Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D050505.440ON41941916610.0
NCAS0H020805.440ON4352799061e-118
Suva_8.1755.440ON4533588671e-112
CAGL0K10230g5.440ON4462208521e-110
NDAI0C015905.440ON4702158491e-109
TDEL0D026105.440ON4402228461e-109
SAKL0G02662g5.440ON4792278461e-109
Smik_15.3005.440ON4633578421e-108
KNAG0B042105.440ON4632248351e-107
YOR123C (LEO1)5.440ON4642628341e-107
Kwal_55.214085.440ON4362188271e-106
KLLA0E02311g5.440ON4172218201e-105
KLTH0F15928g5.440ON4232218181e-105
Kpol_1062.265.440ON4572798151e-104
ACL167C5.440ON4392248081e-103
ZYRO0F10164g5.440ON4232208031e-103
TPHA0E017305.440ON4692227971e-101
Skud_15.2855.440ON4872147931e-101
Ecym_45115.440ON4612167831e-99
TBLA0A064905.440ON4282267558e-96
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D05050
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   644   0.0  
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   353   e-118
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   338   e-112
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   332   e-110
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   331   e-109
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   330   e-109
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   330   e-109
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   328   e-108
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   326   e-107
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   325   e-107
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   323   e-106
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   320   e-105
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   319   e-105
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   318   e-104
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   315   e-103
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   313   e-103
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   311   e-101
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   310   e-101
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   306   1e-99
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   295   8e-96

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/419 (78%), Positives = 328/419 (78%)

Query: 1   MSESVIRESLEPDVHEEVDNVAQDQREPXXXXXXXXXXXXXXXXXXXXXXXXXXGSYGGH 60
           MSESVIRESLEPDVHEEVDNVAQDQREP                          GSYGGH
Sbjct: 1   MSESVIRESLEPDVHEEVDNVAQDQREPDDMDDLFGDDNDEQKEEDDQEDEEDEGSYGGH 60

Query: 61  RTSYIDEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIY 120
           RTSYIDEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIY
Sbjct: 61  RTSYIDEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIY 120

Query: 121 YTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRV 180
           YTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRV
Sbjct: 121 YTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRV 180

Query: 181 FKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLI 240
           FKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLI
Sbjct: 181 FKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLI 240

Query: 241 FIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEXXXXXXXXXXXXXX 300
           FIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE              
Sbjct: 241 FIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQ 300

Query: 301 XXXXXXLESPELGAFSHSNRRSQTPSQGYERTHRXXXXXXXXXXXXXXXXXXXXXXXXXX 360
                 LESPELGAFSHSNRRSQTPSQGYERTHR                          
Sbjct: 301 MKEQERLESPELGAFSHSNRRSQTPSQGYERTHREDEYEEDDFLVDDDEEDESVELESGA 360

Query: 361 XXXXXXXXXXXXXXXXXXXRAERLKEMKRSNKVVIEEENDENSPKRRKGPVISDDEDED 419
                              RAERLKEMKRSNKVVIEEENDENSPKRRKGPVISDDEDED
Sbjct: 361 DEEDDEEEEEAQFSDEDEARAERLKEMKRSNKVVIEEENDENSPKRRKGPVISDDEDED 419

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  353 bits (906), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 176/279 (63%), Positives = 208/279 (74%), Gaps = 8/279 (2%)

Query: 61  RTSYIDEEEAMYNRKFYGEEGSD-MSDHEEEAL--FKEADVELVRHVVPYKTFPENEDDK 117
           R + IDEEEAMY RKFYG++  +  S  ++ AL  FKE +VEL+RH+VPYKT  E  D+ 
Sbjct: 75  RRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDET 134

Query: 118 TIYYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAE 177
           T+YY KVP FL+I+P+PFDP +FE+ V++R SN+SS EDQLGDRLIDENT+RWRYSRDA 
Sbjct: 135 TVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDAN 194

Query: 178 QRVFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINK 237
           QRVFKESNAQIVQWSDGS+SLKLG EYTDILVN T+NTFL VSHDQQELMQC +GG+I K
Sbjct: 195 QRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITK 254

Query: 238 TLIFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEXXXXXXXXXXX 297
           TL+FIPTSTNSKIHQ+LSKA+ RR+QR H GPGTMI+N DPEVEKRELE           
Sbjct: 255 TLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRR 314

Query: 298 XXXXXXXXXLESPEL-----GAFSHSNRRSQTPSQGYER 331
                    LESP+      G +    R +  PS G  R
Sbjct: 315 RRQLKEKELLESPDTTMDVSGGYETRKRNTPNPSLGSRR 353

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  338 bits (867), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 223/358 (62%), Gaps = 15/358 (4%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKT-FPENEDDKTIYYTKV 124
           EE+AMY RKFYGE+ +D SD +E    FKE +VELVRH++P K    E      I+Y ++
Sbjct: 106 EEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNEIFYARI 165

Query: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184
           P FL+IDP+PFDPPSFE KV ER +N  S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 166 PNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFKES 225

Query: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244
           N QIVQWSDGSYSLK+G EYTDILVN T NTFLTVSHDQQELMQC +GG+I KTL+FIPT
Sbjct: 226 NTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPT 285

Query: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEXXXXXXXXXXXXXXXXXX 304
           ST+SKIHQ+LSKA+ R++QR + GPGT I+N+DPEVEKRELE                  
Sbjct: 286 STSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKEK 345

Query: 305 XXLESPELGAFSHSNRRSQTPSQGYERTHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 364
              ESP++G F  + R+  +P+  Y  T R                              
Sbjct: 346 EKQESPDVG-FETAFRKQSSPT-AYGATRRNEYEEDDFLVDDDEEEEAEFDDDDDNEEEE 403

Query: 365 XXXXXXXXXXXXXXXRAERLKEMKRSNKVVIEEE---NDENSPKRRKGPVISDDEDED 419
                           A RL+ +KR    + +EE   +D N  KRR+  VI DDEDED
Sbjct: 404 EEEADEDN--------AARLRNLKREGAAMYKEEGGDDDSNESKRRRVAVIEDDEDED 453

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  332 bits (852), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 153/220 (69%), Positives = 184/220 (83%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVPA 126
           +E+ MY RKFYGE+  + SD +E   FKE++V+L+RH++PYKT   N +   I+Y KVPA
Sbjct: 107 KEQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPA 166

Query: 127 FLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESNA 186
           FL+IDP+PFDP +FE  V ER S  +S EDQLGDRLIDENTIRWRYSRDAEQ VFKESNA
Sbjct: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226

Query: 187 QIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTST 246
           QIVQWSDGS+SLKLG EYTDI+VN TDNTFLTVSHDQQELMQC DGG+I KT++FIPTST
Sbjct: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286

Query: 247 NSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           NSKIHQ+LSKA++RR+ R + GPG+ I+  DPE+EK+ELE
Sbjct: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELE 326

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  331 bits (849), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 185/215 (86%), Gaps = 3/215 (1%)

Query: 65  IDEEEAMYNRKFYGEEGSDMSDHEEEAL-FKEADVELVRHVVPYKTFPENEDDKTIYYTK 123
           +D+EEAMY RKFYG+     SD+EE+A  FKEA+VE++RH+VPYKT   ++ D TIYY K
Sbjct: 115 MDDEEAMYTRKFYGDTDK-YSDNEEDAHDFKEANVEIIRHMVPYKT-SSDQADTTIYYAK 172

Query: 124 VPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKE 183
           VP FL+IDP+PFDP SFE KVK+R +++SS EDQLGDRLIDENTIRWRYSRD  QRVFKE
Sbjct: 173 VPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKE 232

Query: 184 SNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIP 243
           SNAQIVQWSDGS+SLKLG EYTDILVN TDNTFLTVSHDQQELMQC +GG+I KT++FIP
Sbjct: 233 SNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIP 292

Query: 244 TSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278
           TSTNSKIHQ+LSKA+ RR+QR + GPGTMI+  DP
Sbjct: 293 TSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDP 327

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  330 bits (846), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 181/222 (81%), Gaps = 3/222 (1%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKTFPENEDDK-TIYYTKV 124
           +E AMY RKFYGE+  +MSD EE A  F E +VELVRH+VPYKT  E  D+K TIYY KV
Sbjct: 84  QEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKV 143

Query: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184
           P FL+IDP+PFDPPSFE+KVKER  N SS EDQLGDRLIDENTIRWRYSRD  Q+V+KES
Sbjct: 144 PEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKES 202

Query: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244
           NAQIVQWSDG  SLKLG EYTDILVN TDNTF  VSHD+QELMQC  GG++ K+L+FIPT
Sbjct: 203 NAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPT 262

Query: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           STNSK+HQ+L+KA+ RRDQR   GPG   VN DPE+EK ELE
Sbjct: 263 STNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELE 304

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  330 bits (846), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 192/227 (84%), Gaps = 4/227 (1%)

Query: 63  SYI--DEEEAMYNRKFYGEEGSDMSDHEE-EALFKEADVELVRHVVPYKTFPENEDDKTI 119
           SY+  DEE+AMYNRKFYG++  + SD E+ +  FKEADVE+ +H+VPYKT   N  DK +
Sbjct: 124 SYLEEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKT-TSNSQDKEV 182

Query: 120 YYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQR 179
           YY KVP FL+IDP+PFDPPSF+  V+ R + FSS EDQL DRLIDENTIRWRYSRD++Q+
Sbjct: 183 YYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQ 242

Query: 180 VFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTL 239
           VFKESNAQI+QWSDG++SL+LG E++D+L+N TDNTFLTVSH+QQELMQCV+GG+I KT+
Sbjct: 243 VFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTM 302

Query: 240 IFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           +FIPTST+SKIHQRLSKA+ RR+QR H GP T IV  DPE+E+RELE
Sbjct: 303 MFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELE 349

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  328 bits (842), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 217/357 (60%), Gaps = 5/357 (1%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKTF-PENEDDKTIYYTKV 124
           EE+AMY RKFYGE+ +D SD +E    FKE +VELVRH++P K    E      I+Y ++
Sbjct: 108 EEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARI 167

Query: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184
           P FL+IDP+PFDPPSFE KV ERTSN +S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 168 PNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKES 227

Query: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244
           N QIVQWSDG+YSLK+G E TDILVN T NTFLTVSHDQQEL+QC +GG+I KTL+FIPT
Sbjct: 228 NTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 287

Query: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEXXXXXXXXXXXXXXXXXX 304
           STNSKIHQ+LSKA+ RR+QR + GPGT IV++DPEVEKRELE                  
Sbjct: 288 STNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLKEK 347

Query: 305 XXLESPELGAFSHSNRRSQTPSQGYERTHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 364
              ESP+  AF    R+  +P+                                      
Sbjct: 348 EKQESPD-AAFETGFRKQSSPTAYGTSRRNEYEEDDFLVDDDEEEEAEFDDDDDNEEEEE 406

Query: 365 XXXXXXXXXXXXXXXRAERLKEMKRSNKVVI--EEENDENSPKRRKGPVISDDEDED 419
                           A RL+ +K+    +   EE  D N  KRR+  VI DDE+ED
Sbjct: 407 EEEEEEEEEEDADEANAARLRSLKKEGAAMYRQEENEDNNETKRRRVAVIEDDEEED 463

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  326 bits (835), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/224 (70%), Positives = 183/224 (81%), Gaps = 3/224 (1%)

Query: 65  IDEEEAMYNRKFYGEEGSDMSDHEE-EALFKEADVELVRHVVPYKTFPENE-DDKTIYYT 122
           +DEEE MYNRKFYGE+  DMSD E+ E  FKEA+VELV+H+VPYK  P++      IY  
Sbjct: 96  MDEEEEMYNRKFYGED-VDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTNDIYVA 154

Query: 123 KVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFK 182
           KVP FL IDP PFDP SFE KV +R     S ED+LGDRLIDENT+RWRYSRD  Q VFK
Sbjct: 155 KVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSVFK 214

Query: 183 ESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFI 242
           ESN QIVQWSDGSYSLKLG EYTDIL+N TDNTFLTVSHDQQELMQCV+GG +NKTL+FI
Sbjct: 215 ESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFI 274

Query: 243 PTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           PTST+SKIHQ+LSKA+ARR+    +GPGT IV++DPE+EK+ELE
Sbjct: 275 PTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELE 318

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  325 bits (834), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/262 (60%), Positives = 191/262 (72%), Gaps = 3/262 (1%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKT-FPENEDDKTIYYTKV 124
           EE+AMY RKFYGE+ ++ SD +E    FKE +VELVRH++P K    E      I+Y ++
Sbjct: 114 EEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARI 173

Query: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184
           P FL+IDP+PFDPPSFE KV ER SN +S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 174 PNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKES 233

Query: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244
           N QIVQWSDG+YSLK+G E TDILVN T NTFLTVSHDQQEL+QC +GG+I KTL+FIPT
Sbjct: 234 NTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 293

Query: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEXXXXXXXXXXXXXXXXXX 304
           STNSKIHQ+LSKA+ RR+QR   GPGT IV++DPEVEK+ELE                  
Sbjct: 294 STNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLKEK 353

Query: 305 XXLESPELGAFSHSNRRSQTPS 326
              ESP+  AF    R+  +P+
Sbjct: 354 EKQESPD-AAFETGFRKQNSPT 374

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  323 bits (827), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 187/218 (85%), Gaps = 1/218 (0%)

Query: 69  EAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVPAFL 128
           +AMYNRKFYG+   D +D   +  F+EADV++V+HVVPY T P +E DKTI+Y KVP FL
Sbjct: 81  QAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVP-SEGDKTIFYAKVPQFL 139

Query: 129 SIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESNAQI 188
           +IDP+PFDPP+F+NK+++RT+  SS EDQ+ DRLI+ENT+RWRYSRD++Q+VFKESNAQI
Sbjct: 140 TIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQI 199

Query: 189 VQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTSTNS 248
           VQWSDG++SL+LG E+TD+L+N T++T+LTVSHDQQEL+Q V GG++ K +IFIPTSTNS
Sbjct: 200 VQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNS 259

Query: 249 KIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           K HQRLSKA+AR++QR H GP T I+ +DPE+E++ELE
Sbjct: 260 KSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELE 297

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  320 bits (820), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 152/221 (68%), Positives = 187/221 (84%), Gaps = 1/221 (0%)

Query: 66  DEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVP 125
           DEE+AMYNRKF GE+    S+ E E  +KE DVE+V+HVVPYKT     DDKTIYY KVP
Sbjct: 67  DEEQAMYNRKFLGEDYEGQSEEEYEKKYKEVDVEIVKHVVPYKT-ANGADDKTIYYAKVP 125

Query: 126 AFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESN 185
            FL+IDP+PFDPPSF+ KV++R S +SS EDQLGDRLI+ENTIRWRYSRD ++RVFKESN
Sbjct: 126 QFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESN 185

Query: 186 AQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTS 245
           AQIV+WSDG++SLK+G EYTDILVN T+NT+LTVSH++QEL+QCV+GG+I K+++F+PTS
Sbjct: 186 AQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTS 245

Query: 246 TNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           TNSK+H+ LSKA+ARRD+R   GP T I   DPE+EKRELE
Sbjct: 246 TNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELE 286

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  319 bits (818), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/221 (64%), Positives = 189/221 (85%), Gaps = 2/221 (0%)

Query: 66  DEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVP 125
           D+E+AMYNRKFYG++G D +D E    F+EAD+++++H+VPY T P ++ DKTIYYTKVP
Sbjct: 65  DDEQAMYNRKFYGDKGEDSND-EGSQEFREADIDIMKHIVPYSTEP-SQGDKTIYYTKVP 122

Query: 126 AFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESN 185
            FL+IDP+PFDPP+F++K++ER +  +SVEDQ+ DRLI+ENT+RWRYSRD  QRVFKESN
Sbjct: 123 QFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESN 182

Query: 186 AQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTS 245
           A IVQWSDG+YSL+LG EYTD+L+N T++T+L VSHDQQEL+Q V GG++ K +IFIPTS
Sbjct: 183 AHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTS 242

Query: 246 TNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           TNSK HQRLSKA+AR++Q+ H GP T I+ +DPE+E++ELE
Sbjct: 243 TNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELE 283

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  318 bits (815), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 200/279 (71%), Gaps = 11/279 (3%)

Query: 58  GGHRTSYIDE----EEAMYNRKFYGEEGSDMSDHEEEAL-FKEADVELVRHVVPYK-TFP 111
           G  R +Y+DE    E+AMY RKFYGE+  D SD EE+   F+E DV L RHVVP K T  
Sbjct: 78  GRRRRNYVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSE 137

Query: 112 ENEDDKTIYYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWR 171
           EN+ D TIYY KVP FL+IDP+PFDPP+FEN V+ER +N  S E+QL DRLID+NTIRWR
Sbjct: 138 ENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWR 197

Query: 172 YSRDAEQRVFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVD 231
           YSRD  QRVFKESNA IVQWSDGSYSLKLG EYTDIL+N TDNTFLTVSHDQQELMQCV 
Sbjct: 198 YSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVH 257

Query: 232 GGQINKTLIFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEXXXXX 291
           GG+I+K+L+F+P ST SK+HQRLSKAI RR+     GP +MIVN+DPE+EK+ELE     
Sbjct: 258 GGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQ 317

Query: 292 XXXXXXXXXXXXXXXLESPELGAF-----SHSNRRSQTP 325
                          LES E   F     S S +RS TP
Sbjct: 318 VFRERRKKKQKEIEALESLETTGFGNNSYSASRKRSTTP 356

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 380 RAERLKEMKRSNKVVI--EEENDENSPKRRKGPVISDDEDE 418
           RAERL+E+KR        +E++   SPKRRK  VI DDED+
Sbjct: 417 RAERLRELKRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  315 bits (808), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 184/224 (82%), Gaps = 3/224 (1%)

Query: 66  DEEEAMYNRKFYG---EEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYT 122
           +EE+ MYNRKFYG   ++ SD+SD +E    KEAD+ELV+HVVP       E  + +YYT
Sbjct: 79  NEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYT 138

Query: 123 KVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFK 182
           KVP FL+IDP+PFDPPSF+ ++++R + FSS EDQLGD LIDENTIRWRYSR ++QRVFK
Sbjct: 139 KVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFK 198

Query: 183 ESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFI 242
           ESNAQ+++WSDG+ SLKLG EYTDIL N  +NT+LTVSH+QQE+MQCV+GG I+ +++FI
Sbjct: 199 ESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFI 258

Query: 243 PTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           PTSTNSKIH+RL+KAIARR+ R HSGP T IV  DPE+EKREL+
Sbjct: 259 PTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQ 302

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  313 bits (803), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 178/220 (80%), Gaps = 1/220 (0%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVPA 126
           EE AMY RKFYGE+   +SD EE   F+E DVELVRH+VPY+   +  D   +YY K+P 
Sbjct: 87  EEHAMYTRKFYGEDVDRVSDEEEAQEFREEDVELVRHIVPYRA-TQGTDKPVLYYAKIPE 145

Query: 127 FLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESNA 186
           FL+IDP+PFDPPSFE  VKER  N +S EDQLGDRLIDENT+RWRYSRDA Q+VFKESNA
Sbjct: 146 FLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNA 205

Query: 187 QIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTST 246
           QIVQWSDG++SLKLG EYTDIL N TDNTF  VSHDQQELMQC +GG++ KTL+FIPTST
Sbjct: 206 QIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTST 265

Query: 247 NSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           +S++HQ+L+KA+ RRD +  +GPGT IV  DPE+E+ ELE
Sbjct: 266 SSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELE 305

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  311 bits (797), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 176/222 (79%), Gaps = 9/222 (4%)

Query: 66  DEEEAMYNRKFYGEEGSDMSDHEEEAL-FKEADVELVRHVVPYKTFPENEDD-------- 116
           DEE AMY RKFYG+E  +  D +E    FKEADVELVRH+VPYK   +  D+        
Sbjct: 109 DEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSK 168

Query: 117 KTIYYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDA 176
            + YY ++P FL+IDP+PFDPP FE++VKER  N ++V+D++GDRLIDENTIRWRYSRDA
Sbjct: 169 NSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDA 228

Query: 177 EQRVFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQIN 236
            Q VFKESNAQI+QWSDGSYSLKLG +YTD+LVN   NTFLTVSHDQQELMQCVDGG+I+
Sbjct: 229 NQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEIS 288

Query: 237 KTLIFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278
           K+ +F+P STNS++HQRLSKAIARRDQ     P +MI+N+DP
Sbjct: 289 KSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDP 330

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  310 bits (793), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/214 (67%), Positives = 172/214 (80%), Gaps = 2/214 (0%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKT-FPENEDDKTIYYTKV 124
           EE+AMY RKFYGE+ +D SD +E A  FKE ++E+VRH++P K    E      I+Y ++
Sbjct: 136 EEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYARI 195

Query: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184
           P FL+ID +PFDPPSFE KV ER  N +S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 196 PNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFKES 255

Query: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244
           N QIVQWSDGSYSLK+G E TDILVN T NTFLTVSHDQQEL+QC +GG+I KTL+FIPT
Sbjct: 256 NTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 315

Query: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278
           STNSKIHQ+LSKA+ RR+QR + GPGT IVN+DP
Sbjct: 316 STNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDP 349

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 381 AERLKEMKRSNKVVIEEE---NDENSPKRRKGPVISDDEDE 418
           A RL+ +KR    + +EE   +D N  KRR+  VI DDEDE
Sbjct: 446 AARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVIEDDEDE 486

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  306 bits (783), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 179/216 (82%), Gaps = 3/216 (1%)

Query: 66  DEEEAMYNRKFYGEE---GSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYT 122
           ++E+ MYNRKFYG++    S  SD EEE   KEA+V++++HVVPY T   +E D ++YY 
Sbjct: 84  EDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLYYA 143

Query: 123 KVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFK 182
           KVP FL+IDP+PFDPP F++++++R   FSS EDQLGDRLIDENTIRWRYSR A Q+VFK
Sbjct: 144 KVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQVFK 203

Query: 183 ESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFI 242
           ESNAQI+QWSDG++SLKLG E++DIL+N  +NT++TVSH+Q+ELMQCV+GG+I K+++FI
Sbjct: 204 ESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFI 263

Query: 243 PTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278
           PTSTNSK HQRLS AIARR+ R HSGP T IV +DP
Sbjct: 264 PTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  295 bits (755), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 139/226 (61%), Positives = 179/226 (79%), Gaps = 6/226 (2%)

Query: 67  EEEAMYNRKFYGEEGSDMSDHEE-EALFKEADVELVRHVVPYKTFPENED---DKTIYYT 122
           +++AMY +KFYGE+G + SD ++ E  +KE+D+ELVRH+VPYKT P N++    + +YY 
Sbjct: 54  QDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHRELYYA 113

Query: 123 KVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQ--RV 180
           KVP FL +DP+PFD  +FE+ VKER  N  + + Q+ DRL DENTIRWRYSRD+    +V
Sbjct: 114 KVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKV 173

Query: 181 FKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLI 240
           FK+SNAQI+QWSDGSYSLKLG +YTDIL N TDN FLTVSHDQQELMQC +GG+I KTL+
Sbjct: 174 FKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLM 233

Query: 241 FIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286
           FIP+ST SKIHQRL+ A+  RD++  SGPG M++N DPE+EK+ LE
Sbjct: 234 FIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLE 279

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,546,356
Number of extensions: 1581803
Number of successful extensions: 5123
Number of sequences better than 10.0: 34
Number of HSP's gapped: 5207
Number of HSP's successfully gapped: 48
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)