 DSLDPTRIPTQPDCINTLFKIFKGPLNRKSSE-EPRKTINPNNVSLNSHIDPTWLTSKYG 338

Query: 313 FQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKA 372
           F+ +  ++ E  +  LEY PPDL ++  DWK+R+LR+S+TR+CL+L F G++S +LLS+ 
Sbjct: 339 FELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQE 398

Query: 373 NIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYY 432
            + +  K YR F+ M T+ ST   FQ+  +   R      S+SPLD+++HFI+LS+ Y Y
Sbjct: 399 AVNRNPKVYRIFSMMQTNFSTMFWFQLLGE--YRAIFSTESSSPLDSDHHFIDLSACYNY 456

Query: 433 TDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRV 492
            DRDII+NYE  C +D  N G+Y DAL +IAN KG+YQLI+YCGKQD VGQE L ++L V
Sbjct: 457 IDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGV 516

Query: 493 LGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFID 552
             +D+   D  +LNDS+L SIYK E  ++R +  R  ELK+++R++ K  +S KL+F+ D
Sbjct: 517 FQIDSKEFDPHNLNDSVLLSIYKNESASTR-NPNRHAELKNSLRLLAKFKKSPKLKFYAD 575

Query: 553 HEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLF 612
           +EPY NV  AY +L++DESVDDDI+QTAYT+++NDSPGLK+DCD+ALYTIA+ +RS+ LF
Sbjct: 576 YEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALF 635

Query: 613 NFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXX 672
           NFL++Q  +F  Y+GPD  S+Q ALS+LQVNENA D+ +++IFQ++W ++ + + DQ   
Sbjct: 636 NFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLK 695

Query: 673 XXXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIA 732
                     E+NSKLIS+F++TG +DA+ L  ENWP GLNNIGNTCYLNSLLQYYFSI+
Sbjct: 696 LKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSIS 755

Query: 733 PLREYILNYKGSISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSR 792
            LR+Y+L+Y+ ++ ++  ++    RRIGGRE++E EVERS+QF+YQLRDLF+ MI+++ R
Sbjct: 756 SLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDR 815

Query: 793 CITPKHELAYLAFAPSNIEVEFAASEVERTTVDLPFDKE 831
           C+TP+ ELAYLAF PS + VEF      +   + P +KE
Sbjct: 816 CVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKE 854

 Score =  463 bits (1192), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/360 (62%), Positives = 278/360 (77%), Gaps = 1/360 (0%)

Query: 865  VMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIK 924
            V  NTST+ AKISSDQLENALEMGRQQDVTECIGNVL+Q+ESAS PI L +D EQ DL+K
Sbjct: 943  VAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVK 1002

Query: 925  ELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYG 984
            +LFYG  KQ I+PL D ++ RTKYE F SLLVNI DHP+DIYDAL+  F  E+LK++EYG
Sbjct: 1003 QLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYG 1062

Query: 985  DVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTK 1044
            DV+RTV++T+FP ILQIQIQRVYYDRERFMPFKS+ PLPF+ TIYMDRY+  +N +L  +
Sbjct: 1063 DVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINR 1122

Query: 1045 KNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQ 1104
            K ET++L  +L  LK RQ ELL++NELGLSRK + +ET NFL  +  + +QG+ + NR  
Sbjct: 1123 KRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDV-LETQGIQIDNRTG 1181

Query: 1105 IIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYW 1164
            + ++L   +  I+ ELSQ+Y  I  +E+KI HQFD+F+ IGYSLFAVFIHRGEASYGHYW
Sbjct: 1182 LAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYW 1241

Query: 1165 VYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKRII 1224
            +YIKD  +SGIWRKYND                GNTATPYFLV+VK  ++ +IEPLKR++
Sbjct: 1242 IYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVL 1301

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/792 (44%), Positives = 506/792 (63%), Gaps = 32/792 (4%)

Query: 32  LPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSSEFKGILKSSPLTYSK 91
           L   DDG+ +LY  +    P KT DRL+DD+   ++      LS E + +L++  L Y++
Sbjct: 17  LEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVS------LSEEGREVLRAPMLEYAR 70

Query: 92  RRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSFDAVAE 151
           +R   R ++ +G  +DQ+ LQT +EY S +C   NR++VF GVL D   +   S D +  
Sbjct: 71  QRANAR-TWSVGYLLDQVVLQTSFEYTSRTCA-QNRVHVFMGVLCDPG-QRFASQDELVN 127

Query: 152 TPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVS 211
             IYHL+VTVK R +LE  ++H G++ YHL+ ELHP+DK D   F++ D  ++D A YV+
Sbjct: 128 YRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVA 187

Query: 212 SDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLF 271
           S TN+L+                      I +RY  VC+++  L+   IPSQ +C  TLF
Sbjct: 188 SGTNRLV-RIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLF 246

Query: 272 RVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYE 331
           +VFK PL R+ A  D +KTI+A NK LNS +++ WLV+K+GF+    +  E   +  EY+
Sbjct: 247 KVFKNPLSRQKAQ-DELKTISADNKVLNSQLEANWLVTKFGFELCEIE--EDGQKIYEYK 303

Query: 332 PPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHT 391
           PPD  +H  +W++R+ R+SY RK L+L F GK S +L+ K  +    K  R F    TH 
Sbjct: 304 PPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTHF 362

Query: 392 STTALFQIF-----NDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCN 446
           S +  + +      ND  +++        P D NYHF++LSS+YYY+DRDII+NYE    
Sbjct: 363 SHSFWYHLMGEYDHNDFNQQMH-------PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIA 415

Query: 447 IDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLN 506
           +D  N  IY+D L+++AN+KGS QL++Y  KQ+VVG E L ++LR+  LD +S D + L+
Sbjct: 416 LDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLS 475

Query: 507 DSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLL 566
           D  L   YK+    S    Q+  +L++A+R++ +   S KL+F+++ EP+PN + AY LL
Sbjct: 476 DEFLLESYKEVCKDS--GPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLL 533

Query: 567 DIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYY 626
           +IDESVD DI++TAY+I+++D+PGLKMDC +ALYT+A+  RSI LFN L +QCP F  +Y
Sbjct: 534 EIDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFY 593

Query: 627 GPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNS 686
               LS+Q AL  L VN NATD+L+++IFQ++W    L   +Q             E+NS
Sbjct: 594 HMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNS 653

Query: 687 KLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSIS 746
           KLI++FLETG++D N L   NWP G+NNIGNTCYLNSLLQYYF+I+PLREYIL Y  + S
Sbjct: 654 KLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTAS 713

Query: 747 NYEIDETSN----KRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAY 802
           N   +  S+    +RRIGGR +S+ EVERS+QF+YQLR LF++M++S+ R +TP  EL Y
Sbjct: 714 NLLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVY 773

Query: 803 LAFAPSNIEVEF 814
           L+F+PS+ EVEF
Sbjct: 774 LSFSPSSTEVEF 785

 Score =  356 bits (913), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/372 (52%), Positives = 249/372 (66%), Gaps = 9/372 (2%)

Query: 859  VATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFE 918
            V + +     TST  AKISSDQLEN LE+GRQQDVTECIGNVLYQ+ESAS P+ LDE+ E
Sbjct: 1022 VGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGE 1081

Query: 919  QYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSF-ASEF 977
            Q+DL+K+LFYGK KQE++PL    + RTK E F SLLVNI DHP+DIYDAL+S F     
Sbjct: 1082 QFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLL 1141

Query: 978  LKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALD 1037
               ++ G V+R+V++   P +LQIQIQRVYYDRE+FMPFKS EPLPF   +YMDRY A D
Sbjct: 1142 TLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATD 1201

Query: 1038 NELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGL 1097
            N  L  KK +   LR +L+ L+ R+  LL +N+ G++   +  +T  FL D A +TS   
Sbjct: 1202 NAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFL-DAAELTSGSR 1260

Query: 1098 SVLNRGQI----IEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFI 1153
             +  +       ++ LR A   +D EL+ +   I  +++ I H+FD F   GYSL AVFI
Sbjct: 1261 QLQEQYHATTSHLDALRVA---LDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFI 1317

Query: 1154 HRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYY 1213
            HRGEASYGHYWVYIKD +  GIWRKYND                 NTATPYFLV+VK+ +
Sbjct: 1318 HRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAH 1377

Query: 1214 KGDIEPLKRIIA 1225
            + DIEPLKR++A
Sbjct: 1378 ELDIEPLKRLLA 1389

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1226 (35%), Positives = 654/1226 (53%), Gaps = 124/1226 (10%)

Query: 47   GLNLPFKTPDRLIDDIVYD------------LAFINDS-DLSSEF---KGILKSSPLTYS 90
             + LP+K  D+LI++ V+             L+FIN S D   E    KGIL+     YS
Sbjct: 90   NIELPYKY-DQLIENAVFKTSDRIIDDILIDLSFINSSADEIKELGLNKGILRLPTTDYS 148

Query: 91   KRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLID----SNMENPTSF 146
            K R        +        +  ++EYES +    N+I  FF +L      SN++  +  
Sbjct: 149  KFRSSFSEYKIINLSNKNNLINYRFEYESKTNHQDNKILEFFSILHKPKDASNLDYESMA 208

Query: 147  DAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDF 206
               ++   YHLKV++KTR +LE  KKH  I H+++I E +  DK D + F+  + NL+D+
Sbjct: 209  KFWSQNEFYHLKVSIKTRNQLELSKKHTPIQHFYVIDEFNEEDKLDFINFNPDNPNLLDY 268

Query: 207  AAYVSSDTNKLILXXXXXXXXXXXXXXXXXXXXHITSRYQLVCEQYDSLNSD-TIPSQVD 265
            A ++SS+TNK++L                     + + Y    E+Y + N    +P+Q D
Sbjct: 269  AIFISSNTNKVVLVEIFKSEFNLNDKLIILDDLQVLNNY----EKYKNSNHKLKLPTQTD 324

Query: 266  CFRTLFRVF--KGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYG--FQENSFQNP 321
                L   F  +   D   +  D IK  ++  KA+   ++  WL  ++   FQE      
Sbjct: 325  VLLVLMYCFNKQQNFDNIHSSEDEIKLKDS--KAIKISLNPSWLTERFSLKFQE------ 376

Query: 322  EANDQGLEYEPPDLIDHKNDWKIRKLR-DSYTRKCLQLAFWGKLSNKLLSKANIQKYEKS 380
               D+ L +   +L ++ N  K  K R D +TR  L+L    K + + L K N  K    
Sbjct: 377  ---DESLIF--MNLRNNLNLIKKEKRRFDVFTRCLLELFVLIKSAPQKLVKCN-SKDTNI 430

Query: 381  YRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQN 440
             +  + +  ++S +   QI  +    L Q++ +      +  FINLS    YT+ +I++N
Sbjct: 431  IKVVDTISINSSLSFWSQILGEYKSILSQNNFNQ--YSKHAEFINLSILPTYTESEIVKN 488

Query: 441  YETLCNIDTNNKGIYFDALTYIANTKGSYQ-LISYCGKQDVVGQEVLQNSLRVLGLDATS 499
            YE L  ++ +  G+YFD+L +++     Y+ L  Y  K +++G E    SL++  +D   
Sbjct: 489  YEILTILNPDKIGVYFDSLKFVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDK-- 546

Query: 500  VDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNV 559
            ++  + +DS+L+  Y         D      L+++++ +  +  S  L+F   +EPY N 
Sbjct: 547  LEFTNCSDSVLWEKYLTYYEDKNFDYNHAI-LRNSIKSLSIVKNSPILKFLCKYEPYKNP 605

Query: 560  MDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQC 619
             +A+  L+I ESVD D +  +YT +IND    K   DKAL TIAI  + ++LF+ L E C
Sbjct: 606  DNAFVTLNIHESVDSDTIIVSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENC 665

Query: 620  PDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILN------EYDQXXXX 673
             DF+  Y    + ++ AL  +  +E  +D  +I  F++RW +  +N      +       
Sbjct: 666  KDFVNLYHSMNIEYKTALQAIDSSELNSDNELILSFKKRWYRIDVNNDTFGDDTVNLLTL 725

Query: 674  XXXXXXXXSEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAP 733
                    S +NS L++ ++E G+++   L  ++WP+GLNNIGNTCYLNSLLQYYF+I+P
Sbjct: 726  RKVMMVISSNRNSLLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISP 785

Query: 734  LREYILNYKGSISNYEID--ETSN--KRRIGGREVSENEVERSIQFMYQLRDLFNDMIYS 789
            LREY++N+    ++ E+D  E  N  KRR+GGR +S  E  RSIQF+YQLRDL+ +M++S
Sbjct: 786  LREYLINF----NDIELDGREMKNLEKRRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHS 841

Query: 790  KSRCITPKHELAYLAFAPSNIEVEFA-ASEVERTTVDLPFDK------EGDIXXXXXXXX 842
             SR ++P+ +LAYLAFAPS+  +EF    +      D   DK         I        
Sbjct: 842  SSRKVSPRLQLAYLAFAPSDTPIEFRDGIQNAIGKNDYYSDKTNGGSESSSIKGLNSNLN 901

Query: 843  XXXXXXXAQEVTSDISVATEDKV-MTNTSTKT-----AKISSDQLENALEMGRQQDVTEC 896
                   + +  S+ S+ T D + +  TST        KISS QLE  LEMG QQDVTEC
Sbjct: 902  SDSDADSSLDSDSESSLLTFDNLPIIKTSTTNLPTLIPKISSSQLETTLEMGSQQDVTEC 961

Query: 897  IGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLV 956
            I NVL+Q+E+AS PI +DED EQ DL+K+LF+GKT+Q+I P +++SK   K E F SLLV
Sbjct: 962  IENVLFQIEAASNPISIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLV 1021

Query: 957  NISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPF 1016
            ++SD PRDIYDAL++ F  E   M+EYG V+++++I++FP ILQ+QIQRVYYD E+ +PF
Sbjct: 1022 SVSDKPRDIYDALDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPF 1081

Query: 1017 KSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRK 1076
            K +EPL FS ++Y+DRYA   +E L  KK E   L+ +LK L   + EL  +N+      
Sbjct: 1082 KDLEPLRFSESLYLDRYANDIDEKLAEKKIEVASLKKRLKGLITIKKELEKKND------ 1135

Query: 1077 ESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDH 1136
                                                    + E+  I  EIN +E KID 
Sbjct: 1136 ----------------------------------------NVEIRTISKEINDVETKIDT 1155

Query: 1137 QFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDXXXXXXXXXXXXXXX 1196
             F EF   GYSLFAVFIHRG+A++GHYW+YIKD +  G WRKYND               
Sbjct: 1156 AFSEFHKHGYSLFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFS 1215

Query: 1197 XGNTATPYFLVFVKDYYKGDIEPLKR 1222
             GN++TPYFLV++K+  + D+EPLKR
Sbjct: 1216 EGNSSTPYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1254 (31%), Positives = 635/1254 (50%), Gaps = 108/1254 (8%)

Query: 7    EQSIEAHAGDSDEQSVSSTTADEKSLPPND----DGKQLLYPAVGLNLPFKTPDRLIDDI 62
            E  ++ H  D+D+ + ++  +  +++  ND    DG  LLY  +     FKT  R++DDI
Sbjct: 36   ESKLKKHHHDADKINPNTANSSAQNVEKNDTSIDDGMHLLYQNIEKEGVFKTSQRILDDI 95

Query: 63   VYDLAFIN-DSDLSSE--FK-GILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYE 118
            + D+AF++ DS+ S +  FK G+L    + YS  R+ ++P   +    +   +  K +++
Sbjct: 96   LTDIAFMSLDSEKSDDIDFKDGVLNLPTIKYSLWRKYIKPFKIILFNTNNPVVDVKLQHK 155

Query: 119  SISCPDHNRINVFFGVLIDS--NMENPTSFDA-VAETPIYHLKVTVKTRTKLEHLKKHVG 175
            S++ P +N I   +G+L+          +FD  +   P+Y +++TVKTR +LEH KKH+ 
Sbjct: 156  SVTSPKNNTITELYGLLVPKIPRRSELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIA 215

Query: 176  ISHYHLITE---LHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILXXXXXXXXXXXXX 232
            ++ Y L+ +   LH  DK D   F++  ++L+DF+ Y+SSDTNK+IL             
Sbjct: 216  LTPYFLLDDFDKLHEVDKSDFPKFNKDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTEL 275

Query: 233  XXXXXXXHITSRYQLVCEQYDSLNSD----TIPSQVDCFRTLFRV----FKGPLDRKSAD 284
                    + +R   +   ++ L  D     +  Q+D    L        KG  +R   +
Sbjct: 276  DYLLSSASVLNRSNELDNLHEELQPDYNDAIVEEQIDTIEILLHCIMQNLKGSPER---E 332

Query: 285  LDPIKT--INATNKALNSHMDSKWLVSKYGFQENSFQNPE----ANDQGLE--YEPPDLI 336
            L+  KT  + + +  L +++D KWL   +  +    +  +      D+ L+  ++ P+  
Sbjct: 333  LEKQKTSFLLSDDVKLGTYVDIKWLEENFDIKVKEQKRKDHVSITLDEALKLSFDDPN-- 390

Query: 337  DHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTAL 396
              KN  K  K+    TR  ++L + GK+     S     +       F ++  H +T+  
Sbjct: 391  -PKNQAKFDKI----TRYAMELMYLGKVLQSFYSNEEEIEEYMEDTIFKQVKVHHTTSFW 445

Query: 397  FQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYF 456
             QI N+         TS   +D   HFINL      +++DII NYE     D +N   YF
Sbjct: 446  TQILNEYQSIFSSQKTSTRCVDE--HFINLCIDSNVSEKDIITNYEIQLRTDPDNDSKYF 503

Query: 457  DALTYIANTKGSYQLI-SYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYK 515
            ++L Y++     Y ++  YC +  ++ +    ++L +        +       +     +
Sbjct: 504  ESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEIFKYSEEYFNAIEHVSEIWDKYTE 563

Query: 516  QEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDD 575
              Q+ +  D Q   +L  +   +  + +S  L +   +EP+ + + AY  L++D  +D +
Sbjct: 564  LVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYITKYEPFFHPVTAYLKLNVDAKLDSE 623

Query: 576  IVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQ 635
             +  AYT++I + P  K+  D+AL+ IAI+   ++L   L + C  F        L+   
Sbjct: 624  NIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLSLLYVLKQNCSAFNECISNIILTSDD 683

Query: 636  ALSLLQVNENATDELVIKIFQQRWGQKILNEYDQXXXXXXXXXXXXSEKNSKLISYFLET 695
            A  ++ + + +++  +I  F + W +   +                  + S L+ +F E 
Sbjct: 684  AFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNFILASAALREVSKHRASALLRHFYEF 743

Query: 696  GVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNY-EIDETS 754
            G ++  ++  E WP G+NNIGNTCYLNSLLQYYFSI   RE+I NY+   S+    +   
Sbjct: 744  GKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSITLFREFIENYQSIESDLLNSNAEM 803

Query: 755  NKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEF 814
            +KRR+GGRE+  NE+ RS+QF+YQ++DLF  M+++KSR +TP ++LAYLAFAP+N E++F
Sbjct: 804  SKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKF 863

Query: 815  A-ASEVERTTVDLPFDKEGDIXXXXXXXXXXXXXXXAQEVT-SDISVATEDKVMTNTSTK 872
               SE+E +                           A  ++ SDI     D  + +TS  
Sbjct: 864  KHKSELESS------------EEHQLTTSHSIALSSATSISHSDIDTQDHDISLNSTSYS 911

Query: 873  ---TAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYG 929
                A ++ D LE  LE+G QQDVTECI  VLYQ+E+ S P+ LD D EQ DL+KELFYG
Sbjct: 912  NRLVAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYG 971

Query: 930  KTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRT 989
            +T QEI P+    K   K E +SSLLVNI D P D+Y+ L+  FA E++ M+EYG+V++T
Sbjct: 972  ETIQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKT 1031

Query: 990  VSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETK 1049
            +SIT  P IL IQIQRVYYD+E+ +P+K    LPF N I++DRY   +      K+N+  
Sbjct: 1032 LSITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNK-----KENDVL 1086

Query: 1050 E-LRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEK 1108
            E  R +LK  K +  EL+           S   ++N                        
Sbjct: 1087 EKARLELKLAKVKYRELV-----------SEYNSVN------------------------ 1111

Query: 1109 LRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIK 1168
              K+IS+    +   YD I  +   I+ +  +   I YSLFAVFIHRG+AS+GHYWVYI+
Sbjct: 1112 --KSISD---RIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYWVYIR 1166

Query: 1169 DPERSGIWRKYNDXXXXXXXXXXXXXXXXGNTATPYFLVFVKDYYKGDIEPLKR 1222
            D E +GIWRKYND                G+ +TPYFL +V    K  ++PL R
Sbjct: 1167 DFE-NGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVR 1219

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 55/122 (45%), Gaps = 23/122 (18%)

Query: 690 SYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE 749
           S F+E  +      Q    PIGL N+GNTCYLN+ LQ  F I PLRE ILNYK S S   
Sbjct: 89  STFIEDLLPGQQFQQFNQTPIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSP 148

Query: 750 IDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHEL-----AYLA 804
            DE   K                   + +LR+ F+ +   K + + P   L     AY  
Sbjct: 149 ADEVHQK------------------IVLELRNCFDSLDKKKFQAVMPLMLLNVLRKAYPQ 190

Query: 805 FA 806
           FA
Sbjct: 191 FA 192

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y+L  +  H+G  S  GHY  +I+D E   IW K+ND
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFND 470

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 34/53 (64%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           F+E    +  L +  + PIG  N+GNTCYLNS LQ  + I PLRE IL+Y GS
Sbjct: 90  FIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSYNGS 142

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (53%)

Query: 690 SYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE 749
           S F+E    +       + PIG  N+GNTCYLN+ LQ  + I PLR+ IL+Y  + +   
Sbjct: 89  SQFIEDLAPEQQFQHANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTP 148

Query: 750 IDETSNKRRIGGREVSEN 767
           +DET  K  +  +   EN
Sbjct: 149 VDETHKKIVVEMKRCFEN 166

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSN 755
           PIGL N+GNTCY+N+ LQ  + I PLRE ILN+     N+  D+ S+
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFPADDESH 149

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y L  V  H+G  S  GHY  +I+D      W K+ND
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFND 459

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 46/105 (43%), Gaps = 23/105 (21%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEID 751
           FLE       L+Q +  P+GL N+GNTCY N+ LQ  + I PLRE +L Y          
Sbjct: 88  FLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAY---------- 137

Query: 752 ETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITP 796
                        +E   +   Q + QLR+ FN     K +  TP
Sbjct: 138 -------------NEPNPDLHGQLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V  H+G  S  GHY  +++D      W KYND
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYND 451

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 27/34 (79%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           P+GL N+GNTCY+NS LQ  + I PLR+ +LNYK
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYK 92

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 45/95 (47%), Gaps = 19/95 (20%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENE 768
           P+GL N+GNTCY+NS LQ  + I PLRE ILN++    N          R G        
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN----------RSG-------- 146

Query: 769 VERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYL 803
            E+ IQ + +L+  F  +        TP   LA L
Sbjct: 147 -EQHIQLVAELKRCFQQLRDRPQESTTPILLLATL 180

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%)

Query: 687 KLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           K  S+F+E    D  + +    PIG  N+GNTCYLN+ LQ  F +  LRE ILNY
Sbjct: 85  KTASHFIEDLSPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 67/191 (35%), Gaps = 25/191 (13%)

Query: 992  ITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKEL 1051
            IT  PK L IQ  R ++ R      K +  + F     +D    L  E  Q K     EL
Sbjct: 300  ITKLPKYLTIQYVRFFWKRSSNKKSKILRKVVFP--FQLDVSDILTPEYQQEKIKVRDEL 357

Query: 1052 RNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRK 1111
            R   K  + +Q +   R                 L   ATVT    +        E   +
Sbjct: 358  RTVDKLREEKQRDAKKRK----------------LDGGATVTEGSFATPKEHSETEHALE 401

Query: 1112 AISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEAS-YGHYWVYIKDP 1170
            A     SE     DE        D Q  E     Y+L  V  H+G  S  GHY  +I+D 
Sbjct: 402  A-----SEKEYWRDEFKK-HFPPDLQAGENPSCVYNLVGVITHQGANSDSGHYQAFIRDE 455

Query: 1171 ERSGIWRKYND 1181
                +W K+ND
Sbjct: 456  NDENVWYKFND 466

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 690 SYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISN 747
           S F+E    D  + +  + PIG  N+GNTCY+NS LQ  F +  L++ ILNYK   +N
Sbjct: 89  SSFIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTEGNN 146

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 14/70 (20%)

Query: 1126 EINLIENKIDHQFDEFR-------------DIGYSLFAVFIHRGEAS-YGHYWVYIKDPE 1171
            E  LI+++ +H  +E++                Y L  +  H+G  S  GHY  +I+D  
Sbjct: 403  ETALIKSRKEHWLEEYKKRFPKDLQAGENPSCVYDLIGIITHQGANSESGHYQSFIRDEN 462

Query: 1172 RSGIWRKYND 1181
                W K+ND
Sbjct: 463  DEDKWYKFND 472

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%)

Query: 687 KLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           K  ++F+E    D  + + ++ PIGL N+GNTCY+N+ LQ  F +  +R+ ILNY
Sbjct: 84  KGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           F+E    DA   Q    P+G+ N+GNTCY+N+ LQ  + I PLRE IL +
Sbjct: 42  FIEDLGADAQSGQLSRVPMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (63%)

Query: 690 SYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISN 747
           ++F+E    +  + Q  + PIG  N+GNTCYLN+ LQ  + I  LR+ +LN+  SI+N
Sbjct: 87  NHFIEDLTPEQQVQQFNDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINN 144

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y L  +  H+G  S  GHY  +I+D     IW K+ND
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFND 466

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS--ISNYE 749
           F+E    +  + Q    P+G  N+GNTCYLN+ LQ  + +  LRE ILNY  S  +SN  
Sbjct: 91  FIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNG 150

Query: 750 IDETSNKRRI 759
           + +    ++I
Sbjct: 151 VQDEETHKQI 160

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V  H+G  S  GHY  +I+D      W K+ND
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFND 466

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 17/88 (19%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENE 768
           P+G+ N+GNTCY+N+ LQ  F I PLRE +L         E DE         R + E  
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVL---------EFDEK--------RAIKEGV 143

Query: 769 VERSIQFMYQLRDLFNDMIYSKSRCITP 796
                Q + +L+  F  +   K   ITP
Sbjct: 144 DTYHAQLVRELKVTFQKLKDRKGENITP 171

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS--ISNYE 749
           F+E    +  + Q    P+G  N+GNTCYLN+ LQ  + +  LR+ ILNY  S   SN  
Sbjct: 91  FIEDLAPEQQVQQFAETPVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSG 150

Query: 750 I-DETSNKRRI 759
           + DE ++K+ I
Sbjct: 151 VQDEETHKQII 161

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 690 SYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           ++F+E    D  L + ++ PIG  N+GNTCY+N+ LQ  +    +R+ IL+YK
Sbjct: 91  NHFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           F+E    +  + Q    P+G  N+GNTCYLN+ LQ  + +  LR+ ILNY  S
Sbjct: 91  FIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPS 143

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V  H+G  S  GHY  +I+D      W K+ND
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFND 466

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY---KGSISNY 748
           F+E    +  + Q    P+G  N+GNTCYLN+ LQ  + +  +R+ ILNY   +G  S+ 
Sbjct: 91  FIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSS 150

Query: 749 EIDETSNKR 757
             DE ++K+
Sbjct: 151 AQDEETHKQ 159

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 25/39 (64%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           N L P    IGLNN+GNTCY+NS LQ    I  LR+Y L
Sbjct: 333 NALTPSRGNIGLNNLGNTCYMNSALQCLVHIPQLRDYFL 371

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 25/34 (73%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           PIGL N+GNTCY+NS LQ  + +  LR+ +L YK
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYK 141

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 85/235 (36%), Gaps = 31/235 (13%)

Query: 952  SSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTV----SITNFPKILQIQIQRVY 1007
            S L  +IS     + + L  S   E  K  E+  V  T      IT  PK L +Q  R +
Sbjct: 255  SKLKCHISGTTNFMKNGLIESLHEEIEKRSEHTGVNSTYLVDKQITKLPKYLTVQYVRFF 314

Query: 1008 YDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLN 1067
            + R      K +  + F     +D    L  E  Q K    +ELR K++  K+     L 
Sbjct: 315  WKRSTNKKSKILRKVQFP--FQLDVADMLTPEYAQEKIKIREELR-KIEKEKSDDERELK 371

Query: 1068 RNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEI 1127
            R ++  S  +    T      E   T + L    R   +++ +K                
Sbjct: 372  RRKVNDSDSDGTTMT----PREKQETEEALEDSRREHWLQEYKKHFPT------------ 415

Query: 1128 NLIENKIDHQFDEFRDIGYSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
                   D +  E     Y L  V  H+G  S  GHY  +I+D +    W K+ND
Sbjct: 416  -------DLRPGENPSCVYDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFND 463

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%)

Query: 692 FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           F+E    D  + Q  + P+GL N+GNTCYLN+ LQ  F    L++ IL Y  S
Sbjct: 91  FVEDLSPDQQVQQFNSTPLGLQNMGNTCYLNATLQALFRADELKDLILQYDPS 143

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 1146 YSLFAVFIHRGEAS-YGHYWVYIKDPERSGIWRKYND 1181
            Y L  V  H+G  S  GHY  +I+D      W K+ND
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFND 462

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSIS 746
           N LQP     GL N+GNTCY+NS LQ    I  LR+Y L Y G  S
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL-YDGFTS 337

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 14/52 (26%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI--------------LNYKGSISN 747
           +GLNN+GNTCY+NS LQ    I P+R+Y               L ++G+I+N
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIAN 449

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           N L P +  +GL+N+GN+CY+NS LQ    I  LR+Y L Y G
Sbjct: 289 NKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYFL-YGG 330

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIG 760
           N L+P +   GL N+GNTCY+NS LQ    I  LR+Y L Y G    YE DE + +  +G
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL-YDG----YE-DEINEENPLG 408

Query: 761 GREVSENEVERSIQFMYQLR 780
                       +Q ++Q R
Sbjct: 409 YHGYVARAFSDLVQKLFQNR 428

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           N + P N  +GL N+GNTCY+NS LQ    I   ++Y L
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFL 378

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  ++++PLRE IL +
Sbjct: 137 NKVFGYENFGNTCYCNSVLQCLYNLSPLRENILQF 171

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 12/87 (13%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIG 760
           N L P +  +GL N+G+TC++NS+LQ    I  LR+Y L Y G  +      T N    G
Sbjct: 342 NRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFL-YNGFAAEL---NTRNSLGYG 397

Query: 761 GREVSENEVERSIQFMYQLRDLFNDMI 787
           GR            F   ++ LF D I
Sbjct: 398 GRVAG--------AFAEVVQALFGDKI 416

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           N L+P +   GL N+GNTCY+NS LQ    I  LR+Y L Y G
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL-YDG 396

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           N L+P +   GL N+GNTCY+NS LQ    I  LR+Y L Y G
Sbjct: 355 NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL-YNG 396

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 12/70 (17%)

Query: 685 NSKLISYFLETGVIDANLLQPENW--------P---IGLNNIGNTCYLNSLLQYYFSIAP 733
           +S++IS  +E     +N   P N+        P   +GL+N+GNTCY+NS LQ    I  
Sbjct: 303 DSQIISLVVEVKQKSSNQHWPSNFFHYNKLNAPSGIMGLSNLGNTCYMNSALQCLLHIPE 362

Query: 734 LREYILNYKG 743
           L EY L YKG
Sbjct: 363 LNEYFL-YKG 371

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           N L+P +   GL N+GNTCY+NS LQ    +  LR+Y L Y G
Sbjct: 352 NKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFL-YNG 393

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           N L P +   GL N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 284 NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           GL N GNTCY NS+LQ  F+++ LR  IL Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           +GL+N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 323 MGLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           N L P     GL+N+GN+CY+NS LQ    I  L++Y L Y G
Sbjct: 325 NKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFL-YGG 366

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (58%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           N LQ     IGL N+GNTCY+NS LQ    I   R+Y L
Sbjct: 321 NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFL 359

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           IGL+N+GNTCY+NS LQ    I   ++Y L Y G
Sbjct: 346 IGLSNLGNTCYMNSALQCLLHIPEFKDYFL-YNG 378

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (62%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSI 745
           GL N GNTCY NS+LQ  +++   RE IL    SI
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSI 166

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 697 VIDANLL---QPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDET 753
           V ++NL+      N   G  N GNTCY NS+LQ +F+ +  R  +L++  S S+ E   T
Sbjct: 111 VKESNLMPYGDGSNKIFGYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSDGERART 170

Query: 754 -----SNKRRIGG 761
                 +KR I G
Sbjct: 171 LETFGRSKRNING 183

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           IGL+N+GNTCY+NS LQ    I  +R+Y + Y G
Sbjct: 321 IGLSNLGNTCYMNSGLQCLVHIPQIRDYFV-YNG 353

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%)

Query: 701 NLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           N L P    +GL N+GNTCY+NS LQ    +    EY L
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFL 443

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS+LQ  F+    R   L++K
Sbjct: 754 GLRNLGNTCYINSMLQCLFATTEFRNIFLSHK 785

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           IGL N+GN+CYLN ++Q       L +  LNY  S   Y I+  S   ++G + V    +
Sbjct: 747 IGLQNMGNSCYLNCIIQCLLGTHELTKIFLNY--SFERY-INLNS---KLGSKGVLAKNL 800

Query: 770 ERSIQFMYQLRDLFND 785
            + I  MY    L N+
Sbjct: 801 SKLIHLMYNHSTLKNN 816

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           G  N GNTCY NS+LQ  ++++ LRE IL +
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQF 171

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKG 743
           +GL+N+GNTCY+NS LQ    I  LR+Y   Y G
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVHIPKLRDYFF-YGG 321

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
            G  N GNTCY NS+LQ  ++++ LRE IL +
Sbjct: 141 FGYENFGNTCYCNSVLQCLYNLSSLRENILQF 172

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS+LQ  F  +  R+  L  K
Sbjct: 589 GLRNMGNTCYINSMLQCLFGCSQFRDLFLGGK 620

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 24/102 (23%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEVE 770
           GL N+GNTCY+NS LQ    I   REY L Y G    YE                E   +
Sbjct: 322 GLVNLGNTCYMNSALQCITHIPVFREYFL-YSG----YE---------------KELNTD 361

Query: 771 RSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEV 812
             + +   + + F+++I    RC+     + + A+AP++ + 
Sbjct: 362 NPLGYQGHVAEAFSELI----RCLFGDKLVQFSAYAPNHFKA 399

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 701 NLLQPE---NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKR 757
           NL QP+   ++ +GL N+GN+CY+N ++Q   S   L +  LN     ++YE     N  
Sbjct: 507 NLNQPKLDLDFTVGLENMGNSCYMNCIIQCLLSTHELSQIFLN-----NSYEKHINLNS- 560

Query: 758 RIGGREVSENEVERSIQFMYQ 778
           ++G + V      R +  MY+
Sbjct: 561 KLGSKGVLAKYFARLVHTMYR 581

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS+LQ  F+    R+  L+ K
Sbjct: 557 GLRNMGNTCYINSMLQCLFATRKFRDLFLSPK 588

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++  LR ++L Y
Sbjct: 140 NKVFGYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
            GL N GNTCY NS+LQ  +++  LR  +L Y
Sbjct: 99  FGLENYGNTCYCNSVLQCLYNLKELRVNVLKY 130

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  ++I  LR+ ++ Y
Sbjct: 109 NKVFGYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           GL N+GNTCY+NS+LQ  F+    R+  L  K S
Sbjct: 609 GLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYS 642

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 19/77 (24%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           +GL N+GN+CYLNS+LQ +            Y G I N+ ++E        G E   + V
Sbjct: 326 VGLINLGNSCYLNSILQCF------------YNGGIPNWSVEEL-------GTEFPLSVV 366

Query: 770 ERSIQFMYQLRDLFNDM 786
             S     QL  L N M
Sbjct: 367 YPSNNLKCQLLKLTNAM 383

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 1099 VLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEA 1158
            +LN G +   +    +N+D +  ++  E    +N     +     + Y L AV  H+G++
Sbjct: 675  ILNSGDVNRSVEWVFNNMDDD-GELPKEEPTTKNNNKDNYGNLNHVPYKLTAVVCHKGQS 733

Query: 1159 SY-GHYWVYIKDPERSGI-WRKYND 1181
            ++ GHY  +I+      + W  YND
Sbjct: 734  AHSGHYVAFIRKIVDGKLSWVLYND 758

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           G  N GNTCY NS+LQ  ++++ +RE IL +
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS+LQ  F+    R+  ++ K
Sbjct: 609 GLRNLGNTCYINSMLQCLFATTKFRDLFVSGK 640

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 711  GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
            GL N+ NTCY+NS+LQ  FS +  R   L+ K
Sbjct: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNK 1137

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILN--YKGSISNYEIDETSNKRRIGGREVSEN 767
           GL N+GNTCY+NS+LQ  F+    R   L+  YK  I        SN   I  R++  N
Sbjct: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLN 505

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
            G  N GNTCY NS+LQ  F++   R  IL +
Sbjct: 114 FGYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 1143 DIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            D+ Y L  +  HRG  + GHY  Y K  +  G+W ++ND
Sbjct: 420  DMIYELTGIVTHRGTVNEGHYITYTKTAD--GVWYQFND 456

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  ++I+  R  +L Y
Sbjct: 123 NKVFGYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query: 697 VIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNK 756
            +  N +   ++ +GL N+GN+CY+N ++Q  F+   L +  LN  G+ + +     + +
Sbjct: 512 TLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLN--GTYAKH----INKQ 565

Query: 757 RRIGGREVSENEVERSIQFMYQ 778
            ++G + V  +   + ++ MY+
Sbjct: 566 SKLGSKGVLSHNFAKLLKDMYE 587

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK-GSISNYEIDETSNKRR 758
           GL N+GNTCY++S+LQ  F+   LR+  +  K  S  N+++ +  N  R
Sbjct: 626 GLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTDKINLSR 674

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  ++I   R  IL Y
Sbjct: 131 NKVFGYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 19/29 (65%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           IGL N G TCYLNSLLQ YF     R+ +
Sbjct: 202 IGLKNQGATCYLNSLLQSYFFTKLFRKIV 230

 Score = 35.8 bits (81), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H GE S GHY+  IK P+    W +++D
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIK-PDVGDQWFRFDD 473

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL NIG TCY+NS+LQ  F+    R+  L+ K
Sbjct: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTK 588

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS++Q  F+    R   ++ K
Sbjct: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 698 IDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNY-EIDETSNK 756
           +D  +L+   +  GL N GNTC++NS+LQ   S   L E++ N    I  Y EI++  + 
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN--NVIRTYEEIEQNEHN 146

Query: 757 RRIGGREVSENEV 769
               G+E +++E 
Sbjct: 147 EEGNGQESAQDEA 159

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 13/58 (22%)

Query: 697 VIDAN--LLQPENWPI-----------GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
            ID N   LQP   P+           G  N GNTCY NS+LQ  +++  LR  IL +
Sbjct: 490 TIDHNHSALQPRTNPLIPFGDGSNKVFGYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 133 NKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 19/23 (82%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIA 732
            GLNN+GN+CY+NS+LQ  F+ A
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFNGA 335

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 695 TGVIDANLL----QPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           TGV+  N +    + E   +G  N G TCYLNSLLQ YF     R+ +
Sbjct: 240 TGVLWHNFINYDSKKETGYVGFRNQGATCYLNSLLQSYFFTKYFRDLV 287

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIK-PTTDDKWYRFDD 530

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 18/168 (10%)

Query: 886  EMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTR 945
            E   Q DV E    ++ ++ES  K   ++        + ++F GK K  I    +I    
Sbjct: 334  EAFTQHDVQELNRILMDRLESRMKGTSVEGK------LTDVFVGKMKSYI-KCVNIDYES 386

Query: 946  TKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMD------EYG--DVQRTVSITNFPK 997
            ++ E F  + +N+      + +A E+    E +  +      +YG  D ++ V   +FP+
Sbjct: 387  SRVEDFWDIQLNVKGL-EGLANAFENYIEVELMDGENQYAAQDYGLQDAKKGVVFESFPE 445

Query: 998  ILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKK 1045
            +L +Q++R  YD       K  +   F  TI +  Y  +D E+L+ +K
Sbjct: 446  VLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPY--MDKEVLKKQK 491

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 18/88 (20%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYIL--NYKGSISNYEIDETSNKRRIGGREVSENE 768
           GL N+GNTCY+NS++Q  F+    R   +  NYK  +                  ++ N 
Sbjct: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL----------------EPLASNR 642

Query: 769 VERSIQFMYQLRDLFNDMIYSKSRCITP 796
              S +    L  LFN M  +    + P
Sbjct: 643 PHHSPKLSNSLSMLFNKMYLNGGCSVVP 670

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 131 NKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNK 756
           GL N+GNTCY+N +LQ  F+   L+   ++  G    Y++    NK
Sbjct: 649 GLRNLGNTCYINCMLQSLFATNELKNLFIS--GKYREYQMKPNDNK 692

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSE 766
           N+ +GL N+GN+CY+N +LQ       L +  LN     ++YE     N  ++G + V  
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLN-----NSYEKHININS-KLGSKGVLA 633

Query: 767 NEVERSIQFMYQ 778
               R    M+Q
Sbjct: 634 RYFARLAHIMHQ 645

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
            G+ N+GNTCY+NS+LQ  F     R+  L
Sbjct: 213 FGIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS+LQ  F+    R+  ++ K
Sbjct: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSK 710

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSE 766
           ++ IGL N+GN+CYLN ++Q       L  YI      ++N      +   R+G + +  
Sbjct: 429 DFAIGLVNLGNSCYLNCIIQCLLGCHEL-SYIF-----LTNSYRKHVNVNSRLGSKGLLA 482

Query: 767 NEVERSIQFMYQ 778
           N   + +Q MYQ
Sbjct: 483 NYFSQLVQKMYQ 494

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           G  N GNTCY NS+LQ  +++   R  IL Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+G+TCY+NS+LQ  F+    R+  L+ K
Sbjct: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPK 645

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++  LR  +L Y
Sbjct: 134 NKVFGYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           IGL N+GN+CYLN ++Q   S        LN     ++YE    + K ++G + V     
Sbjct: 608 IGLENMGNSCYLNCIIQCLLSSHEFTRIFLN-----NSYE-KHINLKSKLGSKGVLARNF 661

Query: 770 ERSIQFMY 777
            R I  MY
Sbjct: 662 ARLINTMY 669

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           GL N+ NTCY+NS+LQ  FS    R   L+ K S
Sbjct: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780

>KLTH0A06534g Chr1 (543130..544806) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|P25364 Saccharomyces cerevisiae
           YCR065W HCM1 Forkhead transcription factor involved in
           cell cycle specific transcription of SPC110 encoding a
           spindle pole body (SPB) calmodulin binding protein
           dosage-dependent suppressor of calmodulin mutants with
           specific defects in SPB assembly
          Length = 558

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 58/152 (38%), Gaps = 20/152 (13%)

Query: 270 LFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLE 329
           L RV   P+  + A L P +  +A  +A+N       L     + EN        D G  
Sbjct: 273 LSRVASSPVGLREALL-PFEQASANKEAINQDAFIGELSPAIPYSEN--------DAGAS 323

Query: 330 YEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSY--RFFNKM 387
                  + KN+     LR SY+  C Q   W   S  L  K + +KY  S+   F    
Sbjct: 324 -------ETKNETAFPSLRKSYSADCPQQELWSAPSLTLSPKKDAKKYTCSFNANFEASP 376

Query: 388 HTHTSTTA-LFQIFNDSARRLQQDDTSASPLD 418
           HT T  T  L + F      L+  D +  PLD
Sbjct: 377 HTRTPKTGPLLEGFGSPGSELEGVDFTG-PLD 407

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS++Q  F+    R   ++ K
Sbjct: 610 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSK 641

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           IG  N G TCYLNSLLQ YF     R+ +
Sbjct: 202 IGFKNQGATCYLNSLLQSYFFTKLFRKMV 230

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P  +  W +++D
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIK-PNVTDQWFRFDD 473

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           G  N GNTCY NS+LQ  ++ + LR+ ++ Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 35.8 bits (81), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 1146 YSLFAVFIHRGEA-SYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G + S GHY V+ K PE  G W  Y+D
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCKQPE--GHWATYDD 621

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 18/88 (20%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYIL--NYKGSISNYEIDETSNKRRIGGREVSENE 768
           GL N+GNTCY+NS++Q  F+    R   +  NYK  +   +          G R    ++
Sbjct: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK----------GSRSAHSSK 651

Query: 769 VERSIQFMYQLRDLFNDMIYSKSRCITP 796
           +  S+        LFN M  +    + P
Sbjct: 652 LSNSLNM------LFNKMYLNGGCSVVP 673

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N  NTCY+NS++Q  F   P R+  L  K
Sbjct: 293 GLQNPCNTCYINSIIQCLFGSTPFRDLFLTKK 324

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742
           GL N+GNTCY+NS++Q  F+    R   ++ K
Sbjct: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSK 634

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 35.8 bits (81), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           +GL N GNTCY+NS++Q  F    LR+  +
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 29/110 (26%)

Query: 711 GLNNIGNTCYLNSLLQ---------------------YYFSIAPLREYILNYKGSISN-- 747
           GL N+GN+CYLNS+LQ                       +  + LR  ++  + ++ N  
Sbjct: 310 GLQNLGNSCYLNSVLQVLLNGDLSRWSLEGLGDFPGDVLYVSSNLRCQLIKMRNALKNEP 369

Query: 748 ----YEIDETSNKRRIGG--REVSENEVERSIQFMYQLRDLFNDMIYSKS 791
               + +  T+ K  IGG   E S    + +++F     DL +  ++ KS
Sbjct: 370 EKYPHGVKPTTFKHCIGGTHEEFSSGRQQDALEFFSYFVDLLDKKVFEKS 419

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           +GL NIGN+CYLN ++Q       L +  LN      N+     +   ++G + V     
Sbjct: 559 VGLQNIGNSCYLNCIIQCLLGTHELTKIFLN------NFYERHINLNSKLGSKGVLAKYF 612

Query: 770 ERSIQFMY 777
            R I  M+
Sbjct: 613 ARLIHLMH 620

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%), Gaps = 1/29 (3%)

Query: 703 LQPE-NWPIGLNNIGNTCYLNSLLQYYFS 730
           L+P  N+  GL N+GN+CYLNS+LQ  F+
Sbjct: 311 LEPNGNFGCGLINLGNSCYLNSILQALFA 339

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKR 757
           G  N G TCY NS+LQ  F+I   R+ I+    SI  +++   S ++
Sbjct: 107 GFQNFGYTCYCNSILQALFNIGSFRDGIIG-PASIGEFQLKNISMRK 152

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%), Gaps = 1/22 (4%)

Query: 710 IGLNNIGNTCYLNSLLQ-YYFS 730
           +GL N G TCYLNSLLQ YYF+
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFT 211

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIK-PGLEDAWYRFDD 461

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%), Gaps = 1/22 (4%)

Query: 710 IGLNNIGNTCYLNSLLQ-YYFS 730
           +GL N G TCYLNSLLQ YYF+
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFT 220

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIK-PGLDDKWYRFDD 470

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 695 TGVIDANLLQPENWPI----GLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           TGV+  N L  ++  +    G  N G TCYLNSLLQ YF     R+ +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 20/100 (20%)

Query: 923  IKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMD- 981
            + E+F GK K  I  + ++     + E F  L +N+ +     ++ L+ SF + +++M+ 
Sbjct: 311  LNEIFVGKMKSYIKCI-NVDYESARVEDFWDLQLNVKN-----FENLQGSFDN-YIEMEL 363

Query: 982  ----------EYG--DVQRTVSITNFPKILQIQIQRVYYD 1009
                      +YG  D Q+ V   +FP +L +Q++R  YD
Sbjct: 364  MNGENQYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 695 TGVIDANLLQPENWPI----GLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           TGV+  N L  ++  +    G  N G TCYLNSLLQ YF     R+ +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 63/139 (45%), Gaps = 12/139 (8%)

Query: 923  IKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMD- 981
            + E+F GK K  I    ++     + E F  L +N+ +  +++ ++ ++    E +  + 
Sbjct: 311  LSEIFVGKMKSYI-KCVNVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 982  -----EYG--DVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYA 1034
                 +YG  D Q+ V   +FP +L +Q++R  YD       K  +   F  TI  D   
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETI--DLSP 426

Query: 1035 ALDNELLQTKKNETKELRN 1053
             +D E+L+   +   + RN
Sbjct: 427  FVDKEVLKKSLDSGDKSRN 445

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++   R  IL Y
Sbjct: 123 NKVFGYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 143 NKVFGYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 35.4 bits (80), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY--KGSISNYEIDETSNKRRI 759
           N   G  N GNTCY NS+LQ  F +   R  IL +  K SI   ++  + N  RI
Sbjct: 119 NKIFGYENFGNTCYCNSILQCLFFLDDFRIDILKHPRKESIDGRKLKYSGNTPRI 173

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 1143 DIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            D+ Y L  +  H G  + GHY    K PE  G W K+ND
Sbjct: 403  DLIYELIGIICHTGTVNEGHYTAICKIPE--GQWIKFND 439

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 695 TGVIDANLLQPENWPI----GLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           TGV+  N L  ++  +    G  N G TCYLNSLLQ YF     R+ +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIK-PGVEDQWYRFDD 483

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R+ +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV 234

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIK-PSIEDQWYRFDD 477

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++  LR  +L +
Sbjct: 140 NKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 695 TGVIDANLLQPENWPI----GLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           TGV+  N L  ++  +    G  N G TCYLNSLLQ YF     R+ +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           +GL N+GN+CYLN ++Q   +   L +  LN     ++YE     N  ++G + +     
Sbjct: 735 VGLENMGNSCYLNCIIQCLLNNHELTKMFLN-----NSYEKHININS-KLGSKGILAKSF 788

Query: 770 ERSIQFMYQ 778
            R +  MYQ
Sbjct: 789 ARLVHSMYQ 797

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
           YDL122W
          Length = 747

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 696 GVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           G +D + L    +  GL N GNTC++NS++Q   S A L +++
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  I+ P+  G W +++D
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQ-PDAHGSWYRFDD 465

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R+ +
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P+    W +++D
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIK-PDLQDQWYRFDD 478

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R+ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P+    W +++D
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIK-PDLEDQWYRFDD 472

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R+ +
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 237

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 80/168 (47%), Gaps = 19/168 (11%)

Query: 890  QQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYE 949
            Q DV E    ++ ++E+  K  K++        + ELF GK K  I    ++    ++ E
Sbjct: 288  QHDVQELNRILMDRLETRMKGTKVEGK------LSELFVGKMKSYI-KCKNVDYESSRVE 340

Query: 950  GFSSLLVNISDHPRDIYDALESSFASEFLKMD------EYG--DVQRTVSITNFPKILQI 1001
             F  + +N+ D  +++  + E+    E +  +      ++G  D  + V   +FPK+L +
Sbjct: 341  EFWDIQLNVKD-LKNLQQSFENYIEVELMDGENQYAAPDFGLQDAYKGVVFESFPKVLHL 399

Query: 1002 QIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETK 1049
            Q++R  YD       K  +   F ++I +  Y  LD ++L+  +NET+
Sbjct: 400  QLKRFEYDFNFDQLIKINDRYEFPDSIDLSPY--LDKDVLKN-ENETE 444

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  IK P+    W +++D
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIK-PDLGDQWYRFDD 482

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRI 759
            G  N GNTCY NS+LQ  +++   R  +L +    SN     T  KR++
Sbjct: 131 FGFENFGNTCYCNSVLQCLYNMTEFRIQMLQHPERNSN-----TRRKRKV 175

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           +GL N+GN+CY+N ++Q       L +  LN     ++YE    +   R+G + V     
Sbjct: 605 VGLENMGNSCYMNCIIQCILGTHDLIKIFLN-----NSYE-KHINLSSRLGSKGVLAKNF 658

Query: 770 ERSIQFMY 777
            R I  MY
Sbjct: 659 ARLIHTMY 666

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISN 747
           +G  N G TCYLNSLLQ YF     R  +     S  N
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQEN 240

 Score = 32.7 bits (73), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIK-PGLEDQWYRFDD 474

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R  +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 221

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 75/163 (46%), Gaps = 20/163 (12%)

Query: 890  QQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYE 949
            Q DV E    ++ ++E+  K   ++      D + E+F G+ K  I  + ++    ++ E
Sbjct: 272  QHDVQELNRILMDRLENKMKGTPVE------DKLNEIFVGRMKSYIKCI-NVDYESSRVE 324

Query: 950  GFSSLLVNISDHPRDIYDALESSFASEFLKMD------EYG--DVQRTVSITNFPKILQI 1001
             F  L +N+ +  +D+  + E+    E +  +      +YG  D ++ V   +FP +L +
Sbjct: 325  EFWDLQMNVKN-LKDLKSSFENYIEIELMNGENQYAAQDYGLQDAEKGVIFESFPPVLHL 383

Query: 1002 QIQRVYYDRERFMPFKSIEPLPFSNTI----YMDRYAALDNEL 1040
            Q++R  YD       K  +   F ++I    Y+D+    D E+
Sbjct: 384  QLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEM 426

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIK-PSTEDQWYRFDD 465

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  + +   R  +L Y
Sbjct: 158 NKVFGYENFGNTCYCNSVLQCLYHLPEFRLRVLEY 192

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 1139 DEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            D+  DI + L  +  HRG  + GHY  + K    +G W K+ND
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTK--VTTGHWFKFND 438

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R+ +
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 232

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIK-PTLEDQWYRFDD 475

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 697 VIDANL--LQP----ENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           ++D N+  L P     N   G  N G+TCY NS+LQ  +++   R+ IL +
Sbjct: 102 IVDTNVTKLMPFGDGSNKVFGYENFGHTCYCNSVLQCIYNLPEFRKSILQF 152

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           IGL N+ N+CY+N ++Q   S+  L +  LN      N  +   + + ++G + V     
Sbjct: 429 IGLENMSNSCYMNCIIQCLLSVPELIQICLN------NSFLKHINMESKLGSKGVIMKHF 482

Query: 770 ERSIQFMY 777
            + IQ M+
Sbjct: 483 AKLIQDMH 490

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 65/135 (48%), Gaps = 16/135 (11%)

Query: 883  NALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDIS 942
            ++ E   Q DV E    ++ ++E+  K   ++       ++ E+F GK K  I  + D+ 
Sbjct: 275  DSAEAFTQHDVQELNRILMDRLENRMKGTSVE------GMLNEIFVGKMKSYIKCI-DVD 327

Query: 943  KTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFL------KMDEYG--DVQRTVSITN 994
               ++ E F  L +N+ +  + + ++ ++    E L      +  +YG  D ++ V   +
Sbjct: 328  YESSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGENQYQAQDYGLQDAEKGVIFES 386

Query: 995  FPKILQIQIQRVYYD 1009
            FP +L +Q++R  YD
Sbjct: 387  FPPVLHLQLKRFEYD 401

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIK-PGLEDQWYRFDD 473

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 231

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y+L  V +H G+ S GHY+  I+ P  S  W +++D
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIR-PGVSDEWYRFDD 475

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 20/136 (14%)

Query: 923  IKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMD- 981
            + ELF GK K  I  + ++    ++ E F  L +N+ +        LE SF S +++++ 
Sbjct: 309  LNELFVGKMKSYIKCI-NVDYESSRVEDFWDLQLNVKN-----LKGLEESF-SNYIEIEL 361

Query: 982  ----------EYG--DVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIY 1029
                      +YG  D ++ V   +FP +L +Q++R  YD       K  +   F  TI 
Sbjct: 362  MNGENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETID 421

Query: 1030 MDRYAALDNELLQTKK 1045
            +  Y    +E L  K+
Sbjct: 422  VSPYIEKGSEQLSNKE 437

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 698 IDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKR 757
           +D  +L+   +  GL N GNTC++NS+LQ   S   L E++ N    I  YE  E +   
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSKELMEFLDN--NVIKTYEEMEQNEH- 145

Query: 758 RIGGREVSENEVERS 772
               +E SE+E E+ 
Sbjct: 146 ---NKEESEHEPEQG 157

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769
           +GL N+GN+CY+N ++Q       L    LN     ++YE     N  ++G + V     
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLN-----NSYERHINLNS-KLGSKGVLAKHF 568

Query: 770 ERSIQFMYQ 778
            R I  M+Q
Sbjct: 569 ARLIHQMHQ 577

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 698 IDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE-IDETSNK 756
           +D  +L+   +  GL N GNTC++NS+LQ   S   L +++ N    I  YE I+ +   
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDN--NVIKTYEDIERSEQN 146

Query: 757 RRIGGREVSENE 768
           +   G E  ++E
Sbjct: 147 KENNGNEREQDE 158

>Kpol_1070.2 s1070 complement(3357..5345) [1989 bp, 662 aa] {ON}
           complement(3357..5345) [1989 nt, 663 aa]
          Length = 662

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 506 NDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNL 565
           ND+    +   ++NA+  D+Q+  + K+ + +        KL++F+D+E  P VMDAY  
Sbjct: 190 NDTRNSKLVTDKKNATPEDVQQRLKDKTGLPIFSTYFSCSKLRWFLDNE--PTVMDAYEA 247

Query: 566 LDI 568
            D+
Sbjct: 248 GDL 250

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 17/68 (25%)

Query: 706 ENW--------PIGLNNIGNTCYLNSLLQYYFSIAPLREYILN-----YKGSIS----NY 748
           +NW        P GL N G TCY N+ +Q    I  ++ Y+ +     Y G+IS    +Y
Sbjct: 347 KNWGDQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILLGKYDGTISKNSVSY 406

Query: 749 EIDETSNK 756
            + ETS K
Sbjct: 407 TLAETSKK 414

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 698 IDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           +D+N+L    +  GL N GNTC++NS+LQ   S   L +++
Sbjct: 116 MDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFL 156

>Ecym_3424 Chr3 complement(798948..799349) [402 bp, 133 aa] {ON}
            similar to Ashbya gossypii ADR135W
          Length = 133

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 1100 LNRGQII-EKLRKAISNIDSELS---------QIYDEINLIENKIDHQFDEFRDIGYSLF 1149
            L+ GQII  +  + +SN DSE++         + YD  +L    +DH FDE +D G S  
Sbjct: 48   LSLGQIICGQPPQKLSNDDSEITTEYVFPVPLKQYDSGSLTLENLDHLFDELQDKGCSRI 107

Query: 1150 AVFIHRGEASYGHYWVY 1166
             + I   + +  +Y +Y
Sbjct: 108  VLAIVSDDGAVVYYTIY 124

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 12/43 (27%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDE 752
            GL N+GN+CY+N++LQ  F+            G +S++ +DE
Sbjct: 309 CGLLNLGNSCYMNAVLQVLFN------------GGVSSWSLDE 339

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 1143 DIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            DI Y L  +  HRG  + GHY  + K     G W K+ND
Sbjct: 408  DIIYELIGIVSHRGTVNEGHYIAFCKI--SGGQWFKFND 444

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 685 NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           N+    +    G ID  +L+   +  GL N GNTC++NS+LQ   S   L  ++
Sbjct: 66  NNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFL 119

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 17/98 (17%)

Query: 699 DANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRR 758
           D+N L  E    GL N  NTCY+NS++Q  F     R+  L              + K R
Sbjct: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL--------------TKKYR 332

Query: 759 IGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITP 796
           +    ++ N+  + +Q    +  LF  M  +  R I P
Sbjct: 333 LF---LNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIP 367

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSE 766
           ++ +GL N+GN+CY+N ++Q       L    LN      +YE     N  R+G + V  
Sbjct: 460 DFAVGLENMGNSCYINCIVQCLLGTHELTNIFLN-----KSYERHINMNS-RLGSKGVLA 513

Query: 767 NEVERSIQFMYQ 778
               +    MYQ
Sbjct: 514 KYFAKLTHSMYQ 525

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 35/87 (40%), Gaps = 19/87 (21%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENE-V 769
           GL N  NTCY+NS++Q  FS    R+  L  K  +                    ENE  
Sbjct: 297 GLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKL------------------FLENEKY 338

Query: 770 ERSIQFMYQLRDLFNDMIYSKSRCITP 796
            + +Q  + +  LF  M  +  R I P
Sbjct: 339 PKGLQLSHSIYVLFKKMYLNGGRAIIP 365

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 1/22 (4%)

Query: 710 IGLNNIGNTCYLNSLLQ-YYFS 730
           +G  N G TCYLNSLLQ YYF+
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFT 224

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 923  IKELFYGKTKQEIVPLS-DISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMD 981
            I ELF GK K  I  ++ D    RT  E F  + +N+ +  RD+  + E+    E +  +
Sbjct: 309  INELFVGKMKSYIRCINVDYQSVRT--EDFWDIQLNVKNM-RDLQTSFENYIEVELMDGE 365

Query: 982  -EYG-------DVQRTVSITNFPKILQIQIQRVYYD 1009
             +Y        D ++ V   +FP +L +Q++R  YD
Sbjct: 366  NQYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYD 401

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 1146 YSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            Y L  V +H G+ S GHY+  IK P     W +++D
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIK-PSTKDEWYRFDD 474

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
            YBR058C (REAL)
          Length = 782

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 21/108 (19%)

Query: 1090 ATVTSQGLS--------VLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEF 1141
            A++ S GLS        ++N G +   +    +N+D        E+   E + + Q  + 
Sbjct: 656  ASMLSMGLSPKLCRKALIINNGDVNRSVEWVFNNMDDN-----GELPDPEGQSEQQQQQQ 710

Query: 1142 RDIG------YSLFAVFIHRGEASY-GHYWVYI-KDPERSGIWRKYND 1181
            +D+G      Y+L AV  H+G + + GHY V+I K  E    W  YND
Sbjct: 711  KDLGHLTTRPYALTAVICHKGNSVHSGHYVVFIRKMVEGEWKWVLYND 758

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 5/39 (12%)

Query: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE 749
           GL N+G TCY+NS+LQ  F+    R+         SNYE
Sbjct: 600 GLRNLGATCYINSMLQCLFATNMFRDLF-----EPSNYE 633

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 1143 DIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            D+ Y L AV  H G  + GHY    K P   G W ++ND
Sbjct: 391  DMMYELVAVISHEGSVNQGHYTSMCKIP--GGQWFRFND 427

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 705 PENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           PE + +GL N+GN+CYLNS+LQ   +   +R + L+  GS
Sbjct: 312 PE-YGLGLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGLGS 349

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++   R  +L +
Sbjct: 121 NKVFGYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILN 740
           N+ +GL N+GN+CY+N ++Q       L +  L+
Sbjct: 492 NFTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLD 525

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILN--YKGSI 745
           ++ +GL N+GN+CY+N ++Q       L +  LN  YK  I
Sbjct: 520 DFSVGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHI 560

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNY 741
           N   G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 169 NKVFGYENFGNTCYCNSVLQCLYNLYEFRLNMLEY 203

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
           (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 15/95 (15%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENE 768
           P GL N G TCY N+ +Q    I  ++ Y+         +++   S+K  I    V++  
Sbjct: 310 PCGLLNHGVTCYTNAAVQAMLHIPAIQHYL---------FDVLRGSHKNTIKADSVTQVL 360

Query: 769 VERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYL 803
            E S +  ++      D  ++KS  I PK  ++ L
Sbjct: 361 AETSKKMWWR------DKKHNKSTYINPKKLISRL 389

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 685 NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738
           NS L  +      +D  +L+      GL N GNTC++NS+LQ   S   L E++
Sbjct: 61  NSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQSLASSRTLVEFL 114

>SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {ON}
           similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005C SAD1 Conserved zinc-finger domain protein
           involved in pre-mRNA splicing required for assembly of
           U4 snRNA into the U4/U6 particle
          Length = 472

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739
           IGLNNI N  Y N ++Q    + P+R+Y L
Sbjct: 155 IGLNNISNNDYANVVIQLLGHVPPIRDYFL 184

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 24/117 (20%)

Query: 704 QPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGRE 763
           +P+ +  GL N GN CY NS++Q   SI    +YI  +   I   EI          G E
Sbjct: 66  RPDKYTTGLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGIDENEISS-------AGLE 118

Query: 764 VSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASEVE 820
            ++ E   ++     L DL                +L  + F P+N +++   S +E
Sbjct: 119 KTDTE---ALLLHRALADLL--------------RKLQMVIFEPTNADIKHLVSVLE 158

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 702 LLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744
           LL  +++  GL N+GN+CYLNS+LQ   +   +  + L++ GS
Sbjct: 315 LLPNKDYGCGLINLGNSCYLNSVLQSLLN-GGVPNWSLDFLGS 356

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 710 IGLNNIGNTCYLNSLLQYYFS 730
            GL N+GN+CYLNS+LQ  F+
Sbjct: 323 CGLINLGNSCYLNSVLQCLFN 343

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score = 33.1 bits (74), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 503 KSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEP 555
           K+ N +LLFS Y + +NA   D+    ELK+A+RV++  +   KL++  +  P
Sbjct: 313 KAKNTALLFSSYARLKNAMYPDL----ELKTALRVLLTKLDPSKLRYRPEEVP 361

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 1143 DIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYND 1181
            D+ Y L ++  H+G  + GHY V +K  +  G W K+ND
Sbjct: 430  DMIYELTSIISHKGTVNEGHYIVVVKVND--GQWFKFND 466

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILN-----YKGSISNYEIDE--TSNKRRIGG 761
           P GL N G TCY N+ +Q    I  ++ Y+ +     YK +IS   + +      +R+  
Sbjct: 376 PKGLLNHGVTCYTNAAVQALIHIPAIQHYLFDVLRGEYKSTISPNSVTQVLAETSKRMWS 435

Query: 762 REVSENEVERSIQFMYQLRDL 782
            + S+N+     + + +L D+
Sbjct: 436 TDASKNQFINPKKLIGRLEDI 456

>ZYRO0C13068g Chr3 complement(1036937..1037587) [651 bp, 216 aa] {ON}
            similar to uniprot|P40081 Saccharomyces cerevisiae
            YER134C Hypothetical ORF
          Length = 216

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 11/72 (15%)

Query: 1110 RKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKD 1169
            R  + +I      IY + NL +  I    DE R+           +    YG  +VY+KD
Sbjct: 151  RSKVGHIRDSFKIIYGDTNLDKRDICLFDDEGRN-----------KEVERYGIKFVYVKD 199

Query: 1170 PERSGIWRKYND 1181
            PER   W+ Y D
Sbjct: 200  PERGATWKLYQD 211

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 709 PIGLNNIGNTCYLNSLLQYYFSIAPLREYILN-----YKGSISNYEIDE--TSNKRRIGG 761
           P GL N G TCY N+ +Q    I  ++ Y+ +     YK +I+   + +      +R+  
Sbjct: 123 PKGLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQSVTQVLAETTKRMWS 182

Query: 762 REVSENEVERSIQFMYQLRDL 782
            E S+N+     + + +L D+
Sbjct: 183 NESSKNQFINPKKLIGRLDDI 203

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 758

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 699 DANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRR 758
           +A +L+   +  GL N GNTC++NS+LQ   S   L +++ N    I  Y+  E S    
Sbjct: 88  EAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASSKTLLQFLDNE--VIQAYKEAEESEDEH 145

Query: 759 IGGRE 763
           +  +E
Sbjct: 146 VAEKE 150

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSE 766
           N+ +GL N GN+CY++ ++Q       L    LN      N   +  +   R+G + +  
Sbjct: 485 NFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLN------NSYQNHINLNSRLGSKGLLA 538

Query: 767 NEVERSIQFMYQL-RDLFNDMIYSKSRCITPKHELA 801
               + I  MYQ  +D+   M   K+  I  + ++A
Sbjct: 539 RYFSQLIHQMYQYGKDIRKKMGNEKTAVIPTQFKIA 574

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 707 NWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSE 766
           N+ +GL N GN+CY++ ++Q       L    LN      N   +  +   R+G + V  
Sbjct: 483 NFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLN------NSYQNHINLNSRLGSKGVLA 536

Query: 767 NEVERSIQFMYQ 778
               + I  MYQ
Sbjct: 537 RYFSQLIHQMYQ 548

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score = 32.3 bits (72), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 698 IDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILN 740
           +D  +L+   +  GL N GNTC++NS+LQ   S   L +++ N
Sbjct: 89  LDEEVLKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDN 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,706,840
Number of extensions: 5934146
Number of successful extensions: 21765
Number of sequences better than 10.0: 306
Number of HSP's gapped: 22193
Number of HSP's successfully gapped: 373
Length of query: 1227
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1106
Effective length of database: 39,606,813
Effective search space: 43805135178
Effective search space used: 43805135178
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)