Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D050305.426ON1462146277530.0
NDAI0C016205.426ON1460146269150.0
NCAS0H020405.426ON1460146268910.0
Smik_15.2945.426ON1460145768310.0
YOR116C (RPO31)5.426ON1460145768260.0
Skud_15.2795.426ON1460145768240.0
TDEL0E019905.426ON1460146268050.0
Kpol_1016.95.426ON1460146267960.0
Suva_8.1695.426ON1460145767900.0
SAKL0G02354g5.426ON1458145267020.0
KLTH0F16236g5.426ON1460146266580.0
ZYRO0F09856g5.426ON1458146266510.0
CAGL0L11660g5.426ON1459145966410.0
TBLA0A037205.426ON1458146266240.0
KNAG0B042405.426ON1455146266240.0
AER252C5.426ON1459146265010.0
TPHA0H017605.426ON1459146364880.0
KLLA0E21253g5.426ON1457145264530.0
Ecym_55255.426ON1459145764380.0
Kwal_55.214595.426ON1148114652190.0
Smik_4.957.314ON1719149818660.0
YDL140C (RPO21)7.314ON1733149818660.0
Suva_4.1047.314ON1733149818650.0
Skud_4.1147.314ON1726150018640.0
Ecym_80657.314ON1743151018240.0
ZYRO0F05918g7.314ON1744151217480.0
KLLA0F05071g7.314ON1720150817440.0
CAGL0I03828g7.314ON1715151917120.0
Kwal_55.21464singletonOFF32031713921e-180
KAFR0B010607.314ON168593314901e-178
TDEL0C023207.314ON172793114871e-177
ADR086C7.314ON174593414861e-177
KNAG0C039707.314ON172192914761e-176
NCAS0A139007.314ON171693314731e-175
NDAI0A021307.314ON172993314721e-175
TPHA0A030707.314ON171993014671e-175
SAKL0F10472g7.314ON173097914641e-174
TBLA0F021707.314ON172692714621e-174
KLTH0H02046g7.314ON174098114611e-174
Kwal_56.244897.314ON172893714551e-173
Kpol_162.1singletonON131158812481e-147
KLTH0D01628g7.51ON165499910921e-123
Kwal_26.69797.51ON165499010901e-123
TDEL0H040007.51ON166597910891e-123
YOR341W (RPA190)7.51ON166498110841e-122
Smik_15.5197.51ON166599110761e-121
Skud_15.5067.51ON166599410751e-121
NDAI0H012007.51ON166988510721e-121
KNAG0D049707.51ON167197010701e-120
Suva_8.3917.51ON166599110701e-120
ADR374C7.51ON164097910511e-118
ZYRO0D04532g7.51ON16677419501e-105
KLLA0F23243g7.51ON16537349391e-103
CAGL0E05500g7.51ON16437539361e-103
Kpol_1040.37.51ON16567349351e-103
TPHA0H028007.51ON16487269301e-102
KAFR0K005407.51ON16627299131e-100
NCAS0F007307.51ON16746319101e-99
TBLA0E019307.51ON16597298992e-98
SAKL0B10736g7.51ON16507308823e-96
Kpol_1019.277.314ON3642912285e-19
KLTH0F19338g3.22ON129070811.0
KLLA0D13068g5.359ON87756791.6
CAGL0M01386g5.370ON1427113801.6
Kpol_1038.203.22ON131396782.6
TPHA0H014405.359ON87588773.1
Kwal_55.220763.22ON128670773.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D05030
         (1462 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2991   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2668   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2659   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2635   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2633   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2633   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2625   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2622   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2620   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2586   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2569   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2566   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2562   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2556   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2556   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2508   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2503   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2490   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2484   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2014   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   723   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   723   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   723   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   722   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   707   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   677   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   676   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   664   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   540   e-180
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   578   e-178
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   577   e-177
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   577   e-177
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   573   e-176
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   572   e-175
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   571   e-175
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   569   e-175
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   568   e-174
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   567   e-174
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   567   e-174
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   565   e-173
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   485   e-147
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   425   e-123
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   424   e-123
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   424   e-123
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   422   e-122
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   419   e-121
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   418   e-121
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   417   e-121
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   416   e-120
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   416   e-120
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   409   e-118
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   370   e-105
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   366   e-103
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   365   e-103
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   364   e-103
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   362   e-102
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   356   e-100
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   355   1e-99
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   350   2e-98
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   344   3e-96
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    92   5e-19
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    36   1.0  
KLLA0D13068g Chr4 complement(1117229..1119862) [2634 bp, 877 aa]...    35   1.6  
CAGL0M01386g Chr13 (155052..159335) [4284 bp, 1427 aa] {ON} simi...    35   1.6  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    35   2.6  
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    34   3.1  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    34   3.4  

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2991 bits (7753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1446/1462 (98%), Positives = 1446/1462 (98%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            AHVRKSR                HPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DLKPKPTLFESLSSASSNIKLN
Sbjct: 1441 DLKPKPTLFESLSSASSNIKLN 1462

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2668 bits (6915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1283/1462 (87%), Positives = 1367/1462 (93%), Gaps = 2/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PK+ISG+EFSALSA+DIVAQSEVEISSRDLFDLE+ R+ K  GALD RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSL CETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK CS++LLSD+D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++L+ELR  G +DNL++MGILKKV+DQCKKQRRCL CGALNGVVKKAAAG+G+ASLKII
Sbjct: 121  RQFLNELRRPG-VDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HD FRWVGKKS PEKD W+GDW EVLSHHPELERFVKRC+DDLNPLKTLNLFKQ++PEDC
Sbjct: 180  HDNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLG++STVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPGASSGGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNR+KLQ+L
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANYLLK NE+ARRNLRYGDR+KLAKNLQ+GD+VERHLEDGDVVLFNRQPS
Sbjct: 420  IINGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT TQLLSMM D NLQFDIPPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P+YLWTGKQLFSLLIKPN  SPVVINLDAKNKVYIPPK+K+ PNEMSRNDG+VIIRGS I
Sbjct: 600  PHYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRM+KLCARFLGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKEELVEIAYAKCD+LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  ADDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDPMEMEG+A+PVNFNRSWDHA NITF+ ++ GLLPYQ+
Sbjct: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+ TN +L PLE+RL+RYDNLG  V  ED  K EY DQFDAERDFYK+LR Y+  K+  L
Sbjct: 960  METTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
              VRKSR                +PDE+  +  R SVDQL KITE  V KFLEIAL KYR
Sbjct: 1020 GSVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN NDERAARVVKGR+EKT+LSDVAYYIQDVYKDNLSF+Q+RIDLNTIEKLQLE
Sbjct: 1140 IINAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVALT+APKLKI  SDV+I G DK+ +NVFPEG K+KSIST+AK+P+EN VFYR
Sbjct: 1200 LTIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP IVVKGLPEIARAVINIRDDGKRELLVEGYGLR+VMCTDGVIG KT TNH+
Sbjct: 1260 MQHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHI 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV++VLGIEAARSSI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I  E
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKE 1439

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
             LKPKPTLFE+L+S+ S IK+N
Sbjct: 1440 SLKPKPTLFENLTSSRS-IKMN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2659 bits (6891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1272/1462 (87%), Positives = 1372/1462 (93%), Gaps = 2/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PK+ISG+EFSALSA+DIVAQSE+E+SSRDLFDLE+ R+ K  GALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSL CETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK CS++LL+D+DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++L ELR  G +DNL++MGILKKV+DQCKKQRRCL CGALNGVVKKAAAG+G ASLKII
Sbjct: 121  RQFLTELRRPG-VDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+GDW EVLSHHPELERF+KRC+DDLNPLKTLNLFKQ++PEDC
Sbjct: 180  HDTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPGASSGGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN++KLQ+L
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANYLLKKNE+ARRNLRYGDR+KLAKNLQ+GD+VERHLEDGDVVLFNRQPS
Sbjct: 420  IINGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT TQLLSMMS+G L+FDIPPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYY+WTGKQ+FSLLI+PN +SPVVINLDAKNKV++PPK K  PNEMSRNDG+V+IRGSNI
Sbjct: 600  PYYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCAR+LGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKEELVEIAYAKCD+LID ++KGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  ADDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDPMEMEG+A+PVNFNRSWDHA+NITF+N E+GLLPY++
Sbjct: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+KTNE+L PLEERL+RYDN+G  V K+D +K EY DQFDAERDFY++LR YIQ K+D L
Sbjct: 960  MEKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADIL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A VRKSR                 PDER T+  + SVDQL KITEK+V  FLEIAL KYR
Sbjct: 1020 ARVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN NDERAARVVKGR+EKT+LSD+AYYIQDVYKDNLSF+Q+R+DL TIEKLQLE
Sbjct: 1140 IINAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+TKAPKLKIQ SDV+I G DK+ +NV+P+G K+KSIST AK+PS N VFYR
Sbjct: 1200 LTIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRR LP IVVKG  +I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIG KT TNH+
Sbjct: 1260 MQHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHI 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV++VLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1320 LEVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I   
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEA 1439

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DLKPKPTLFE LS+  ++ KLN
Sbjct: 1440 DLKPKPTLFEKLSNCGTH-KLN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2635 bits (6831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1257/1457 (86%), Positives = 1363/1457 (93%), Gaps = 1/1457 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  K NGALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSL C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS++LLS+ DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +L ELR  G +DNL++MGILKK++DQCKKQRRCLHCGALNGVVKKAAAG+G+A+LKII
Sbjct: 121  RHFLQELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANYLLK+NE+ARRNLRYGDRLKLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMMSDG  QFDIPPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYYLWTGKQ+FSLLIKPNH SPVVINLDAKNKV++PPKSKSLPNEMS+NDGFVIIRGS I
Sbjct: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKEELVEIAY+KCD+LI  +NKG+LETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  ADDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN + GLLPY +
Sbjct: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+ TNE+L PLEERLVRYDN G  V +E+L+K EY DQ+DAERDFY++L+ YI  K+  L
Sbjct: 960  MQTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATAL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A++RKSR                 PD+   D  ++SV QL +I+EK+V KFLEIAL KYR
Sbjct: 1020 ANLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+NDERAARVVKGRVEKT+LSDVAYY+QDVYKDNLSF+Q+RIDL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+T+A KLKIQASDV+I G D++ +NVFPEG K++SISTSAK+PSENDVFYR
Sbjct: 1200 LTIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+T TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I   
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISER 1439

Query: 1441 DLKPKPTLFESLSSASS 1457
            DL PKP LFESLS+ ++
Sbjct: 1440 DLVPKPCLFESLSNEAA 1456

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2633 bits (6826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1257/1457 (86%), Positives = 1362/1457 (93%), Gaps = 1/1457 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  K NGALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSL C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS++LLS+ DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++LHELR  G +DNL++MGILKK++DQCKKQRRCLHCGALNGVVKKAAAG+G+A+LKII
Sbjct: 121  RQFLHELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANYLLK+NE+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMMSDG   FDIPPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYYLWTGKQ+FSLLIKPNH SPVVINLDAKNKV++PPKSKSLPNEMS+NDGFVIIRGS I
Sbjct: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKEELVEIAY KCD+LI  +NKG+LETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  ADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN ++GLLPY +
Sbjct: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+  NE+L PLEERLVRYDN G  V +EDL+K EY DQ+DAERDFY +LR YI  K+  L
Sbjct: 960  METANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATAL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A++RKSR                 PDE   D  ++SV QL +I+EK+V KFLEIAL KYR
Sbjct: 1020 ANLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+NDERAARVVKGRVEKT+LSDVA+Y+QDVYKDNLSF+Q+RIDL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+T+A KLKIQASDV+I G D++ +NVFPEG K+KSISTSAK+PSENDVFYR
Sbjct: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+T TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I  +
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439

Query: 1441 DLKPKPTLFESLSSASS 1457
            DL PK  LFESLS+ ++
Sbjct: 1440 DLVPKRCLFESLSNEAA 1456

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2633 bits (6824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1255/1457 (86%), Positives = 1362/1457 (93%), Gaps = 1/1457 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  K NGALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS+L C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS+VLLS+ DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +LHELR  G +DNL++MGILKK++DQCKKQRRCLHCGALNGVVKKAAAG+G+A+LKII
Sbjct: 121  RHFLHELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQEL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANYLLK+NE+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMMSDG  QFD+PPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYYLWTGKQ+FSLLIKPNH SPVVINLDAKNKV++PPKSKSLP+EMS+NDGFVIIRGS I
Sbjct: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKEELVEIAY KCD+LI  +NKG+LETQPGCNEE+TLEAKIGG LSKVREEVGD
Sbjct: 720  ADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN + GLLPY +
Sbjct: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            MK  NE+L PLEERLVRYDN G+ V +ED D+ EY DQ+DAERDFY++LR YI  K+  L
Sbjct: 960  MKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATAL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A++RKSR                  DE   D  R+SV QL +I+EK+V KFLEIAL KYR
Sbjct: 1020 ANLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK+ISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+NDERAARVVKGRVEKT+LSDVAYY+QDVYKDNLSF+Q+RIDL+TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIA+A+T+A KLKIQASDV+I G D++ +NVFPEG K+KSISTSAK+PSENDVFYR
Sbjct: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALP +VVKGLP+I+RAVINIRDD KRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I  +
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439

Query: 1441 DLKPKPTLFESLSSASS 1457
            DL PKP LFESLS+ ++
Sbjct: 1440 DLVPKPCLFESLSNEAA 1456

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2625 bits (6805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1249/1462 (85%), Positives = 1359/1462 (92%), Gaps = 2/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+S  PK+ISG+EFSALSA+DIVAQSEVEIS+RDLFDLE  R  +  GALDP+MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSL C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICKNCS+VLL D D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +L ELR  G +DNL++MGIL KV+DQCKKQRRCL CGALNGVVKKAAAGSG+ASLKII
Sbjct: 121  RHFLSELRRPG-VDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRW GKKS PEKD W+GDW+EVLSH+PELER+VKRC DDLNPLKTLNLFKQ++PEDC
Sbjct: 180  HDTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            K+GLEKGISINNMMEHWDYLQL+VAMYIN+DSVNPAM+PGASSGGGKVKPIRGFCQRLKG
Sbjct: 300  KSGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR+KLQ+L
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANYLLKK+E+ARRNLRYGDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPS
Sbjct: 420  LINGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDR + TQLLSMMSDGNLQFDIP PAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P YLWTGKQ+FSLLIKPN KSPVVINLDAKNKV+IPPKSKSLP+EMS+NDG+VIIRGS I
Sbjct: 600  PCYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKE++VE AYAKCD+LIDSYNKGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  ADDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDPMEMEG+AQPVNF RSW+HA N+TFNN ERGL PYQ+
Sbjct: 900  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
             ++T+++L PL  RL+RYDN+G  V KE    +EY DQ DAER+FY +L+S+++ K++ L
Sbjct: 960  EEETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A VRK R                  DE   +  R SVDQLC+IT  +V +FL+IA+SKYR
Sbjct: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+NDERAARVVKGR+EKT+LSDVA+YIQDVY+DNLSF+Q+RIDLNTI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+T+APKLKIQASDV+I   DK+ +NVFPEG K+KSISTSAK+P ENDVF+R
Sbjct: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRR+LP IVVKGLP+I+RAVIN+RDD KRELLVEGYGLR+VM TDGV+G KT TNH+
Sbjct: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMK+D VEGVSECIILGQTMSIGTG+FKV+KGTD+  +
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DL+PKPTLFESLS  ++ IK N
Sbjct: 1440 DLRPKPTLFESLSKETA-IKAN 1460

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2622 bits (6796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1245/1462 (85%), Positives = 1351/1462 (92%), Gaps = 2/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PKKISG+EFSALSASDIVAQSEVE+S+RDLFDLE  R  K  GALDP+MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSS+ C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICKNCSS+LL+D D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +LHELR  G IDNLK+M I+KK++DQCKKQRRCL CGALNGVVK+AAAGSG+ASLKII
Sbjct: 121  RDFLHELRRPG-IDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS+PEKD W+GDW +VL+++PELERF KR  DDLNPLKTLNLFKQ+RPEDC
Sbjct: 180  HDTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQL+VAMYIN+DSVNP+M+PGASSGG K KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR+KLQ L
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQAL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPN+HPGANY+LK NEEARRNLRYGDRLK+AK L+ GDIVERHLEDGD+VLFNRQPS
Sbjct: 420  VINGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKN
Sbjct: 480  LHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKD+F DRATFTQLLSMMSD NLQFDIPPP I+K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PY LWTGKQLFSLLIKPN  SPVVINLDAKNKV+IPPKSKSLPNEMS+NDGFV+IRGS I
Sbjct: 600  PYCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
             + LK KKEELVEIAYAKCD+LID + KGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  DNALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            +CINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  ICINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP+EMEG+AQPVNF RSWDHA+NITF+N+ +GLLPY +
Sbjct: 900  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            + KTN++L P EERL+RYDN+G  V   D  K E+ DQ D+ER+FY +LR Y+Q K+  L
Sbjct: 960  INKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASIL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A +RK +                  DE  +  +R +V++LCKITEK V KFLEIA+SKYR
Sbjct: 1020 ASIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+ND+RAARVVKGR+EKT+LSDVAYY+QDVYKDNLSFL+++IDL+TI+KLQLE
Sbjct: 1140 IINAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVALT+APKLKIQ +DV I   DK+ ++V+PEGSK+KSISTS K+PSENDVFYR
Sbjct: 1200 LTIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP IVV GLP+IARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKT TNHV
Sbjct: 1260 MQTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHV 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTG+FK++K T+IKP+
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPD 1439

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DLKPK TLFE+L  A   +K+N
Sbjct: 1440 DLKPKRTLFENL-VAEPALKVN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2620 bits (6790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1248/1457 (85%), Positives = 1359/1457 (93%), Gaps = 1/1457 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  + NGALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSSL C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS++LLS+ DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +K+LHELR  G +DNL++MGILKK++DQCKKQRRCLHCGALNGVVKKAAAG+G+A+LKII
Sbjct: 121  RKFLHELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPN+HPGANYLLKKNE+ARRNLRYGDR+KLAK+LQ GD++ERHLEDGDVVLFNRQPS
Sbjct: 420  VVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLL MMSDG  QFD+PPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYYLWTGKQ+FSLLIKP+HKSPVVINLDAKNKV++PPKSKSLP+EMS+NDGFV+IRGS I
Sbjct: 600  PYYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKEELVEIAY KCD+LI S+NKG+LETQPGCNEE+TLEAKIGG LSKVREEVGD
Sbjct: 720  ADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITF+N + GLLPY +
Sbjct: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+  N++L PLE+RLVRYDN G  V  ED DK E+ DQ+DAERDFY++LR YI  K+  L
Sbjct: 960  METANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A++RKSR                 PDE      R+SV QL +I+E++V KFLEIAL KYR
Sbjct: 1020 ANLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+NDERAARVVKGRVEKT+LSDVAYY+QDVYKDNLSF+Q+RIDL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+T+A KLKIQA DV+I G DK+ +NVFPEG K+KSISTSAK+PSENDVFYR
Sbjct: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALP +VVKGL +I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKV+KGT++  +
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439

Query: 1441 DLKPKPTLFESLSSASS 1457
            DL PKP LFESLS+ ++
Sbjct: 1440 DLIPKPCLFESLSNEAA 1456

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2586 bits (6702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1227/1452 (84%), Positives = 1339/1452 (92%), Gaps = 3/1452 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+  APKKI G+EFSALSASDIVAQSEVEIS+RDLFDLE  R  K  GALD +MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS   C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CKNC+S+LLSD+DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++L ELR  G +DNL++MG LKK++DQCKKQRRCLHCG LNGVVKKAAAGSG+ASLKII
Sbjct: 121  RQFLAELRRPG-VDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEK+ W+GDW +VL H+PELER++KRC DDLNPLKTLNLFKQV+PEDC
Sbjct: 180  HDTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNPAM+PGAS  GGK KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKG 357

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQ+L
Sbjct: 358  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQL 417

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPNIHPGANYLLKKN++ARRNLRYGDR+KLAKNLQYGD+VERH+EDGDVVLFNRQPS
Sbjct: 418  VINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPS 477

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 478  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT TQLLSMMSDGN+QFD+PPPA+MK
Sbjct: 538  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMK 597

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P+YLWTGKQ+FSLLI+PN KSPV+IN+DAKNKV++PPK K LPNEMS NDGFV+IRGS I
Sbjct: 598  PHYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEI 657

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 717

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
              DLK KKE+ VE AYAKCD+LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 718  GADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 778  VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 838  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP++MEG+AQPVNFNRSWDHA NITF + + GLLPYQ+
Sbjct: 898  YDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQI 957

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            ++ TN +L PLE++LVR+DNLGN++ KED +K+EY DQ DAER+FY++LR Y+  K+ HL
Sbjct: 958  IENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHL 1017

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A +RK++                + DE+  +   ++V+QLCKI++  V  FL IA+SKY 
Sbjct: 1018 AKIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYH 1077

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+ DERAARVVKGR+EKT+LSDV YYIQDVYKDNLSF+Q ++DL TIEKLQLE
Sbjct: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLE 1197

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+T+A KLKI  +DVSI G +K+ +NVFPEG K+KSISTSAK+PSEN VFYR
Sbjct: 1198 LTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYR 1257

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP IVVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+
Sbjct: 1258 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LE+ +VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT I  E
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437

Query: 1441 DLKPKPTLFESL 1452
            DLKPK TLFESL
Sbjct: 1438 DLKPKHTLFESL 1449

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2569 bits (6658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1462 (83%), Positives = 1338/1462 (91%), Gaps = 2/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+  APK+I G+EFSALSASDIVAQS+VEIS+RDLFDLE  RK K  GALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS   C TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ+ICK C+++LLS+EDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
             ++L ELR  G IDNL++MGILKKV+DQCKKQRRCL CG+LNGVVKKAAAGSG+ASLKI+
Sbjct: 121  HQFLSELRRPG-IDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKIL 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+GDW  VL+H+PELER+VK+C DDLNPLKTLNLFKQV PEDC
Sbjct: 180  HDTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNPAM+PG S+GG K KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKG 358

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN++KLQ+L
Sbjct: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQL 418

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPN HPGANYLLKK+EEARRNLRYGDR+KLA+NLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 419  VINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPS 478

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 479  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFF RA F QLLSMMSDGNLQFDIPPP+IMK
Sbjct: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMK 598

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYY+WTGKQ+FSLLI+PN +SPVVINLDAKNKVYIPPK KSLPNEMS NDG+V+IRGS I
Sbjct: 599  PYYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKI 658

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTP 718

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
              +LK KKE +VE AYAKCD LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 719  GFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 778

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 779  VCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNS 838

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 839  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNT+RTSSNGIVQFTYGGDGLDP++MEG+AQPVNF+RSW+HA N+TFN+ ++ LLPYQ+
Sbjct: 899  YDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQI 958

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M++TN VL PLEE+LVRYDNLGNE+     D++EY DQ DAER+FYK+LR Y+  K+ HL
Sbjct: 959  MQQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHL 1018

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A++R  +                  DE A   + +SVDQLCKI+ K VLKFLEIA+ KY 
Sbjct: 1019 ANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYH 1078

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KA+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVNNNDERAARVVKGR+EKT+LSDVA+YIQDVYKDN+SFLQ+++DL TIEKLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLE 1198

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LT+EDIAVA+T+A KLKI ASDVSI G DKV +NV+PE +K KSISTSAK+P EN++FYR
Sbjct: 1199 LTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYR 1258

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP IVVKGLP+IARAVINI+DDG RELLVEGYGLREVM TDGVIG KT TNH+
Sbjct: 1259 MQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHI 1318

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1319 LEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKM 1378

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTG+FKVVKGTDI   
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISES 1438

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DL PKPTLFESL  + + +K+N
Sbjct: 1439 DLAPKPTLFESLCDSVTALKVN 1460

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2566 bits (6651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1227/1462 (83%), Positives = 1347/1462 (92%), Gaps = 4/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV SEAPKKISG+EFSALSA+DIVAQSEVEIS+RDLFDLE  R  K  GALDP+MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSS+ C+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ ICK CSS+LL D DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            K +L ELR  G +DNL++MGILKKV+DQCKKQRRCL CGALNGVVKKAAAG G+ASLKII
Sbjct: 121  KHFLSELRRPG-VDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRW GKKS PEK+ WIGDW+ VL+H PELER+VKRC DDLNPLKTLNLFKQV+PEDC
Sbjct: 180  HDTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTE+VWTSSLI
Sbjct: 240  ELLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQL VAMYIN+DSVNPA+L G +  GGKVKPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKG 357

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L
Sbjct: 358  KQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQL 417

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPN +PGANYLLKK+E+ARRNLR+GDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPS
Sbjct: 418  VVNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPS 477

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+
Sbjct: 478  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKS 537

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD+   TQLLSMMSDG LQFDIPPP I K
Sbjct: 538  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWK 597

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P YLWTGKQ+FSLLI+PN KSPVV+NLDAKNKVYIPPKSKSLPNEMS+NDGFV+IRGS I
Sbjct: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRM+KLCAR++GNRGFSIGISDVTP
Sbjct: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            A++LK KKEE+VE AYAKCD+LID ++KGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 718  AEELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNS
Sbjct: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 
Sbjct: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP+EMEG+AQPVNFNR+WDHA N+TFNN +RGLLPYQ+
Sbjct: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQI 957

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+ T E+L PLE RLVRYDNLGNE+ KE+ D++EY DQ DAER FY +LR +I +K+  L
Sbjct: 958  MQVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLL 1017

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A  R S+                  DE   +  R SVDQ+ +IT+K V +FL +A+ KYR
Sbjct: 1018 AKFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYR 1077

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN +DERAARVVKGR+EKT+LSDVA+YIQDVY+DNLS+LQ+R+DL+TI+KLQLE
Sbjct: 1138 IINAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLE 1197

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIAVA+T+APKLKIQASDV I G DK+ +NVFP+G+K+KSIST AK+PSEN+VFYR
Sbjct: 1198 LTIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYR 1257

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALP IVVKGL +I+RAVINIRDDGKRELLVEGYGLR+VM TDGV+G KTVTNH+
Sbjct: 1258 MQQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHI 1317

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1318 LEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1377

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTM+IGTG+FKVVKGT++  E
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEE 1437

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
             LKPKPTLFESL + +S +K+N
Sbjct: 1438 QLKPKPTLFESLVNETS-VKVN 1458

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2562 bits (6641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1237/1459 (84%), Positives = 1343/1459 (92%), Gaps = 4/1459 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVVI E PK+ISG+EFSALS +DIVAQSE+EISSRDLFDLE NR  KE GALDPRMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            S+SS+ C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK CS++LLS++DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +L ELR  G +DNL++M +LKKV+DQCKKQRRCLHCGALNGVVKKAAAG+GTASLKII
Sbjct: 121  RHFLSELRRPG-VDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKSTPEKD WIGDW EVLSH+PELER+VKR TDDLNPLKTLNLFKQ+  EDC
Sbjct: 180  HDTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAG+EKGISINNMMEHWDYLQ+TVAMYIN+DS+NPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 300  KAGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN KKL++L
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V NGPN+HPGANYLLKKNEEARRNLRYGDR KLA NLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 420  VQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+ TQLLSMMSDG+LQFDIPPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P YLWTGKQ+FSLLIKPN  SPV INLDAKNKVYIPPK K  PNEMS+NDGFVI+RGS I
Sbjct: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            ADDLK KKE+LVEIAYAKCD+LID YNKGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  ADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN +RGLLPY++
Sbjct: 900  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKL-EYADQFDAERDFYKTLRSYIQSKSDH 1019
             K  + +L PLE+RL+RYD LG  V  ED DKL +Y DQ D+ER FY +LR ++  K+  
Sbjct: 960  KKTVDNILKPLEKRLIRYDTLGRPVSAED-DKLDDYVDQHDSERLFYASLREFMTDKAKK 1018

Query: 1020 LAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKY 1079
            LA +RKSR                  +E    + + S+ QL +ITE AV KFLEIA+SKY
Sbjct: 1019 LAKLRKSRGLPKLIKKSELEGYDPE-NEHIDAIVQHSITQLYRITEDAVQKFLEIAISKY 1077

Query: 1080 RKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTIST 1139
             +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK IST
Sbjct: 1078 HRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIST 1137

Query: 1140 PIINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQL 1199
            PIINAVLVNNNDERAARVVKGR+EKT+LSDV YYIQDVYK+N+++LQ+++DLNTI+KLQL
Sbjct: 1138 PIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQL 1197

Query: 1200 ELTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFY 1259
            ELTIEDIA+A+T+APKLKIQ SDV++ G DK+ +NV PEG  SK+ STS K+P+ENDVFY
Sbjct: 1198 ELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFY 1257

Query: 1260 RMQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNH 1319
            RMQ LRRALP I+VKGL +IARAVINIRDDGKRELLVEGYGLR+VMCTDGVIG+KT TNH
Sbjct: 1258 RMQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNH 1317

Query: 1320 VLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSK 1379
            VLE+ +VLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSK
Sbjct: 1318 VLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK 1377

Query: 1380 MRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKP 1439
            MRDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVK TDI  
Sbjct: 1378 MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAE 1437

Query: 1440 EDLKPKPTLFESLSSASSN 1458
            ++LKPK TLFESL+S  +N
Sbjct: 1438 DELKPKRTLFESLTSNVAN 1456

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2556 bits (6624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1227/1462 (83%), Positives = 1333/1462 (91%), Gaps = 4/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV SE PKKISG+EFSALSA+DIVAQSEV I++RDL+DLE  R  K++GALD RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS+L CETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICK+C++VLLSDEDK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +L ELR  G IDNLK+MGILKK++DQCKKQRRCLHCG LNGVVKKAAAG G+ASLKII
Sbjct: 121  RNFLSELRRPG-IDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKK TPEKD+W+GDW EVLSH+PELERFVKR  DDLNPLKTLNLFKQ++PEDC
Sbjct: 180  HDTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTE+VWTSSLI
Sbjct: 240  ELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQL+VAMYIN+DSVNP ++PGAS+G  KVKPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKG 358

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYN++KLQ L
Sbjct: 359  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQAL 418

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPN+HPGANYLLKK+EEARRNLRYGD++KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 419  VLNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPS 478

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 479  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMM DGNLQFDIPPPAIMK
Sbjct: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMK 598

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P YLWTGKQLFSLLIKPN  SPVVIN+DAKNKV+ PPK KSLP+EMS NDGFV+IRGS I
Sbjct: 599  PCYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQI 658

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 659  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTP 718

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
             D LK  KE LVEIAYAKCD+LI  YN+GKLETQPGCNEE+TLEAKI G+LSKVREEVGD
Sbjct: 719  DDKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGD 778

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            +CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 779  ICINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNS 838

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSF+SGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 839  KTPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP +MEG+AQPVNFNRSWDHA NI F+NN++ + PYQ+
Sbjct: 899  YDNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQI 958

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            ++ TN++L+PLEE+L+RYDN+G  V  E+  K E+ DQ DAER+FY +LR Y+  K++ L
Sbjct: 959  LEITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANEL 1018

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A VRKSR                  DE+  D  R SV+Q+C+ITE  V +FL+IA++KYR
Sbjct: 1019 ADVRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYR 1078

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1079 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN NDERAARVVKGR+EKT+LSDVAYYIQD YKDN S+L+++IDL TIEKLQLE
Sbjct: 1139 IINAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLE 1198

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LT+ DIA A+ +APKLKIQ  DV    + K+ ++V PE S SK IS SAK+P EN+VFYR
Sbjct: 1199 LTMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYR 1257

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP IVVKGLP+IARAVINIRD+GKRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1258 MQHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1317

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV+SVLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1318 LEVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVK T I+  
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNG 1437

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
             LKPK TLFESL    +NIK+N
Sbjct: 1438 TLKPKRTLFESLCK-ETNIKIN 1458

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2556 bits (6624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1230/1462 (84%), Positives = 1339/1462 (91%), Gaps = 7/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+ E  KKISGIEFSAL+A+DIVAQSEVEI++RDLFDLE+ R+QK  GALD RMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSSS  C TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+CS+VLLSD+D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +L ELR  G IDNL+KM ILKKV+DQCKKQRRCL CG LNGVVKKAAAG+GTASLKII
Sbjct: 121  RDFLKELRRPG-IDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKK  PEKD WIG+WNE+L+HHPELERFVKRC+DDLNPLKTL LFKQ++ EDC
Sbjct: 180  HDTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGL KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPGASSGGGKVKPIRGFCQRLKG
Sbjct: 300  KAGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKG 359

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN++KLQ+L
Sbjct: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQL 419

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGP +HPGANYLLKKNEEARRNLRYGD+LKLAKNLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 420  IINGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPS 479

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD  + TQLLSMMSD  LQFDIPPPAIMK
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMK 599

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYYLWTGKQ+FSLLI+PN KSPVVINLDAKNKVYIPPK KS PNEMS NDGFVIIRGS I
Sbjct: 600  PYYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEI 659

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            + DL+ KKEE+V  AYAKCD+LID +  GKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 720  SSDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNS 839

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YD+TVRTS+NGIVQFTYGGDGLDP++MEG+A+PVNF RSWDHA NITFN NE GLLPY++
Sbjct: 900  YDDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEI 959

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            +++T+ VL PLEE+L+RYDNLG  V KE +D   YAD+ DAER FYK+LR Y+Q K+  L
Sbjct: 960  VRETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARL 1019

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A +R +R                   E  +   ++SVDQ+ KIT+K V  FL IAL KY 
Sbjct: 1020 AQIRNTRGLLEMTQNGGDTSM-----EVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN  DERAARVVKGR+EKT+LSD+A+YIQDVY+ N+S+L+IR+DL TIEKLQLE
Sbjct: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LT+EDIAVAL++APKLKIQ +D+ I G DK+ VNV+PEG K+KSISTSAK+PSEN+VFY+
Sbjct: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRR+LP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKT+TNHV
Sbjct: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV+SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMS+GTGSFKVVK  D+   
Sbjct: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DLK +PTLFESL+S ++ IK N
Sbjct: 1435 DLKVRPTLFESLASETA-IKAN 1455

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2508 bits (6501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1462 (82%), Positives = 1327/1462 (90%), Gaps = 3/1462 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+   PK+ISG+EFSALSASDIVAQSEVEI +RDLFDLE  R  K+ GALD RMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS   C TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ+ICKNC+ +LL++EDK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++L ELR  G IDNL++M  LKKV+DQCKKQRRCLHCG LNGVVKKAAAGSG+A+LKII
Sbjct: 121  RQFLSELRRPG-IDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD WIGDWN+VL H PELER++KR  ++LNPLKTLNLFKQ+ P+DC
Sbjct: 180  HDTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMME WDYLQ+ VAMYIN+DSVNPA++PG + GGGK KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKG 358

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+L
Sbjct: 359  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQL 418

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NG N+HPGANYLLKKNEEARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 419  IVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPS 478

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 479  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATF Q+LSMMSDGNLQFDIPPPAIM+
Sbjct: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMR 598

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P+YLWTGKQLFSLLIKPN KSPV+INLDAKNKVYI PK+K+ PNEMS NDG+V+IRGSNI
Sbjct: 599  PHYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNI 658

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTP 718

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
              +LK  KEE+VEIAYAKCD+LID Y +GKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 719  GVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 778

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 779  VCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 838

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 839  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP+ MEG+A+PVNFNRSWDHA NIT+N++++G+LPYQ+
Sbjct: 899  YDNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQI 958

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            +++TN +L+PLE++L RYDN+GN +     ++  Y DQ DAER+FY++LR+Y+  K+  L
Sbjct: 959  LEETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKL 1018

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A + KSR                  D    +V   SV+QLCKI+ K V  FL+IA+SKYR
Sbjct: 1019 ADITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYR 1078

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KA+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINA LVN++DERAARVVKGRVEKT+LSDV +YIQDVY+DN+SFLQ+++DL TIEKLQLE
Sbjct: 1139 IINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLE 1198

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LT+EDIA+A+T APKLKI   DVSI G +K+ +NV  +  K+KSIST A +P ENDVF++
Sbjct: 1199 LTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFK 1258

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP IVVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT TNH 
Sbjct: 1259 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV  VLGIEAAR+SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTM+IGTGSFKVVKGT+I P+
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPD 1438

Query: 1441 DLKPKPTLFESLSSASSNIKLN 1462
            DLKPKPTLFE+L S ++ +K+N
Sbjct: 1439 DLKPKPTLFENLCSLNT-LKVN 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2503 bits (6488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1195/1463 (81%), Positives = 1324/1463 (90%), Gaps = 5/1463 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVVISE PK+ISG+EFSALS SDI+AQSEVEIS+RDLFDLE  R   E GALDP+MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS+L C TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQILQ +CK+CS++LL+D DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            + +LHELR    IDNLK+M ILKK++DQCKKQRRCL CG LNGVVK+AA GSG+ASLKII
Sbjct: 121  RHFLHELRKPD-IDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKK+ PEKD WIGDWN+VL+++PELE+F+KRCTDDLNPLKTLNLFKQ++ EDC
Sbjct: 180  HDTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTV SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMMEHWDYLQL+VAMYIN+DSVN  ++PG S+GG K KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPG-SNGGTKAKPIRGFCQRLKG 358

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLTYPEKVTRYN+ KLQ+L
Sbjct: 359  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKL 418

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            VMNGPN+HPGANYLLK NEEARRNLRYG+R KLAK L+ GDIVERHLEDGD+VLFNRQPS
Sbjct: 419  VMNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPS 478

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVK 539
            LHRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVK
Sbjct: 479  LHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVK 538

Query: 540  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIM 599
            NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT TQLLSMMSD NL+FDIPPPAI 
Sbjct: 539  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIF 598

Query: 600  KPYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSN 659
            KP  LWTGKQ+FSLLIKPN +SPVVINLDAKNKVYIPP++KS P+EMS NDG+VIIRGS 
Sbjct: 599  KPQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSE 658

Query: 660  ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVT 719
            ILSGVMDKSVLGDGKKHSVFYTILRDYGPQE+ANAMNRM+KLCAR+LGNRGFSIGISDVT
Sbjct: 659  ILSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVT 718

Query: 720  PADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVG 779
            P ++LK+KKE+LVEIAY KCD+LI  YNKG+LETQPGCNEE+TLEAKIGGLLSKVREEVG
Sbjct: 719  PGEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVG 778

Query: 780  DVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 839
            DVCINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KN
Sbjct: 779  DVCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKN 838

Query: 840  SKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 899
            SKTPQSKGFVRNSFF+GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC
Sbjct: 839  SKTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898

Query: 900  QYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQ 959
            QYDNT+RTSSNGIVQFTYGGDGLDP++MEG+A+PVNF R+WDHA NITF+ N +GLLPYQ
Sbjct: 899  QYDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQ 958

Query: 960  VMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDH 1019
            ++K+TN +L PLE  LVRY+N+G  + K+D  K EY DQ DA+RDFY ++R Y+  K++ 
Sbjct: 959  IIKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQ 1018

Query: 1020 LAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKY 1079
            LA +RK+R                  DE      R  VD+LCKI+E  V KFLEIA+SKY
Sbjct: 1019 LAKIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKY 1078

Query: 1080 RKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTIST 1139
             +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTIST
Sbjct: 1079 HRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTIST 1138

Query: 1140 PIINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQL 1199
            PII AVLVN++D RAARVVKGR+EKT+LSDVAYYI+DVY+DN +F++I+IDL+TIEKLQL
Sbjct: 1139 PIIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQL 1198

Query: 1200 ELTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFY 1259
            ELTIEDIA+A++KAPKLKI +S++ I G+DK+ ++VF E   SKSISTS K+ SEN VFY
Sbjct: 1199 ELTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFY 1256

Query: 1260 RMQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNH 1319
            +MQ LRRALP +VVKGL +I+RAVINI+DD K ELLVEGYGLR+VMCTDGVIG+KT TNH
Sbjct: 1257 KMQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNH 1316

Query: 1320 VLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSK 1379
            +LE+ +VLGIEAARSSI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSK
Sbjct: 1317 ILEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK 1376

Query: 1380 MRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKP 1439
            MRDSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTGSF VVK T + P
Sbjct: 1377 MRDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSP 1436

Query: 1440 EDLKPKPTLFESLSSASSNIKLN 1462
            E +KPK TLFESL S++ + KLN
Sbjct: 1437 EQVKPKRTLFESLVSSNDHNKLN 1459

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2490 bits (6453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1452 (82%), Positives = 1305/1452 (89%), Gaps = 3/1452 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKE VI  APKKI GI FSALSA+DIV+QSEVEIS+RDLFDL+  R  KE GALDPRMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS   C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ++CK C ++LLS+EDK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +K+L ELR  G +DNL++M ILKK++DQCKKQRRC  CG LNGVVKKAAAGSG+A+LKII
Sbjct: 121  RKFLTELRRPG-MDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEK+ WIGDW +VL ++PELER+VKRC DDLNPLK LNLFKQ++P DC
Sbjct: 180  HDTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNP+MLPG+S  G K KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKG 357

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQ+L
Sbjct: 358  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQL 417

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGP +HPGANYLLKKNE+ARRNLRYGDR+KLAK LQYGD+VERH+EDGDVVLFNRQPS
Sbjct: 418  VINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPS 477

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 478  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRA  TQLLSMMSD NLQFDIPPP+IMK
Sbjct: 538  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMK 597

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P+YLWTGKQ+FSLLIKP+ KSPVVINLDAKNKVY+PP  K  PNEMS+NDGFV+IRGSNI
Sbjct: 598  PHYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNI 657

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRM+KLCAR+LGNRGFSIGI+DVTP
Sbjct: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTP 717

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
              DLK KKE++VE AYAKCD+LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 718  GSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 778  VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 838  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNGIVQFTYGGDGLDP++MEG+AQPVNFNRSW HA N+T N+N  GLLPYQ+
Sbjct: 898  YDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQI 957

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            + +TN +L PLE +L RYDN+G E+ KED  K EY DQFDAER FY++LR ++  K+  L
Sbjct: 958  IAETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTL 1017

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A +R  R                + DE        +++QLCKI++  V KFL IA+SKY 
Sbjct: 1018 ASLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYH 1077

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            +ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1078 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINAVLVN+NDERAARVVKGRVEKT+LSDV++Y+QD+Y+DN++FLQI+ID  TIEKLQLE
Sbjct: 1138 IINAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLE 1197

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LT+EDI VA+ KAPKLKI  +D+SI G DK+ + V  +G   KSIST+ K+P  N+VFYR
Sbjct: 1198 LTLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYR 1257

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQQLRRALPHIVVKG  +I+RAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+
Sbjct: 1258 MQQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV  VLGIEAARS II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KM
Sbjct: 1318 LEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKM 1377

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMK D VEGVSECIILGQTMSIGTGSFKVVK T +   
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEN 1437

Query: 1441 DLKPKPTLFESL 1452
            DL PKPTLFE+L
Sbjct: 1438 DLTPKPTLFETL 1449

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2484 bits (6438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1178/1457 (80%), Positives = 1315/1457 (90%), Gaps = 2/1457 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+  APKKI G+ FSALSASDIVAQSEVEI +RDLFDLE  R  K+ GALD +MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS   C TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ+ICKNC+++LLS+E+K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++L ELR  G IDNL++M  L+KV+DQCKKQRRCLHCGALNGVVKKAA GSG+A+LKII
Sbjct: 121  RQFLAELRRPG-IDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKII 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEK+ WIGDWN+VL H+PELER++KR  D+LNPLKTLNLFKQVR +DC
Sbjct: 180  HDTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            ELLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMME WDYLQ+ VAMYIN+DSVNPA++PG + GG     IRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKG 358

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L
Sbjct: 359  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQL 418

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            ++NGPN+HPGANY+LKKNE+ARRNLRYGDR+KLAKN+Q GD+VERH+EDGDVVLFNRQPS
Sbjct: 419  IINGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPS 478

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 479  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPII+ATQDFITGSYLISHKDSFFDRATFTQLLSMM+D N+QFD+PPPAI+K
Sbjct: 539  NLLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIK 598

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            P YLWTGKQ+FSLLI+PN KSPV+INLDAKNKVY+PPK+KS PNEMS NDG+VIIRGS I
Sbjct: 599  PCYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEI 658

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            L GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRM+KLCAR+LGNRGFSIGI+DVTP
Sbjct: 659  LCGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTP 718

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
              +LK KKEE+VEIAYAKCD+LID + +G+LETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 719  GKELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGE 778

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 779  VCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNS 838

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVR+SFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 839  KTPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNTVRTSSNG+VQFTYGGDGLDP+ MEG+AQPVNFNRSWDHA NITFNN E GLLPYQ+
Sbjct: 899  YDNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQI 958

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M+ +N +L PLE +L+R DN+GN +  +     EY DQ DAERDFY++LR+Y+ +K+  L
Sbjct: 959  METSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRL 1018

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A +RKS+                  D  A+    +S++QLCKI+   V  FL IA+SKY 
Sbjct: 1019 AQIRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYH 1078

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KA+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASK ISTP
Sbjct: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTP 1138

Query: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200
            IINA+LVN+NDERAARVVKGR+EKT+LSDV +YIQDVY+DN+SF+Q+++DL+TIEKLQLE
Sbjct: 1139 IINALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLE 1198

Query: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260
            LTIEDIA+A+++APKLKI   DVSI G +K+ ++V  +  K KSIST   +P+ENDVFYR
Sbjct: 1199 LTIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYR 1258

Query: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320
            MQ LRRALP+IVVKGLP+I+RAVINI +DGKRELLVEGYGLR+VM TDGVIG KT TNH 
Sbjct: 1259 MQHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHF 1318

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            LEV  VLGIEAAR+SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1319 LEVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVV+GT+I  +
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMD 1438

Query: 1441 DLKPKPTLFESLSSASS 1457
            +LKP PTLFE+L + ++
Sbjct: 1439 ELKPNPTLFENLCNNTA 1455

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2014 bits (5219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/1146 (83%), Positives = 1040/1146 (90%), Gaps = 2/1146 (0%)

Query: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60
            MKEVV+  APK+I G+EFSALSASDIV QS+VEIS+RDLFDLE  RK K  GALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120
            SSS   C TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ+ICK+C+++LLS+EDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180
            +++L ELR  G IDNL++MGILKKV+DQCKKQRRCL CG+LNGVVKKAAAGSG+ASLKI+
Sbjct: 121  RQFLSELRRPG-IDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKIL 179

Query: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            HDTFRWVGKKS PEKD W+GDW  VLSH+PELER+VK+C DDLNPLKTLNLFKQV PEDC
Sbjct: 180  HDTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDC 239

Query: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
            EL+GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 240  ELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299

Query: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNPAM+PG S+GG K KPIRGFCQRLKG
Sbjct: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKG 358

Query: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
            KQGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L
Sbjct: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQL 418

Query: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
            V+NGPN HPGANYLLKK+EEARRNLRYGDR+KLAKNLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 419  VINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPS 478

Query: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
            LHRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 479  LHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538

Query: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA F QLLSMMSDGN+QFDIPPPAIMK
Sbjct: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMK 598

Query: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
            PYY+WTGKQ+FSLLI+PN KS VVINLDAKNKVYIPPK K LPNEMS NDGFV+IRGS I
Sbjct: 599  PYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQI 658

Query: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
            LSGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRM+KLCAR+LGNRGFSIGI+DVTP
Sbjct: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTP 718

Query: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
              +LK KKE +VE AYAKCDDLID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 719  GFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 778

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            VCI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 779  VCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNS 838

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 839  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960
            YDNT+RTSSNGIVQFTYGGDGLDP++MEG+AQPVNF RSWDHA NITFN++++ LLPYQ+
Sbjct: 899  YDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQI 958

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020
            M++TN +L PLEE+LVRYDNLG  +     D+ E+ DQ DAER+FYK+LR Y+ +K+ HL
Sbjct: 959  MQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHL 1018

Query: 1021 AHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080
            A +R  +                  DE +     +SVDQLCKI+ K V KFLEIA+ KY 
Sbjct: 1019 AKIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYH 1078

Query: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140
            KA+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1141 IINAVL 1146
            IINAVL
Sbjct: 1139 IINAVL 1144

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1498 (34%), Positives = 769/1498 (51%), Gaps = 132/1498 (8%)

Query: 7    SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
            S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
             C+TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNEL---- 121

Query: 126  ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
             +R +  I + KK      +   CK +  C     + +   +  +  G G     +  D 
Sbjct: 122  -MRQALAIKDSKKR--FAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDG 178

Query: 184  FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
             + VG   + +KD   GD  E     PEL          L+  + LN+FK +  +D   L
Sbjct: 179  LKLVG---SWKKDRASGDAEE-----PELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 244  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304  LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
               G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424  GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
            GPN HPGA Y+++ + + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
            +P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PAI+KP  
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 604  LWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNILSG 663
            LW+GKQ+ S+ I PN    + +    +    + PK          ++G +II G  I+ G
Sbjct: 571  LWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIFG 615

Query: 664  VMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPADD 723
            V++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D T AD 
Sbjct: 616  VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGD-TIADG 673

Query: 724  LKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGDVC 782
              +++  E +  A  K  D+        L  + G    E+ E  +   L++ R++ G + 
Sbjct: 674  PTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 783  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 842
               L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734  EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 843  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 902
            P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 903  NTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERGLLPYQV 960
            NT R S   ++QF YG DG+D   +E  +       + +++    I   N E  L P  +
Sbjct: 854  NTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLLNTEHILDP-SL 912

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQS--KSD 1018
            ++  +E+L  L+ +++  +     V      +  + D  +A       +R  IQ+  ++ 
Sbjct: 913  LESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDG-EANWPLPVNIRRIIQNAQQTF 971

Query: 1019 HLAHVRKSRXXXX-----XXXXXXXXXXXXHPDERATDVSRSSVDQLC------------ 1061
            H+ H + S                        +E   +  R +V   C            
Sbjct: 972  HIDHTKPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRV 1031

Query: 1062 ----KITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVAS 1117
                ++T++A    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS
Sbjct: 1032 LQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVAS 1091

Query: 1118 MNVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA---- 1171
              VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V     
Sbjct: 1092 KKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASE 1151

Query: 1172 -YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLEL-----TIEDIAVAL 1210
             YY  D    V  ++   +Q+   L   E            L+LEL       +D+ +  
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1211 TKAPKLKIQASDVSIA----GDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQLRR 1266
                  +   +D+ +      D+K+I+       KS    T A+   E+ +  +++    
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAE---EDHMLKKIENT-- 1266

Query: 1267 ALPHIVVKGLPEIARAVINIRD------------DGKRELLVEGYGLREVMCTDGVIGSK 1314
             L +I ++G+  I R V+   D            + +  L  +G  L EVM   G+  ++
Sbjct: 1267 MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDATR 1326

Query: 1315 TVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1374
              TN  +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1375 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
             G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTG+F V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1498 (34%), Positives = 770/1498 (51%), Gaps = 132/1498 (8%)

Query: 7    SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
            S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
             C+TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNEL---- 121

Query: 126  ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
             +R +  I + KK      +   CK +  C     + +   +  +  G G     I  D 
Sbjct: 122  -MRQALAIKDSKKR--FAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDG 178

Query: 184  FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
             + VG   + +KD   GD +E     PEL          L+  + LN+FK +  +D   L
Sbjct: 179  LKLVG---SWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 244  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304  LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
               G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424  GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
            GPN HPGA Y+++ + + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
            +P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PAI+KP  
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 604  LWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNILSG 663
            LW+GKQ+ S+ I PN    + +    +    + PK          ++G +II G  I+ G
Sbjct: 571  LWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIFG 615

Query: 664  VMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPADD 723
            V++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D T AD 
Sbjct: 616  VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGD-TIADG 673

Query: 724  LKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGDVC 782
              +++  E +  A  K  D+        L  + G    E+ E  +   L++ R++ G + 
Sbjct: 674  PTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 783  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 842
               L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734  EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 843  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 902
            P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 903  NTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERGLLPYQV 960
            NT R S   ++QF YG DG+D   +E  +       + +++    +   N +  L P  +
Sbjct: 854  NTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDP-SL 912

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQS--KSD 1018
            ++  +E+L  L+ +++  +     V      +  + D  +A       +R  IQ+  ++ 
Sbjct: 913  LESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDG-EANWPLPVNIRRIIQNAQQTF 971

Query: 1019 HLAHVRKSRXXXX-----XXXXXXXXXXXXHPDERATDVSRSSVDQLC------------ 1061
            H+ H + S                        +E   +  R +V   C            
Sbjct: 972  HIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRV 1031

Query: 1062 ----KITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVAS 1117
                ++T++A    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS
Sbjct: 1032 LQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVAS 1091

Query: 1118 MNVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA---- 1171
              VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V     
Sbjct: 1092 KKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASE 1151

Query: 1172 -YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLEL-----TIEDIAVAL 1210
             YY  D    V  ++   +Q+   L   E            L+LEL       +D+ +  
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1211 TKAPKLKIQASDVSIA----GDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQLRR 1266
                  +   +D+ +      D+K+I+       KS    T A+   E+ +  +++    
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAE---EDHMLKKIENT-- 1266

Query: 1267 ALPHIVVKGLPEIARAVINIRD------------DGKRELLVEGYGLREVMCTDGVIGSK 1314
             L +I ++G+  I R V+   D            + +  L  +G  L EVM   G+  ++
Sbjct: 1267 MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTR 1326

Query: 1315 TVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1374
              TN  +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1375 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
             G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTG+F V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1498 (34%), Positives = 769/1498 (51%), Gaps = 132/1498 (8%)

Query: 7    SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
            S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
             C+TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNEL---- 121

Query: 126  ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
             +R +  I + KK      +   CK +  C     + N   +  +  G G     +  D 
Sbjct: 122  -MRQALAIKDTKKR--FGAIWTLCKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 184  FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
             + VG   + +KD   GD +E     PEL          L+  + LN+FK +  +D   L
Sbjct: 179  LKLVG---SWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISAKDSSSL 222

Query: 244  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304  LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
               G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424  GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
            GPN HPGA Y+++ + + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
            +P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PAI+KP  
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 604  LWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNILSG 663
            LW+GKQ+ S+ I PN    + +    +    + PK          ++G +II G  I+ G
Sbjct: 571  LWSGKQVLSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIVFG 615

Query: 664  VMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPADD 723
            V++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D T AD 
Sbjct: 616  VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGD-TIADG 673

Query: 724  LKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGDVC 782
              +++  E +  A  K  D+        L  + G    E+ E  +   L++ R++ G + 
Sbjct: 674  PTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 783  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 842
               L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734  EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDYS 793

Query: 843  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 902
            P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 903  NTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERGLLPYQV 960
            NT R S   ++QF YG DG+D   +E  +       + +++    I   N +  L P  +
Sbjct: 854  NTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNPDHILDP-SL 912

Query: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQS--KSD 1018
            ++  +E+L  L+ +++  +     V      +  + D  +A       +R  IQ+  ++ 
Sbjct: 913  LESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDG-EANWPLPVNIRRIIQNAQQTF 971

Query: 1019 HLAHVRKSRXXXX-----XXXXXXXXXXXXHPDERATDVSRSSVDQLC------------ 1061
            H+ H + S                        +E   +  + +V   C            
Sbjct: 972  HIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLRSRLASRRV 1031

Query: 1062 ----KITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVAS 1117
                K+T++A    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS
Sbjct: 1032 IQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVAS 1091

Query: 1118 MNVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA---- 1171
              VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  +E T L  V     
Sbjct: 1092 KKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTIASE 1151

Query: 1172 -YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLEL-----TIEDIAVAL 1210
             YY  D    V  ++   +Q+   L   E            L+LEL       +D+ +  
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1211 TKAPKLKIQASDVSIA----GDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQLRR 1266
                  +   +D+ +      D+K+I+       KS    T A+   E+ +  +++    
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAE---EDHMLKKIENT-- 1266

Query: 1267 ALPHIVVKGLPEIARAVINIRD------------DGKRELLVEGYGLREVMCTDGVIGSK 1314
             L +I ++G+  I R V+   D            + +  L  +G  L EVM   G+  ++
Sbjct: 1267 MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVPGIDPTR 1326

Query: 1315 TVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1374
              TN  +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1375 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
             G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTG+F V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1500 (34%), Positives = 769/1500 (51%), Gaps = 136/1500 (9%)

Query: 7    SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
            S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
             C+TC   +  C GHFGHI LA PVFHVG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHNEL---- 121

Query: 126  ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
             +R +  I + KK      +   CK +  C     + N   +  +  G G     +  D 
Sbjct: 122  -MRQALAIKDSKKR--FAAIWTLCKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 184  FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
             + VG   + +KD   GD +E     PEL          L+  + LN+FK +  ED   L
Sbjct: 179  LKLVG---SWKKDRASGDADE-----PELRV--------LSTEEILNIFKHISVEDFTSL 222

Query: 244  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304  LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
               G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424  GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
            GPN HPGA Y+++ + + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
            +S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
            +P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PAI+KP  
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 604  LWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIRGSNIL 661
            LW+GKQ+ S  I      P  I+L    +    + PK          ++G +II G  I+
Sbjct: 571  LWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIV 613

Query: 662  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPA 721
             GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D T A
Sbjct: 614  FGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGD-TIA 671

Query: 722  DDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            D   +++  E +  A  K  D+        L  + G    E+ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            +    L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
             +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERGLLPY 958
            YDNT R S   ++QF YG DG+D   +E  +       +++++    I   N E  L P 
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLLNPEHILDP- 910

Query: 959  QVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQS--K 1016
             +++  +E+L  L+ +++  +     V      +  + D  +A       +R  IQ+  +
Sbjct: 911  SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDG-EANWPMPVNIRRIIQNAQQ 969

Query: 1017 SDHLAHVRKS-----RXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLC---------- 1061
            + H+ H R S                        +E   +  + +V   C          
Sbjct: 970  TFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLFRSRLATR 1029

Query: 1062 ------KITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGV 1115
                  ++T++A    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGV
Sbjct: 1030 RILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGV 1089

Query: 1116 ASMNVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA-- 1171
            AS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V   
Sbjct: 1090 ASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIA 1149

Query: 1172 ---YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLEL-----TIEDIAV 1208
               YY  D    V  ++   +Q+   L   E            L+LEL       +D+ +
Sbjct: 1150 SEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1209 ALTKAPKLKIQASDVSIA----GDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQL 1264
                    +   +D+ +      D+K+I+       KS    T A+   E+ +  +++  
Sbjct: 1210 GQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAE---EDHMLKKIENT 1266

Query: 1265 RRALPHIVVKGLPEIARAVINIRD------------DGKRELLVEGYGLREVMCTDGVIG 1312
               L +I ++G+  I R V+   D            + +  L  +G  L EVM   G+  
Sbjct: 1267 --MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDP 1324

Query: 1313 SKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1372
            ++  TN  +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +
Sbjct: 1325 TRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSV 1384

Query: 1373 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            TR G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTG+F V+
Sbjct: 1385 TRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1510 (34%), Positives = 767/1510 (50%), Gaps = 143/1510 (9%)

Query: 1    MKEVVISEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMG 59
            M +   S AP + I  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDED 119
                +  C+TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LL +  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASL 177
               Y   +R + +I + K+      V   CK +  C     + +   K  +  G G A  
Sbjct: 118  ---YNELMRQAIKIKDPKRR--FNAVWSLCKSKMVCDTEVPSEDDPSKYISRGGCGNAQP 172

Query: 178  KIIHDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRP 237
             I  D    VG         W  D N   S  PE     KR    L+  + LN+FK + P
Sbjct: 173  SIRKDGLSLVG--------TWKKDKNSEDSDQPE-----KRI---LSAEEILNVFKHITP 216

Query: 238  EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTS 297
            ED   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 298  SLIKAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              ++     G   + + E    LQ  VA Y++ D    A  P A    G+  PI+    R
Sbjct: 274  INVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 418  QELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNR 477
             +LV NGPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNR 446

Query: 478  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 537
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 538  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPA 597
            V   +++P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP P 
Sbjct: 507  VPQQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPKPT 564

Query: 598  IMKPYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRG 657
            I+KP  LW+GKQL S+ I PN    + +    +   Y+ PK          ++G +II G
Sbjct: 565  ILKPKPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGMLIIDG 610

Query: 658  SNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISD 717
              I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFSIGI D
Sbjct: 611  -QIIFGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGD 668

Query: 718  VTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVRE 776
             T AD+  +++  E + +A  +  ++        L  + G    E+ E  +   L++ R+
Sbjct: 669  -TIADEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 777  EVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 836
            + G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHF 787

Query: 837  PKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 896
             K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 897  LSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERG 954
            +   YD T R S   I+QF YG DG+D   +E  +       + +++    I   N E G
Sbjct: 848  IMVHYDGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLNPEYG 907

Query: 955  LLPYQVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLD--KLEYADQFDAERDF--YKTLR 1010
            L P  +++   E++  L     +  N+ +E  K+ +   +L  +   D E ++     +R
Sbjct: 908  LDP-SLLESATEIMGDL-----KLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIR 961

Query: 1011 SYIQSKSDHLAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLK 1070
              IQ+ +     +  ++                  +     V R S + L +  E AV  
Sbjct: 962  RIIQN-AQQTFRIDTTKPTDLTIKDVVLGVRKLQDN---LLVLRGSSNILKEAQENAVTL 1017

Query: 1071 FLEI---------ALSKYRKARVEPGTAVGAIGAQ---SIGEPG---------------T 1103
            F  +          L++YR  +      +  I AQ   SI  PG               T
Sbjct: 1018 FCSLVRSRLATRRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPAT 1077

Query: 1104 QMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGR 1161
            QMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+  A++++  
Sbjct: 1078 QMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSA 1137

Query: 1162 VEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALT-KAPK-LKIQ 1219
            +E T L  V    +  Y  + S   I  D   I+ L   L  E+   +L  ++P  L+++
Sbjct: 1138 IEHTTLKSVTVSSEIYYDPDPSSTVIEEDEEIIQ-LHFSLMDEETENSLKHQSPWLLRLE 1196

Query: 1220 ASDVSIAGDDKVIVNV---FPEGSKSKSISTSAKDPSENDVFYRMQQLR----------- 1265
                ++   D  +  V     E  K+      ++D +EN +  R + +R           
Sbjct: 1197 LDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEN-LIIRCRVVRDPKTLDAEAEA 1255

Query: 1266 -----------RALPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLR 1302
                         L  I ++G+ +I R V+   D       G+        L  +G  L 
Sbjct: 1256 EEDHMLKKIENTMLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLS 1315

Query: 1303 EVMCTDGVIGSKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDV 1362
            EVM   GV  ++  TN  +++ +VLGIEA R+++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1316 EVMTVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDV 1375

Query: 1363 MTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTM 1422
            MT +G ++ +TR G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ  
Sbjct: 1376 MTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMA 1435

Query: 1423 SIGTGSFKVV 1432
             IGTG+F V+
Sbjct: 1436 PIGTGAFDVM 1445

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1512 (33%), Positives = 759/1512 (50%), Gaps = 160/1512 (10%)

Query: 7    SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
            S AP + +  ++F   S  +I A S  +I   +  D  Q R  K  G  DPR+G    SL
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSL 65

Query: 66   TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
             C+TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNE----- 120

Query: 126  ELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKK--AAAGSGTASLKIIHDT 183
            ++R + +I + KK      V   CK +  C      +    +  +  G G A   I  D 
Sbjct: 121  QMRQAIKIKDSKKR--FNAVWSLCKAKMICDTDVPSDEDPTQLISRGGCGNAQPTIRRDG 178

Query: 184  FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
             + VG        +W  D N   +  PE     +R    LN  + LN+FK + PED   L
Sbjct: 179  LKLVG--------SWKKDKNSGDNEEPE-----QRV---LNMEEILNIFKHISPEDSWKL 222

Query: 244  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304  LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
               G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280  EHNGAPHHTIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRN 394

Query: 424  GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
            GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHK 452

Query: 484  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIV 512

Query: 544  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
            +P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PAI+KP  
Sbjct: 513  SPQSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPKP 570

Query: 604  LWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIRGSNIL 661
            LWTGKQL S+ I      P  I+L    +    + PK          ++G ++I G  I+
Sbjct: 571  LWTGKQLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QII 613

Query: 662  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPA 721
             GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D T A
Sbjct: 614  FGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGD-TIA 671

Query: 722  DDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
            D   +++  E +  A  K +D+        L  + G    E+ E  +   L++ R++ G 
Sbjct: 672  DGQTMRQITEAIAEAKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
             +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERGLLPY 958
            YD T R S   I+QF YG DG+D   +E  A       +R+++    I   N +  L P 
Sbjct: 852  YDGTTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDP- 910

Query: 959  QVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQF--DAERDF--YKTLRSYIQ 1014
             +++  +E++  L     +  +L +E  K+ ++  ++  +   D E ++     +R  IQ
Sbjct: 911  SLLESGSEIIGDL-----KLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQ 965

Query: 1015 SKSDHLAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEI 1074
            +        R  R                   ER   V R +   + +  E A+  F  +
Sbjct: 966  NAQQTF---RIDRSKPSDVTIRDVVWGVKELQERLL-VVRGNSRIIKEAQEDAITLFCCL 1021

Query: 1075 ALSK---------YRKARVEPGTAVGAIGAQ---SIGEPGTQMTLKTFHFAGVASMNVTL 1122
              S+         YR  +      +  I  Q   S+  PG  + +      G  +  +TL
Sbjct: 1022 MRSRLASRRVIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1123 ---------------GVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGRVEKT 1165
                           GVPR+KEI+N +K + TP + A L  +   D+  A++++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHT 1141

Query: 1166 MLSDVA-----YYIQD-----------VYKDNLSFLQ--------------IRIDLNTIE 1195
             L  V      YY  D           + + + S L               +R++L+   
Sbjct: 1142 TLKSVTVASEIYYDPDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAA 1201

Query: 1196 KLQLELTIEDIAVALTKAPK---LKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDP 1252
                +LT+  +   + +  K     I + D +    +++I+       KS  + T A+  
Sbjct: 1202 MNDKDLTMGQVGEKIKETFKNDLFVIWSEDNA----EQLIIRCRVVRPKSMDLETEAE-- 1255

Query: 1253 SENDVFYRMQQLRRALPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYG 1300
             E+ +  +++     L +I ++G+  I R V+   D       G+ +      L  +G  
Sbjct: 1256 -EDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVN 1312

Query: 1301 LREVMCTDGVIGSKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLG 1360
            L EVM   GV  S+  TN  +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL 
Sbjct: 1313 LSEVMTVPGVDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLV 1372

Query: 1361 DVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQ 1420
            DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ
Sbjct: 1373 DVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQ 1432

Query: 1421 TMSIGTGSFKVV 1432
               IGTG+F V+
Sbjct: 1433 MAPIGTGAFDVM 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1508 (33%), Positives = 752/1508 (49%), Gaps = 139/1508 (9%)

Query: 1    MKEVVISEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMG 59
            M +   S AP + I  ++F   S  ++   S  +I   +  D E   K K  G  DPR+G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLG 59

Query: 60   VSSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDED 119
                +  C+TC   +A C GHFGHI+LA PVFH+G+     ++ +++C +C  +LL +  
Sbjct: 60   SIDRNYKCQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDE-- 117

Query: 120  KKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLH--CGALNGVVKKAAAGSGTASL 177
               Y  ++R + +I + K+      V   CK +  C        +  V  +  G G    
Sbjct: 118  ---YNEQMRQAIKIKDPKRR--FNAVWTLCKAKMVCETEVPSPDDPTVFLSRGGCGHIQP 172

Query: 178  KIIHDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRP 237
             I  D    VG         W  D N   S  PE     KR    ++  + LN+FK + P
Sbjct: 173  SIRKDGLSLVG--------TWKKDKNADDSDQPE-----KRI---ISAEEILNVFKHISP 216

Query: 238  EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTS 297
            ED   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDGWRLGFNEDFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 298  SLIKAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              ++     G   + + E    LQ  VA Y++ D    A  P A    G+  PI+    R
Sbjct: 274  INVQKLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 418  QELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNR 477
             +LV NGPN HPGA Y+++++ + R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNR 446

Query: 478  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 537
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 538  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPA 597
            V   +++P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PA
Sbjct: 507  VPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWD--GIIPTPA 564

Query: 598  IMKPYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRG 657
            I+KP  LW+GKQ+ S+ I PN    + +        ++ PK          ++G +II G
Sbjct: 565  ILKPVPLWSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPK----------DNGMLIIDG 610

Query: 658  SNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISD 717
              I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D
Sbjct: 611  -KIIFGVVDKKTVG-SSSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGD 668

Query: 718  VTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVRE 776
             T AD+  +++  E + +A  K +D+        L  + G    E+ E  +   L++ R+
Sbjct: 669  -TIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARD 727

Query: 777  EVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 836
            + G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHF 787

Query: 837  PKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 896
             K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 897  LSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNERG 954
            +   YD T R S   ++QF YG DG+D   +E  +       + +++    I   N E  
Sbjct: 848  IMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLNEEYA 907

Query: 955  LLPYQVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQ 1014
            L P  +++  +E++   + +L+  D     V    + +  + D  +        ++  IQ
Sbjct: 908  LDP-SLLESGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDG-EHNWPLPVNIKRIIQ 965

Query: 1015 SKSDHLAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEI 1074
            +        R  +                   E+   V R   D L +  + A+  F  +
Sbjct: 966  NSQQTF---RIDQTKPTDLTIEDVISGVRKLQEKLL-VVRGKSDILKEAQQNAITLFCCL 1021

Query: 1075 ALSK---------YRKARVEPGTAVGAIGAQ---SIGEPGTQMTLKTFHFAGVASMNVTL 1122
              S+         YR  R      +  I AQ   SI  PG  + +      G  +  +TL
Sbjct: 1022 LRSRLATRRVIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1123 ---------------GVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGRVEKT 1165
                           GVPR+KEI+N +K + TP +   L      D+  A+ ++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHT 1141

Query: 1166 MLSDVA-----YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLELTIED 1205
             L  V      YY  D    V +D+   +Q+   L   E            L+LEL   D
Sbjct: 1142 TLKSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLEL---D 1198

Query: 1206 IAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSI--STSAKDPSENDVFYRMQQ 1263
             A    K   +      +     + + V ++ E +  K I      +DP   D     ++
Sbjct: 1199 RAAMTDKDLTMGQVGEKIKETFKNDLFV-IWSEDNAEKLIIRCRVIRDPKTLDADVEAEE 1257

Query: 1264 ---LRR----ALPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREV 1304
               L++     L  I ++G+ +I R V+   D       G+        L  +G  L EV
Sbjct: 1258 DHMLKKIENSMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEV 1317

Query: 1305 MCTDGVIGSKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMT 1364
            M   GV GS+  TN  +++ +VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1318 MTVSGVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMT 1377

Query: 1365 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSI 1424
             +G ++ +TR G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   I
Sbjct: 1378 SQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPI 1437

Query: 1425 GTGSFKVV 1432
            GTG+F V+
Sbjct: 1438 GTGAFDVM 1445

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1519 (33%), Positives = 766/1519 (50%), Gaps = 174/1519 (11%)

Query: 7    SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
            S AP + +  ++F   S  +I A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
             C+TC   +  C GHFGHI LA PVFH+G+     ++ +++C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHNE----- 120

Query: 126  ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
            ++R + +I + KK      V   CK +  C     + +   K  +  G G     I  D 
Sbjct: 121  QMRQAIQIKDPKKR--FNAVWSLCKTKMVCETDVPSEDDPTKLISRGGCGNTQPTIRKDG 178

Query: 184  FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
             + VG   + +KD   GD +E     PE     +R    L+  + LN+FK + PED   L
Sbjct: 179  LKLVG---SWKKDKSTGDADE-----PE-----QRV---LSTEEILNIFKHISPEDSYRL 222

Query: 244  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304  LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
               G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280  EHNGAPHHAVEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRN 394

Query: 424  GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
            GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 452

Query: 484  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMS-----DGNLQFDIPPPAI 598
            +P+S +P +   QD + G   ++ +D+F +   F Q+L+M+      DG     IP PAI
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFLE---FDQVLNMLYWVPDWDGV----IPTPAI 565

Query: 599  MKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIR 656
            +KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G ++I 
Sbjct: 566  IKPKPLWSGKQILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVID 609

Query: 657  GSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGIS 716
            G  I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610  GE-IIFGVVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 717  DVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVR 775
            D T AD   +++  E +  A  K + +        L  + G    E+ E  +   L++ R
Sbjct: 668  D-TVADGQTMREISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 776  EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 835
            +  G +    L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DRAGRLAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPH 786

Query: 836  FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 895
            F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 896  DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPV--NFNRSWDHALNITFNNNER 953
            D+   YD T R S   ++QF YG DG+D   +E  +       +++++    I   N   
Sbjct: 847  DIMVHYDGTTRNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTSN 906

Query: 954  GLLPYQVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYI 1013
             L P  +++  +E++  L+ ++              LD+ EY  Q   +R F +T+ S  
Sbjct: 907  SLEP-SLLESGSEIIGDLKVQMA-------------LDE-EYK-QLVKDRRFLRTIFSDG 950

Query: 1014 QSKSDHLAHVRK--SRXXXXXXXXXXXXXXXXHPD--------ERATDVSRSSVDQLCKI 1063
            +S      ++R+                     P+        +    V RS  + + K 
Sbjct: 951  ESSWPLPVNIRRIIQNAQQTFRIDHTKPSDLTIPEIINSVRDLQDRLLVLRSKSEIIKKA 1010

Query: 1064 TEKAVLKFLEI---------ALSKYRKARVEPGTAVGAIGAQ---SIGEPGTQMTLKTFH 1111
             + AV  F  +          L +YR  +      +  + AQ   SI  PG  + +    
Sbjct: 1011 QDDAVTLFCCLLRSRLATRRVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQ 1070

Query: 1112 FAGVASMNVTL---------------GVPRIKEIINASKTISTPIINAVL--VNNNDERA 1154
              G  +  +TL               GVPR+KEI+N +K + TP +   L    + D+  
Sbjct: 1071 SIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEK 1130

Query: 1155 ARVVKGRVEKTMLSDVA-----YYIQD----VYKDNLSFLQIRIDL--NTIEKLQLELTI 1203
            A++V+  +E T L  V      YY  D    V  ++   +Q+   L  +  EKL  + + 
Sbjct: 1131 AKLVRSAIEHTTLKSVTVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSP 1190

Query: 1204 EDIAVALTKAPKLKIQASDVSIAGDDKVIVNVF--------PEGSKSKSI---------S 1246
              + + L +A    +   D+++    + I + F         E +  K I         +
Sbjct: 1191 WLLRLELDRA---AMNDKDLTMGQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKA 1247

Query: 1247 TSAKDPSENDVFYRMQQLRRA-LPHIVVKGLPEIARAVINIRD------DGKRE------ 1293
              A+  +E D  + ++++    L +I ++G+  I R V+   D       G+ +      
Sbjct: 1248 LDAETEAEED--HMLKKIENTMLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWV 1305

Query: 1294 LLVEGYGLREVMCTDGVIGSKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDP 1353
            L  +G  L EVM   GV  ++  TN  +++  VLGIEA R+++  E+   +++ G  V+ 
Sbjct: 1306 LETDGVNLSEVMTVPGVDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNY 1365

Query: 1354 RHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVS 1413
            RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D+  GVS
Sbjct: 1366 RHMALLVDVMTTQGGLTSVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVS 1425

Query: 1414 ECIILGQTMSIGTGSFKVV 1432
            E +ILGQ   IGTG+F V+
Sbjct: 1426 ENVILGQMAPIGTGAFDVM 1444

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  540 bits (1392), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 261/317 (82%), Positives = 291/317 (91%)

Query: 1146 LVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLELTIED 1205
            LVN NDERAARVVKGR+EKT+LSDVA+YIQDVYKDNLSFLQ++IDL TIEKLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1206 IAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQLR 1265
            IAVA+T+A KLKI A DVSI G DKV +NV+PEGSK KSISTSAK+P EN++FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1266 RALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHVLEVSS 1325
            R+LP IVVKGLP+IARAVINI+ DG RELLVEGYGLR+VM TDGV+G KT TNH+LEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1326 VLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1385
            VLGIEAAR+SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1386 QLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPEDLKPK 1445
            QLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTG+FKVVKGT++  E+LKPK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1446 PTLFESLSSASSNIKLN 1462
             TLFESL   ++ +K+N
Sbjct: 304  ATLFESLCGNTAALKIN 320

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  578 bits (1490), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 368/933 (39%), Positives = 515/933 (55%), Gaps = 71/933 (7%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + +  ++F   S  ++ A S  ++   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PVFHVG+     ++ +++C +C  +LL + ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
           ++R   +I + KK      V   CK +  C     + N   +  +  G G A   +  D 
Sbjct: 121 QMRQVLKIKDPKKR--FNAVWSLCKTKMICETDVPSENDPTQLISRGGCGNAQPTVRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG        +W  D        PE     +R    L   + LN+FK + PED   L
Sbjct: 179 LKLVG--------SWKKDKATSDGEEPE-----QRV---LGVEEILNIFKHISPEDSTKL 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
           G D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304 LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
              G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424 GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
           GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 452

Query: 484 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
           +S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMS-----DGNLQFDIPPPAI 598
           +P+S +P +   QD + G  +++ KD+F +   F  +L+M+      DG     IP PAI
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRILTLKDTFLE---FDHVLNMLYWVPDWDGI----IPTPAI 565

Query: 599 MKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIR 656
           +KP  LWTGKQ+ S  I      P  I+L    +    + PK          ++G +II 
Sbjct: 566 LKPKPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIID 609

Query: 657 GSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGIS 716
           G  I+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI 
Sbjct: 610 G-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 717 DVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVR 775
           D T A+   IK+  E +  A  K +++        L  + G    E+ E  +   L++ R
Sbjct: 668 D-TIANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 776 EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 835
           ++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPH 786

Query: 836 FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 895
           F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 896 DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
           D+   YD T R S   I+QF YG DG+D   +E
Sbjct: 847 DIMVHYDGTTRNSLGNIIQFIYGEDGIDASHIE 879

 Score =  174 bits (442), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 127/397 (31%), Positives = 202/397 (50%), Gaps = 44/397 (11%)

Query: 1077 SKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKT 1136
            S++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1051 SQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1110

Query: 1137 ISTPIINAVLVNN--NDERAARVVKGRVEKTMLSDVA-----YYIQD----VYKDNLSFL 1185
            + TP +   L      D+  A+ ++  +E T L  V      YY  D    V +D+   +
Sbjct: 1111 MKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEII 1170

Query: 1186 QIRIDLNTIEKLQLELTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVF--------P 1237
            Q+   L   E+++  L  +   +   +  +  +   D+++    + I   F         
Sbjct: 1171 QLHFSL-LDEEMEASLDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKETFKKDLFVIWS 1229

Query: 1238 EGSKSKSI---------STSAKDPSENDVFYRMQQLRRA-LPHIVVKGLPEIARAVINIR 1287
            E +  K I            A+  +E D  + ++++    L +I ++G+  I R V+   
Sbjct: 1230 EDNAEKLIIRCRVVRPKGLDAETEAEED--HMLKKIENTMLENITLRGVENIERVVMMKY 1287

Query: 1288 D------DGKRE------LLVEGYGLREVMCTDGVIGSKTVTNHVLEVSSVLGIEAARSS 1335
            D       G+ +      L  +G  L EVM   GV  ++  TN  +++  VLGIEA R++
Sbjct: 1288 DRKVPSKTGEFQKVPEWVLETDGVNLAEVMTIPGVDTTRIYTNSFIDIMEVLGIEAGRAA 1347

Query: 1336 IIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTD 1395
            +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T +
Sbjct: 1348 LYKEVYNVIASDGSYVNYRHMALLVDVMTCQGGLTSVTRHGFNRANTGALMRCSFEETVE 1407

Query: 1396 HLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
             LF+A    + D+  GVSE ++LGQ   IGTG+F V+
Sbjct: 1408 ILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFGVM 1444

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  577 bits (1487), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 363/931 (38%), Positives = 511/931 (54%), Gaps = 61/931 (6%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LL D ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKK--AAAGSGTASLKIIHDT 183
           ++R + +I + KK      +   CK +  C           K  +  G G A   +  D 
Sbjct: 121 QMRQACKIKDSKKR--FNAIWTLCKTKMICESDVPSEEDPTKLISRGGCGNAQPTVRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG        +W  + N      PE +R        L   + LN+FK +  ED   L
Sbjct: 179 LKLVG--------SWKKEKNTGDPEEPE-QRI-------LTMEEILNIFKHISKEDSNRL 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
           G +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304 LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
              G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRN 394

Query: 424 GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
           GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
           +P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP PAI+KP  
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 604 LWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIRGSNIL 661
           LWTGKQ+ S+ I      P  I+L    +    + PK          ++G +II G  I+
Sbjct: 571 LWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG-KII 613

Query: 662 SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPA 721
            GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D T A
Sbjct: 614 FGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGD-TIA 671

Query: 722 DDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780
           D   +++  E +  A  K +D+        L  + G    E+ E  +   L++ R++ G 
Sbjct: 672 DGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 781 VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840
           +    L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 LAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 841 KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900
            +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 901 YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSA 931
           YD+T R S   ++QF YG DG+D   +E  A
Sbjct: 852 YDSTTRNSLGNVIQFVYGEDGMDASHIEKQA 882

 Score =  157 bits (397), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 127/402 (31%), Positives = 201/402 (50%), Gaps = 44/402 (10%)

Query: 1059 QLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1118
            +L K   + VL  +EI   ++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQAFEWVLNNIEI---QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1119 NVTLGVPRIKEIINASKTISTPIINAVLVN---------NNDERAARVVKG----RVEKT 1165
             VT GVPR+      +K I + I +  L +         + D R+  + +     ++  +
Sbjct: 1093 KVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEIIQLHFS 1152

Query: 1166 MLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALTKAPK---LKIQASD 1222
            +L D      +   D  S   +R++L+       +LT+  +   + +  K     I + D
Sbjct: 1153 LLDDET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSED 1208

Query: 1223 VSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQLRRALPHIVVKGLPEIARA 1282
             +    +K+I+       KS  I T A+   E+ +  +++     L +I ++G+  I R 
Sbjct: 1209 NA----EKLIIRCRVVRPKSMDIETEAE---EDHMLKKIENT--MLENITLRGVENIERV 1259

Query: 1283 VINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTVTNHVLEVSSVLGIE 1330
            V+   D       G+        L  +G  L EVM   GV   +  TN  +++  VLGIE
Sbjct: 1260 VMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIE 1319

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            A R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SF
Sbjct: 1320 AGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSF 1379

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E+T + LF+A    + D+  GVSE +ILGQ   IGTGSF V+
Sbjct: 1380 EETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM 1421

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  577 bits (1486), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 366/934 (39%), Positives = 515/934 (55%), Gaps = 61/934 (6%)

Query: 1   MKEVVISEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMG 59
           M +   S AP + I  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G
Sbjct: 1   MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60  VSSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDED 119
               +  C+TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LL +  
Sbjct: 60  SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120 KKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASL 177
              Y   +R + +I + K+      V   CK +  C     + +   K  +  G G A  
Sbjct: 118 ---YNELMRQAIKIKDPKRR--FNAVWSLCKAKMVCDTEVPSEDDPSKYISRGGCGNAQP 172

Query: 178 KIIHDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRP 237
            I  D    VG         W  D N   +  PE     KR    ++  + LN+FK + P
Sbjct: 173 SIRKDGLSLVG--------TWKKDKNAEDADQPE-----KRI---ISAEEILNVFKHISP 216

Query: 238 EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTS 297
           ED   LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217 EDSWRLGFNEDFS--RPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 298 SLIKAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
             ++     G   + + E    LQ  VA Y++ D    A  P A    G+  PI+    R
Sbjct: 274 INVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 358 LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
           LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329 LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 418 QELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNR 477
            +LV NGPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389 TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNR 446

Query: 478 QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 537
           QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447 QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 538 VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPA 597
           V   +++P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP P 
Sbjct: 507 VPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPT 564

Query: 598 IMKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVII 655
           I+KP  LW+GKQL S+ I      P  I+L    +   Y+ PK          ++G +II
Sbjct: 565 ILKPKPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPK----------DNGMLII 608

Query: 656 RGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGI 715
            G  I+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI
Sbjct: 609 DG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGI 666

Query: 716 SDVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKV 774
            D T AD+  +++  + + +A  K +++        L  + G    E+ E  +   L++ 
Sbjct: 667 GD-TIADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEA 725

Query: 775 REEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 834
           R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 835 HFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 894
           HF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 895 EDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
           ED+   YD T R S   I+QF YG DG+D   +E
Sbjct: 846 EDIMVHYDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score =  183 bits (464), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 137/414 (33%), Positives = 213/414 (51%), Gaps = 44/414 (10%)

Query: 1059 QLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1118
            +L K T + VL  +E   +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQTFEWVLNNIE---AQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1119 NVTLGVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGRVEKTMLSDVAYYIQD 1176
             VT GVPR+KEI+N +K + TP +   L  +   D+  A++++  +E T L  V    + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEI 1152

Query: 1177 VYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALT-KAPKL-KIQASDVSIAGDDKVIVN 1234
             Y  + S   I  D   I+ L   L  E+   +L  ++P L +++   V++   D  +  
Sbjct: 1153 YYDPDPSSTVIEEDEEIIQ-LHFSLMDEETEASLKHQSPWLLRLELDRVAMTDKDLTMGQ 1211

Query: 1235 V---------------FPEGSKSKSI--STSAKDPSENDVFYRMQQ---LRR----ALPH 1270
            V               + E +  K I      +DP   D     ++   L++     L  
Sbjct: 1212 VGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENTMLES 1271

Query: 1271 IVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTVTN 1318
            I ++G+ +I R V+   D       G+        L  +G  L EVM   GV  ++  TN
Sbjct: 1272 ITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVPGVDPTRIYTN 1331

Query: 1319 HVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1378
              +++ +VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G +
Sbjct: 1332 SFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFN 1391

Query: 1379 KMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            +     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTGSF V+
Sbjct: 1392 RADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIGTGSFDVM 1445

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  573 bits (1476), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 363/929 (39%), Positives = 514/929 (55%), Gaps = 64/929 (6%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   ++ C GHFGHI LA PVFHVG+     ++ + +C +C  +LL + ++     
Sbjct: 66  KCQTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
           ++R    I + KK          CK +  C     + N   K  +  G G     +  D 
Sbjct: 121 QMRQVMAIKDPKKR--FNATWALCKTKMVCETDVPSENDPTKLVSRGGCGNTQPTVRKDG 178

Query: 184 FRWVG---KKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240
            + VG   +K T E +              E E+ V      L+  + LN+FK +  ED 
Sbjct: 179 LKLVGSWKRKKTIEGE--------------EPEQRV------LSTEEILNIFKHISTEDF 218

Query: 241 ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +
Sbjct: 219 IRLGFNEEFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISL 275

Query: 301 KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360
           +     G   + + E    LQ  VA Y++ D    A  P A    G  +P++    RLKG
Sbjct: 276 ETLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSG--RPVKSIRARLKG 330

Query: 361 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L
Sbjct: 331 KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 390

Query: 421 VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480
           V NGPN HPGA Y++++N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPS
Sbjct: 391 VRNGPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPS 448

Query: 481 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 449 LHKMSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 508

Query: 541 NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600
            +++P+S +P +   QD + G  +++ +D+F +      +L  + D +    IP PAI+K
Sbjct: 509 QIVSPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV--IPTPAILK 566

Query: 601 PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660
           P  LWTGKQ+ S+ I PN    + +    +    + PK          ++G +II G  I
Sbjct: 567 PKPLWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 611

Query: 661 LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720
           + GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D T 
Sbjct: 612 IFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGD-TI 669

Query: 721 ADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVG 779
           AD   IK+  E +  A  K +++        L  + G    E+ E  +   L++ R++ G
Sbjct: 670 ADGATIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 729

Query: 780 DVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 839
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 730 RLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKD 789

Query: 840 SKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 899
             +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 790 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 849

Query: 900 QYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
            YDNT R S   ++QF YG DG+D   +E
Sbjct: 850 HYDNTTRNSLGNVIQFIYGEDGIDASYIE 878

 Score =  177 bits (448), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 129/412 (31%), Positives = 211/412 (51%), Gaps = 44/412 (10%)

Query: 1062 KITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1121
            ++T++A    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1035 RLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1094

Query: 1122 LGVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGRVEKTMLSDVAYYIQDVYK 1179
             GVPR+KEI+N +K + TP +   L ++  +D+  A++++  +E T L  V    +  Y 
Sbjct: 1095 SGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTVASEIYYD 1154

Query: 1180 DNLSFLQIRIDLNTIEKLQLELTIEDIAVAL-TKAPKLKIQASDVSIAGDDKVIVN---- 1234
             +     I  D   I+ L   L  +++  +L  ++P L     D +   D  + +     
Sbjct: 1155 PDPRSTVIEEDEEIIQ-LHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDLTMGQVGE 1213

Query: 1235 ------------VFPEGSKSKSI---------STSAKDPSENDVFYRMQQLRRA-LPHIV 1272
                        ++ E +  K I         S  A+  +E D  + ++++    L +I 
Sbjct: 1214 RIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HMLKKIENTMLENIT 1271

Query: 1273 VKGLPEIARAVINIRD------DGKRELLVE------GYGLREVMCTDGVIGSKTVTNHV 1320
            ++G+  I R V+   D       G+ + + E      G  L EVM   GV  ++  TN  
Sbjct: 1272 LRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDATRIYTNSF 1331

Query: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380
            +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++ 
Sbjct: 1332 IDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRS 1391

Query: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
                L   SFE+T + LF+A    + D+  GVSE ++LGQ   IGTG+F V+
Sbjct: 1392 NTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON}
           Anc_7.314
          Length = 1716

 Score =  572 bits (1473), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 364/933 (39%), Positives = 512/933 (54%), Gaps = 71/933 (7%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + +  ++F   S  ++   S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PVFHVG+     ++ +++C +C  +LL + ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRCLH--CGALNGVVKKAAAGSGTASLKIIHDT 183
           ++R +  I + KK      V   CK +  C        +     +  G G A   I  D 
Sbjct: 121 QMRQAMAIKDSKKR--FNAVWTLCKTKMICETDVPSDDDPTTLISRGGCGNAQPSIRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG        +W  + N      PE     +R    L+  + LN+FK + PED   +
Sbjct: 179 LKLVG--------SWKKEKNTSDGDEPE-----QRV---LSTEEILNIFKHISPEDSTRM 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
           G        RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304 LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
              G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424 GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
           GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 452

Query: 484 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMS-----DGNLQFDIPPPAI 598
           + +S +P +   QD + G   ++ +D+F +   F Q+L+M+      DG     IP PA+
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDTFIE---FDQVLNMLYWVPDWDGV----IPTPAV 565

Query: 599 MKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIR 656
           +KP  LWTGKQ+ S  I      P  I+L    +    + PK          ++G ++I 
Sbjct: 566 LKPKPLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVID 609

Query: 657 GSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGIS 716
           G  I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610 G-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIG 667

Query: 717 DVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVR 775
           D T AD   IK+  E +  A  K +D+        L  + G    E+ E  +   L++ R
Sbjct: 668 D-TIADGQTIKEITETIAEAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 776 EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 835
           ++ G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPH 786

Query: 836 FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 895
           F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 896 DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
           D+   YD T R S   ++QF YG DG+D   +E
Sbjct: 847 DIMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIE 879

 Score =  180 bits (456), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 212/415 (51%), Gaps = 44/415 (10%)

Query: 1059 QLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1118
            Q  K+T++A    L    S++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1119 NVTLGVPRIKEIINASKTISTPIINAVLVN--NNDERAARVVKGRVEKTMLSDVAYYIQD 1176
             VT GVPR+KEI+N +K + TP +   L +  ++D+  A+ ++  +E T L  +     +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTLKSITV-ASE 1151

Query: 1177 VYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALTK-APKLKIQASDVSIAGDDKVIVN- 1234
            +Y D      +  + + I +L   L  ++   +L + +P L     D +   D  + +  
Sbjct: 1152 IYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1235 ---------------VFPEGSKSKSI---------STSAKDPSENDVFYRMQQLRRA-LP 1269
                           ++ E +  K I         S  A+  +E D  + ++++    L 
Sbjct: 1212 VGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HMLKKIENTMLE 1269

Query: 1270 HIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTVT 1317
            +I ++G+  I R V+   D       G+ E      L  +G  L EVM   G+  ++  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPGIDATRIYT 1329

Query: 1318 NHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1377
            N  +++  VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G 
Sbjct: 1330 NSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGF 1389

Query: 1378 SKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            ++     L   SFE+T + LF+A    + D+  GVSE ++LGQ   IGTG+F V+
Sbjct: 1390 NRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM 1444

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  571 bits (1472), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 362/933 (38%), Positives = 516/933 (55%), Gaps = 71/933 (7%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PV HVG+     ++ +++C +C  +LL + ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKK--AAAGSGTASLKIIHDT 183
           ++R +  I + KK      V + CK +  C      +    +  +  G G A   +  D 
Sbjct: 121 QMRQAIAIKDSKKR--FNAVWNLCKTKMICDTDVPSDDDPTQLISRGGCGNAQPTVRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG        +W  + N      PE     +R    L+  + LN+FK + PED   L
Sbjct: 179 LKLVG--------SWKKEKNTNDGDEPE-----QRV---LSTEEILNIFKHISPEDSTRL 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304 LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
              G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424 GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
           GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHK 452

Query: 484 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMS-----DGNLQFDIPPPAI 598
           + +S +P +   QD + G   ++ +D+F +   F ++L+M+      DG     IP PAI
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDTFLE---FDEVLNMLYWVPDWDGV----IPTPAI 565

Query: 599 MKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIR 656
           +KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +++ 
Sbjct: 566 IKPKPLWSGKQVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVD 609

Query: 657 GSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGIS 716
           G  I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610 G-QIIFGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 717 DVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVR 775
           D T AD   IK+  E +  A  K +D+        L  + G    E+ E  +   L++ R
Sbjct: 668 D-TIADGSTIKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 776 EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 835
           ++ G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPH 786

Query: 836 FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 895
           F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 896 DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
           D+   YD T R S   ++QF YG DG+D   +E
Sbjct: 847 DIMVHYDGTARNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  180 bits (457), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 130/422 (30%), Positives = 217/422 (51%), Gaps = 44/422 (10%)

Query: 1052 VSRSSVDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFH 1111
            +S   + Q  ++T++A    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFH
Sbjct: 1026 LSTRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1112 FAGVASMNVTLGVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGRVEKTMLSD 1169
            FAGVAS  VT GVPR+KEI+N +K + TP +   L ++  +D+  A+ ++  +E T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKS 1145

Query: 1170 VAYYIQDVYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALTK-APKLKIQASDVSIAGD 1228
            +     ++Y D      +  + + I +L   L  ++   +L + +P L     D +   D
Sbjct: 1146 ITV-ASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMND 1204

Query: 1229 DKVIVN----------------VFPEGSKSKSI---------STSAKDPSENDVFYRMQQ 1263
              + +                 ++ E +  K I         S  A+  +E D  + +++
Sbjct: 1205 KDLTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEED--HMLKK 1262

Query: 1264 LRRA-LPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGV 1310
            +    L +I ++G+  I R V+   D       G+ +      L  +G  L EVM   GV
Sbjct: 1263 IENTMLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPGV 1322

Query: 1311 IGSKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVL 1370
              ++  TN  ++++ VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGALT 1382

Query: 1371 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFK 1430
             ITR G ++     L  +SFE+T + LF+A    + D+  GVSE ++LGQ   IGTG+F 
Sbjct: 1383 SITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFD 1442

Query: 1431 VV 1432
            V+
Sbjct: 1443 VM 1444

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1719

 Score =  569 bits (1467), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 361/930 (38%), Positives = 513/930 (55%), Gaps = 65/930 (6%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + +  ++F   S  ++ + S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PVFH+G+     ++ + IC +C  +LL + ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRCLH--CGALNGVVKKAAAGSGTASLKIIHDT 183
           ++R    I + KK      +   CK +  C        +     +  G G A   I  D 
Sbjct: 121 QMRQVMSIKDSKKR--FNAIWTLCKTKTVCETDVPSEDDPTQLISRGGCGNAQPTIRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG   + +KD    D +E     PE     +R    LN  + LN+FK +   D   L
Sbjct: 179 LKLVG---SWKKDKATNDGDE-----PE-----QRV---LNTEEILNIFKHISVHDSNTL 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
           G +   +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNE--QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304 LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
              G   + + E    LQ  +A Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280 EHNGAPHHAIEEAESLLQFHIATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 424 GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
           GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQIV 512

Query: 544 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFD--IPPPAIMKP 601
           +P+S +P +   QD + G   ++ +D F +      +L  + D    +D  IP PAI+KP
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPD----WDGIIPTPAIIKP 568

Query: 602 YYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIRGSN 659
             LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +II G  
Sbjct: 569 VPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNGMLIIDG-Q 611

Query: 660 ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVT 719
           I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D T
Sbjct: 612 IIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGIGD-T 669

Query: 720 PADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEV 778
            AD   +K+  E +  A  K +++        L  + G    E+ E  +   L++ R++ 
Sbjct: 670 IADGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKA 729

Query: 779 GDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPK 838
           G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K
Sbjct: 730 GRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSK 789

Query: 839 NSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLS 898
           +  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+ 
Sbjct: 790 DDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIM 849

Query: 899 CQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
             YD+T R S   ++QF YG DG+D   +E
Sbjct: 850 VHYDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  185 bits (470), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 141/420 (33%), Positives = 217/420 (51%), Gaps = 50/420 (11%)

Query: 1057 VDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1116
            V Q  ++T++A    L    S++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1117 SMNVTLGVPRIKEIINASKTISTPIINAVLVNN--NDERAARVVKGRVEKTMLSDVA--- 1171
            S  VT GVPR+KEI+N +K + TP     L      D+  A++++  +E T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTTLKSVTVAS 1150

Query: 1172 --YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLEL---TIEDIAVALT 1211
              YY  D    V  ++   +Q+   L   E            L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAMNDKDLTMV 1210

Query: 1212 KAPKLKIQAS---DVSIAGD----DKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQL 1264
            +  + KI+ +   D+S+       DK+I+       KS    T A+   E+ +  +++  
Sbjct: 1211 QVGE-KIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAETEAE---EDHMLKKIENT 1266

Query: 1265 RRALPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIG 1312
               L  I ++G+ +I R V+   D       G+ +      L  +G  L EVM   GV G
Sbjct: 1267 --MLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEVMTVPGVDG 1324

Query: 1313 SKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1372
            S+  TN  ++++ VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +
Sbjct: 1325 SRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSV 1384

Query: 1373 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            TR G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTG+F V+
Sbjct: 1385 TRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
           similar to uniprot|P04050 Saccharomyces cerevisiae
           YDL140C
          Length = 1730

 Score =  568 bits (1464), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 368/979 (37%), Positives = 531/979 (54%), Gaps = 62/979 (6%)

Query: 1   MKEVVISEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMG 59
           M +   S AP + I  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G
Sbjct: 1   MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60  VSSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDED 119
               +  C+TC   +  C GHFGHI+LA PVFH+G+     ++ + +C +C  +LL DE 
Sbjct: 60  SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLL-DEH 118

Query: 120 KKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAA-AGSGTASLK 178
            ++    ++          +  L KV   C+ +       + +   K  +  G G     
Sbjct: 119 NEQMKQAIKIKDPKRRFNAVWTLSKVKMICETE-----VPSEDDPTKYISRGGCGNTQPS 173

Query: 179 IIHDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPE 238
           I  D    VG         W  D N   +  PE     KR    ++  + LN+FK + PE
Sbjct: 174 IRKDGLSLVG--------TWKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPE 217

Query: 239 DCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSS 298
           D   LG +      RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  + 
Sbjct: 218 DSWRLGFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANI 274

Query: 299 LIKAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRL 358
            ++     G   + + E    LQ  VA Y++ D    A  P A    G+  PI+    RL
Sbjct: 275 NVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIRARL 329

Query: 359 KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQ 418
           KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330 KGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 419 ELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQ 478
           +LV NGPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQ
Sbjct: 390 QLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQ 447

Query: 479 PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 538
           PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448 PSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 539 KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAI 598
              +++P+S +P +   QD + G   ++ +D+F +      +L  + D +    IP P I
Sbjct: 508 PLQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTI 565

Query: 599 MKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIR 656
           +KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +I+ 
Sbjct: 566 LKPKPLWSGKQILSMAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIVD 609

Query: 657 GSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGIS 716
           G  I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +L + GFSIGI 
Sbjct: 610 G-QIIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIG 667

Query: 717 DVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVR 775
           D T AD   +++  E + +A  K +++        L  + G    E+ E  +   L++ R
Sbjct: 668 D-TIADQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEAR 726

Query: 776 EEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 835
           ++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPH 786

Query: 836 FPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 895
           F K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 896 DLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSA--QPVNFNRSWDHALNITFNNNER 953
           D+   YD T R S   I+QF YG DG+D   +E  +       +R+++    I   N + 
Sbjct: 847 DIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDN 906

Query: 954 GLLPYQVMKKTNEVLNPLE 972
            L P  +++  +E++  L+
Sbjct: 907 ALDP-SLLESGSEMMGDLK 924

 Score =  183 bits (464), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 139/428 (32%), Positives = 217/428 (50%), Gaps = 48/428 (11%)

Query: 1048 RATDVSRSSVDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTL 1107
            R+   SR  +++  K+T++     L    +++ ++ V PG  VG + AQSIGEP TQMTL
Sbjct: 1023 RSRLASRRVIEEY-KLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1108 KTFHFAGVASMNVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKT 1165
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +    D+  A++++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHT 1141

Query: 1166 MLSDVA-----YYIQD----VYKDNLSFLQIRIDLNTIEK-----------LQLELTIED 1205
             L  V      YY  D    V +D+   +Q+   L   E            L+LEL   D
Sbjct: 1142 TLKSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDHQSPWLLRLEL---D 1198

Query: 1206 IAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSI--STSAKDPSENDVFYRMQQ 1263
             A    K   +      +     + + V ++ E +  K I      +DP   D     ++
Sbjct: 1199 RAAMNDKDLTMGQVGEKIKETFKNDLFV-IWSEDNAEKLIIRCRVVRDPKTLDAEAEAEE 1257

Query: 1264 ---LRR----ALPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREV 1304
               L++     L  I ++G+ +I R V+   D       G+ +      L  +G  L EV
Sbjct: 1258 DHMLKKIENTMLESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAEV 1317

Query: 1305 MCTDGVIGSKTVTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMT 1364
            M   GV  ++  TN  +++ +VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1318 MSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMT 1377

Query: 1365 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSI 1424
             +G ++ +TR G ++     L   SFE+T + LF+A    + DN  GVSE +ILGQ   I
Sbjct: 1378 SQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAPI 1437

Query: 1425 GTGSFKVV 1432
            GTG+F V+
Sbjct: 1438 GTGAFDVM 1445

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  567 bits (1462), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 354/927 (38%), Positives = 505/927 (54%), Gaps = 59/927 (6%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + I  ++F   S  +I A S  +I   +  D  Q R  K  G  DPR+G    +L
Sbjct: 7   SSAPLRTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PVFH+G+     ++ + IC +C  +LL + ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRCLH--CGALNGVVKKAAAGSGTASLKIIHDT 183
           ++R   +I + KK      +   CK +  C        +     +  G G A   +  D 
Sbjct: 121 QMRQILKIKDSKKR--FNAIWSLCKTKMICDTDVPSEHDPTQLVSRGGCGNAQPTVRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG        +W  + N      PE +R        L+  + LN+FK + PED   +
Sbjct: 179 LKLVG--------SWKKEKNTSDGDEPE-QRI-------LSTEEILNIFKHISPEDSIAM 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAG 303
           G +      RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEEFS--RPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 304 LEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQG 363
              G   + + E    LQ  VA Y++ D    A  P A    G+  P++    RLKGK+G
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGR--PVKSIRARLKGKEG 334

Query: 364 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMN 423
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRN 394

Query: 424 GPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPSLHR 483
           GPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 484 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 543
           +S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 544 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMKPYY 603
           + +S +P +   QD + G   ++ +D+F +      LL  + D +    IP PAI+KP  
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV--IPTPAILKPKP 570

Query: 604 LWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVIIRGSNIL 661
           LW+GKQ+ S+ I      P  I+L    +   ++ PK          ++G +II G  I+
Sbjct: 571 LWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLIIDG-QII 613

Query: 662 SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPA 721
            GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D    
Sbjct: 614 FGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTIAD 672

Query: 722 DDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGDV 781
            +   +    +  A  K +++        L  + G    E+ E  +   L++ R++ G +
Sbjct: 673 GETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 782 CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 841
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 842 TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 901
           +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 902 DNTVRTSSNGIVQFTYGGDGLDPMEME 928
           D+T R S   ++QF YG DG+D   +E
Sbjct: 853 DSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  182 bits (463), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 134/417 (32%), Positives = 209/417 (50%), Gaps = 44/417 (10%)

Query: 1057 VDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1116
            V Q  K+ +++    L    +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1117 SMNVTLGVPRIKEIINASKTISTPIINAVL--VNNNDERAARVVKGRVEKTMLSDVAYYI 1174
            S  VT GVPR+KEI+N +K + TP + A L      D+  A++++  +E T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTV-A 1149

Query: 1175 QDVYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVAL-TKAPKLKIQASDVSIAGDDKVIV 1233
             ++Y D      +  +   I +L   L  E+   +L  ++P L     D +   D  + +
Sbjct: 1150 SEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1234 N----------------VFPEGSKSKSI---------STSAKDPSENDVFYRMQQLRRA- 1267
                             ++ E +  K I         +  A+  +E D  + ++++    
Sbjct: 1210 GQVGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEED--HMLKKIENTM 1267

Query: 1268 LPHIVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKT 1315
            L +I ++G+  I R V+   D       G  E      L  +G  L EVM   GV  S+ 
Sbjct: 1268 LENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVDASRI 1327

Query: 1316 VTNHVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1375
             TN  ++++ VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT  G +  +TR 
Sbjct: 1328 YTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTSVTRH 1387

Query: 1376 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            G ++     L   SFE+T + LF+A    + D+  GVSE +ILGQ   IGTGSF V+
Sbjct: 1388 GFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDVM 1444

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140C
          Length = 1740

 Score =  567 bits (1461), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 370/981 (37%), Positives = 534/981 (54%), Gaps = 66/981 (6%)

Query: 1   MKEVVISEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMG 59
           M E   S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G
Sbjct: 1   MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60  VSSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDED 119
               +  C+TC   +  C GHFGHI+LA PVFH+GY     ++ + +C +C  +LL +  
Sbjct: 60  SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120 KKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASL 177
           +      +R + +I + K+      V   CK +  C     + N   +  +  G G    
Sbjct: 120 EL-----MRQAIKIKDPKRR--FNAVWSLCKAKMVCETEVPSDNDPAQYVSRGGCGNTQP 172

Query: 178 KIIHDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRP 237
            +  D    VG   T +KD    D     +  PE     +R    ++  + LN+FK + P
Sbjct: 173 SVRKDGLSLVG---TWKKDKGADD-----ADQPE-----RRV---ISADEVLNVFKHISP 216

Query: 238 EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTS 297
           ED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+  +
Sbjct: 217 EDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKAN 273

Query: 298 SLIKAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
             ++     G   + + E    LQ  VA Y++ D    A  P A    G+  PI+    R
Sbjct: 274 INVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR--PIKSIRAR 328

Query: 358 LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
           LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L
Sbjct: 329 LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRL 388

Query: 418 QELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNR 477
            +LV NGPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389 TQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNR 446

Query: 478 QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 537
           QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447 QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 538 VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPA 597
           V   +++ +S +P +   QD + G   ++ +D+F +      +L  + D +    IP P 
Sbjct: 507 VPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPI 564

Query: 598 IMKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVII 655
           I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +II
Sbjct: 565 ILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPK----------DNGMLII 608

Query: 656 RGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGI 715
            G  I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI
Sbjct: 609 DG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSIGI 666

Query: 716 SDVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKV 774
            D T AD+  +++  E + +A  K +++        L  + G    E+ E  +   L++ 
Sbjct: 667 GD-TIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNEA 725

Query: 775 REEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 834
           R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 835 HFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 894
           HF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 895 EDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNN---N 951
           ED+   YD T R S   ++QF YG DG+D   +E   Q ++   S D A    F     N
Sbjct: 846 EDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAFERRFRIDLLN 903

Query: 952 ERGLLPYQVMKKTNEVLNPLE 972
            R  L   +++  +E++  L+
Sbjct: 904 PRHALDPSLLESGSEIIGDLK 924

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 134/414 (32%), Positives = 214/414 (51%), Gaps = 44/414 (10%)

Query: 1059 QLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1118
            +L K T + VL  +E   S++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLNKQTFEWVLSNVE---SQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1119 NVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA----- 1171
             VT GVPR+KEI+N +K + TP +   L  ++  D+  A++++  +E T L  +      
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSITVASEI 1152

Query: 1172 YYIQD----VYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALTKAPKLKIQASDVSIAG 1227
            YY  D    V +++   +Q+   L   E+ +  L  +   +   +  +  +   D+++  
Sbjct: 1153 YYDPDPRSTVIEEDEEIIQLHFSLMD-EETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1228 DDKVIVNVF--------PEGSKSKSI--STSAKDPSENDVFYRMQQ---LRR----ALPH 1270
              + I   F         E +  K I      +DP   D     ++   L+R     L  
Sbjct: 1212 VGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKRIENTMLES 1271

Query: 1271 IVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTVTN 1318
            I ++G+ +I R V+   D       G+        L  +G  L EVMC  GV  ++  TN
Sbjct: 1272 ITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCVPGVDPARIYTN 1331

Query: 1319 HVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1378
              +++ +VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G +
Sbjct: 1332 SFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFN 1391

Query: 1379 KMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            +     L   SFE+T + LF+A    + D+  GVSE ++LGQ   IGTG+F V+
Sbjct: 1392 RSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON}
           YDL140C (RPO21) - RNA polymerase II large subunit
           [contig 161] FULL
          Length = 1728

 Score =  565 bits (1455), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 359/937 (38%), Positives = 516/937 (55%), Gaps = 61/937 (6%)

Query: 1   MKEVVISEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMG 59
           M E   S AP + +  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G
Sbjct: 1   MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60  VSSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDED 119
               +  C+TC   +  C GHFGHI+LA PVFH+GY     ++ + +C +C  +LL +  
Sbjct: 60  SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120 KKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASL 177
           +      ++ + +I + K+      V   CK +  C     + N   +  +  G G    
Sbjct: 120 EL-----MKQAIKIKDPKRR--FNAVWSLCKVKMVCETEVPSDNDPSQYVSRGGCGNTQP 172

Query: 178 KIIHDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRP 237
            +  D    VG   T +KD    D     +  PE     +R    ++  + LN+FK + P
Sbjct: 173 SVRKDGLSLVG---TWKKDKGADD-----ADQPE-----RRI---ISADEVLNVFKHISP 216

Query: 238 EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTS 297
           ED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+  +
Sbjct: 217 EDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKAN 273

Query: 298 SLIKAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
             ++     G   + + E    LQ  VA Y++ D    A  P A    G  +PI+    R
Sbjct: 274 INVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSG--RPIKSIRAR 328

Query: 358 LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
           LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L
Sbjct: 329 LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRL 388

Query: 418 QELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNR 477
            +LV NGPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389 TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNR 446

Query: 478 QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 537
           QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447 QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 538 VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPA 597
           V   +++ +S +P +   QD + G   ++ +D+F +      +L  + D +    IP P 
Sbjct: 507 VPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPDWDGV--IPTPI 564

Query: 598 IMKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKSLPNEMSRNDGFVII 655
           I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +II
Sbjct: 565 ILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK----------DNGMLII 608

Query: 656 RGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGI 715
            G  I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI
Sbjct: 609 DG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFSIGI 666

Query: 716 SDVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKV 774
            D T AD+  +++  + + +A  K +++        L  + G    E+ E  +   L++ 
Sbjct: 667 GD-TIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEA 725

Query: 775 REEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 834
           R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 835 HFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 894
           HF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 895 EDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSA 931
           ED+   YD T R S   ++QF YG DG+D   +E  A
Sbjct: 846 EDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQA 882

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 132/414 (31%), Positives = 212/414 (51%), Gaps = 44/414 (10%)

Query: 1059 QLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1118
            +L K T + VL  +E   +++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLNKQTFEWVLSNVE---AQFLRSLVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1119 NVTLGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA----- 1171
             VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  +      
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAKLIRSAIEHTTLKSITVASEI 1152

Query: 1172 YYIQD----VYKDNLSFLQIRIDLNTIEKLQLELTIEDIAVALTKAPKLKIQASDVSIAG 1227
            YY  D    V +D+   +Q+   L   E+ +  L  +   +   +  +  +   D+++  
Sbjct: 1153 YYDPDPRSTVIEDDEEIIQLHFSLMD-EETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1228 DDKVIVNVF--------PEGSKSKSI--STSAKDPSENDVFYRMQQ---LRR----ALPH 1270
              + I   F         E +  K +      +DP   D     ++   L+R     L  
Sbjct: 1212 VGEKIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLDAEAEAEEDHMLKRIENTMLES 1271

Query: 1271 IVVKGLPEIARAVINIRDDG------------KRELLVEGYGLREVMCTDGVIGSKTVTN 1318
            I ++G+ +I R V+   D              +  L  +G  L EVMC  GV  ++  TN
Sbjct: 1272 ITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLETDGVNLAEVMCVPGVDPARIYTN 1331

Query: 1319 HVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1378
              +++ +VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G +
Sbjct: 1332 SFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFN 1391

Query: 1379 KMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            +     L   SFE+T + LF+A    + D+  GVSE ++LGQ   IGTG+F V+
Sbjct: 1392 RSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
           complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  485 bits (1248), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 266/588 (45%), Positives = 364/588 (61%), Gaps = 36/588 (6%)

Query: 349 KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEK 408
           +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2   RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 409 VTRYNRKKLQELVMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLE 468
           VT YN  +L +LV NGPN HPGA Y+++ N + R +LRY  R    + LQYG  VERH+ 
Sbjct: 62  VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 469 DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 528
           D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120 DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 529 RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMS--- 585
           RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +   F Q+L+M+    
Sbjct: 180 RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIE---FDQVLNMLYWVP 236

Query: 586 --DGNLQFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVVINLDA--KNKVYIPPKSKS 641
             DG     IP PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK   
Sbjct: 237 DWDGV----IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK--- 283

Query: 642 LPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKL 701
                  ++G ++I G  I+ GV+DK  +G      + + + R+ GPQ  A     + K+
Sbjct: 284 -------DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKV 334

Query: 702 CARFLGNRGFSIGISDVTPADDLKIKK-EELVEIAYAKCDDLIDSYNKGKLETQPGCNEE 760
              +L + GFS GI D T AD   +K+  E +  A  K +++        L  + G    
Sbjct: 335 VNFWLLHNGFSTGIGD-TIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLR 393

Query: 761 ETLEAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIIS 820
           E+ E  +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + 
Sbjct: 394 ESFEDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVE 453

Query: 821 GNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKT 880
           G R+  GF DR+LPHF K+  +P+SKGFV NS+  GLTP EF FHA+ GREGL+DTAVKT
Sbjct: 454 GKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKT 513

Query: 881 AETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
           AETGY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E
Sbjct: 514 AETGYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIE 561

 Score =  179 bits (454), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 136/414 (32%), Positives = 210/414 (50%), Gaps = 48/414 (11%)

Query: 1062 KITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1121
            ++T++A    L    S++ ++ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 718  RLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 777

Query: 1122 LGVPRIKEIINASKTISTPIINAVLVNNN--DERAARVVKGRVEKTMLSDVA-----YYI 1174
             GVPR+KEI+N +K + TP     L      D+  A+ ++  +E T L  V      YY 
Sbjct: 778  SGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKAKFIRSAIEHTTLKSVTVASEIYYD 837

Query: 1175 QD----VYKDNLSFLQIRIDL--NTIEK---------LQLEL-----TIEDIAVALTKAP 1214
             D    V  D+   +Q+   L  +  EK         L+LEL       +D+ +      
Sbjct: 838  PDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPWLLRLELDRAAMNDKDLTMGQVGEK 897

Query: 1215 KLKIQASDVSIAGD----DKVIVNVFPEGSKSKSISTSAKDPSENDVFYRMQQLRRALPH 1270
              +   +D+ +       DK+I+       KS    T A+   E+ +  +++     L  
Sbjct: 898  IKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDAETEAE---EDHMLKKIENT--MLES 952

Query: 1271 IVVKGLPEIARAVINIRD------DGKRE------LLVEGYGLREVMCTDGVIGSKTVTN 1318
            I ++G+ +I R V+   D      +G  E      L  +G  L EVM   GV  ++  TN
Sbjct: 953  ITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVLETDGVNLLEVMTVTGVDPTRIYTN 1012

Query: 1319 HVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1378
              ++++ VLGIEA R+++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G +
Sbjct: 1013 SFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGSLTSVTRHGFN 1072

Query: 1379 KMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            +     L   SFE+T + LF+A    + D+  GVSE +ILGQ   +GTG+F V+
Sbjct: 1073 RSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPVGTGAFDVM 1126

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  425 bits (1092), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 314/999 (31%), Positives = 494/999 (49%), Gaps = 164/999 (16%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  +E K +  N +M  +  +Q  V  +I++            + GGKV PI G  Q 
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-------GNTGGKV-PIPGVKQA 454

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 418  QELVMNGPNIHPGANYLLKKNEEARRNLRYG----DRLKLAKNL----------QYGDIV 463
            ++ V+NGP+  PGA  +  +NE+       G     R  LA  L               V
Sbjct: 515  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKV 572

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIY 692

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYI 635
                  DG+    +    PPA+ KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 693  GCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI-- 750

Query: 636  PPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 695
              K++      + ND  V+ +   +L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 751  --KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVL 805

Query: 696  NRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQP 755
            + + +L   ++    F+ G+      DDL++ +E        + D L  S + G++    
Sbjct: 806  SVLGRLFTNYITATAFTCGM------DDLRLTEEG----NKWRSDILKTSTDVGRVAAAE 855

Query: 756  GCNEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI------------ 794
              N ++ + A    LL ++ E + D         V  ++++++ + ++            
Sbjct: 856  VTNLDKDVSANDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKF 915

Query: 795  -------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKG 847
                   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G
Sbjct: 916  PNNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGG 975

Query: 848  FVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRT 907
            +++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR 
Sbjct: 976  YIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRD 1035

Query: 908  SSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPY--------- 958
            +   ++QF YGG   D +++   +    F    D+   +    N   L+ +         
Sbjct: 1036 ADGTLIQFLYGG---DAVDVTQESHMTQFKFCADNYDALLKKYNPAALIEHLDVESALKY 1092

Query: 959  -----QVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYI 1013
                 +  KKT +V  P   + V+YD + ++      +  +Y        +F   L S+I
Sbjct: 1093 SKKALKHRKKTEKV--PHYSQKVKYDPVVSK-----FNPSKYLGS--VSENFQDKLESFI 1143

Query: 1014 QSKSDHLAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLE 1073
             S +D    + KSR                                   ++EK   KF  
Sbjct: 1144 DSNND----LFKSRDT---------------------------------VSEK---KFRA 1163

Query: 1074 IALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-N 1132
            +   KY ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  
Sbjct: 1164 LMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMT 1223

Query: 1133 ASKTISTPIIN-AVLVNNNDERAARVVKGRVEKTMLSDV 1170
            AS  I TP +   +L +  D +A    K  V K MLS+V
Sbjct: 1224 ASAAIKTPQMTLPILADVTDPQADTFCKS-VTKVMLSEV 1261

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            V++ +  I R V    ++GKR L+ EG   +E+   D  I    +T N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    + +N++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 65/135 (48%), Gaps = 7/135 (5%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  ++A DI   S ++I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CATC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +Y  +L+  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLKLL 125

Query: 129 TSGRIDNLKKMGILK 143
             G ID   K+  L+
Sbjct: 126 QYGLIDECYKLDELR 140

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  424 bits (1090), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 309/990 (31%), Positives = 490/990 (49%), Gaps = 146/990 (14%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK---------- 301
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 302  ----AGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
                +  +K +  N +M  +  +Q  V  +I++            S GGKV PI G  Q 
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ-------GSAGGKV-PIPGVKQA 453

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 454  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 513

Query: 418  QELVMNGPNIHPGANYLLKKNEEARRNLRYG----DRLKLAKNL----------QYGDIV 463
            ++ V+NGP+  PGA+ +  +NE+       G     R  LA  L               V
Sbjct: 514  RQAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKV 571

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 572  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 631

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 632  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIY 691

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYI 635
                  DG+    +    PPA+MKP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 692  GCIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI-- 749

Query: 636  PPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 695
              K+       + ND  VI +   +L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 750  --KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVL 804

Query: 696  NRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELV----EIAYAKCDDLID-----SY 746
            + + +L   ++    F+ G+ D+   DD    + +++    ++  A   ++ +     S 
Sbjct: 805  SVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSA 864

Query: 747  NKGKL-----ETQPGCNEEETLEAKIGGLLSKVREEVGDVCI-----NELDNLNAPLIMA 796
            N  +L     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 865  NDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMA 923

Query: 797  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 856
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 924  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSG 983

Query: 857  LTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 916
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 984  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1043

Query: 917  YGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPY----QVMKKTNEVLNPLE 972
            Y   G D +++   +    F    D+   +    N   L+ +      +K + + L   +
Sbjct: 1044 Y---GGDAVDVTQESHMTEFKFCADNYDALLKKYNPSALIEHLDVESALKYSKKALKNRK 1100

Query: 973  ERLVRYDNLGNEVMKEDLDKLEY---ADQFDAER-------DFYKTLRSYIQSKSDHLAH 1022
            +         NE +     K++Y     +F+  +       +F   L S+I S ++    
Sbjct: 1101 K---------NERVPHFAQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFIDSNNELFK- 1150

Query: 1023 VRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYRKA 1082
                                          SR SV++          KF  +   KY ++
Sbjct: 1151 ------------------------------SRDSVNEK---------KFRALMQLKYMRS 1171

Query: 1083 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTPI 1141
             + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP 
Sbjct: 1172 LINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQ 1231

Query: 1142 IN-AVLVNNNDERAARVVKGRVEKTMLSDV 1170
            +   +L +  D +A    K  + K MLS+V
Sbjct: 1232 MTLPILADVTDSQADTFCKS-ITKVMLSEV 1260

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 95/164 (57%), Gaps = 6/164 (3%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHVLEVSSVL---G 1328
            V++ +  I R V    ++GKR L+ EG   +E+   D  +    +T++  +VSSVL   G
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSN--DVSSVLKTYG 1544

Query: 1329 IEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLA 1388
            +EAAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ 
Sbjct: 1545 VEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM- 1603

Query: 1389 SFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            S+E T   L  A    + +N++  S  ++LG+  ++GTG+F V+
Sbjct: 1604 SYETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVL 1647

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 7/135 (5%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  ++A DI   S ++I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CATC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +Y  +L+  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLKLL 125

Query: 129 TSGRIDNLKKMGILK 143
             G ID   ++  L+
Sbjct: 126 QYGLIDECHRLDELR 140

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  424 bits (1089), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 309/979 (31%), Positives = 478/979 (48%), Gaps = 124/979 (12%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIKAGLEKGISIN 311
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+   ++  +I 
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 312  NMMEHWDYLQLTVAMYINA-----DSVNPAMLPGASSGGGKVK-PIRGFCQRLKGKQGRF 365
                  D  ++  +  +NA     + VN  +    + G    K P+ G  Q L+ K+G F
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGSASSKIPVPGVKQALEKKEGLF 466

Query: 366  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMNGP 425
            R ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ V+NGP
Sbjct: 467  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQAVINGP 526

Query: 426  NIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ----------YGDIVERHLEDGD 471
            +  PGA+ +  +NE+        +    R  LA  L               V RH+++ D
Sbjct: 527  DKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRHIKNRD 584

Query: 472  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 530
            VVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 585  VVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 644

Query: 531  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLL--------S 582
            EA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +         
Sbjct: 645  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIRPEHG 704

Query: 583  MMSDGNLQFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYIPPKSKS 641
              S G +     PPA++KP  LWTGKQ+ S +L+         INL++ NK+    K++ 
Sbjct: 705  HASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI----KNEY 758

Query: 642  LPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKL 701
                 + ND  VI +   ++ G++DKS  G   K+ + +++   YGP+ AA  ++ + +L
Sbjct: 759  WGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSVLGRL 815

Query: 702  CARFLGNRGFSIGISDV--------TPADDLK----IKKEELVEIAYAKCDDLIDSYN-- 747
               ++    F+ G+ D+        + ++ LK    I ++   E+     D   D     
Sbjct: 816  FTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSDDVELL 875

Query: 748  KGKLETQPGCNEEETLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGS 803
            K   E     N+   L+A     ++ V  +V   C+ +      P      MA  G+KGS
Sbjct: 876  KRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGS 935

Query: 804  TLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFL 863
             +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ 
Sbjct: 936  NVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIKPQEYY 995

Query: 864  FHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLD 923
            FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D
Sbjct: 996  FHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYGGDAVD 1055

Query: 924  PMEMEGSAQPVNFNRSWDHALNITFNN-------NERGLLPYQVMKKTNEVLNPLE---E 973
             +  E      +F R    AL   +N        +    L Y      N   N      E
Sbjct: 1056 -VTKESHMTQFDFCRENYDALLKKYNPVALAEHLDVETALQYSKKVSKNRKKNSKTAHYE 1114

Query: 974  RLVRYDNLGNEVMKEDLDKLEYADQFDA-ERDFYKTLRSYIQSKSDHLAHVRKSRXXXXX 1032
            + V+YD +        L K   A    +    F+  L SY++ K+               
Sbjct: 1115 QKVKYDPV--------LAKYNPAKYLGSVSEKFHDKLESYLEDKAKEFK----------- 1155

Query: 1033 XXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGA 1092
                                SR SV         +  +F  +   KY ++ + PG AVG 
Sbjct: 1156 --------------------SRESV---------SAKRFRALMQLKYMRSLINPGEAVGI 1186

Query: 1093 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTPIINAVLVNNND 1151
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++  
Sbjct: 1187 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVS 1246

Query: 1152 ERAARVVKGRVEKTMLSDV 1170
            +  A +    + K +LS+V
Sbjct: 1247 DEQADLFCKSISKVVLSEV 1265

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            V++ +P I R V +   + KR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F+ L+  DI   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSLDFNILTPQDIRNLSAKQITNPTVLD---NLGHPISGGLYDLSLGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +Y  +L+
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  422 bits (1084), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 317/981 (32%), Positives = 488/981 (49%), Gaps = 128/981 (13%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + +  + +M  +  +Q  V  +I++         G +SG  KV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PIPGVKQA 459

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 418  QELVMNGPNIHPGANYLLKKNEEA-----------RRNLRYGDRLKLAKNLQYGDI---V 463
            ++ V+NGP+  PGA  +  +NE+            +R       L  + N+    +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVY 634
                  DG+    +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIK 756

Query: 635  IPPKSK-SLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 693
                 K SL NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 694  AMNRMSKLCARFLGNRGFSIGISDVT--------PADDLKIK----KEELVEIAYAKCDD 741
             ++ + +L   ++    F+ G+ D+           D LK      +E   E+     D 
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDT 868

Query: 742  LIDSYN--KGKLETQPGCNEEETLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IM 795
              D     K   E     N+   L+A     ++ +  +V   C+ +      P      M
Sbjct: 869  PADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAM 928

Query: 796  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFS 855
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+S
Sbjct: 929  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYS 988

Query: 856  GLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQF 915
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF
Sbjct: 989  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQF 1048

Query: 916  TYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQVMKKTNEVLNPLEERL 975
             YGG   D +++   +    F    D+               Y ++KK N          
Sbjct: 1049 MYGG---DAIDITKESHMTQFEFCLDNY--------------YALLKKYNP--------- 1082

Query: 976  VRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHLAHVRKSRXXXXXXXX 1035
                      + E LD +E A ++       KTL+   + K     H ++S         
Sbjct: 1083 --------SALIEHLD-VESALKYSK-----KTLK--YRKKHSKEPHYKQSVKYDPVLAK 1126

Query: 1036 XXXXXXXXHPDERATDVSRSSVDQLCKITEKA----VLKFLEIALSKYRKARVEPGTAVG 1091
                       E   D   S +D+  K+ + +      KF  +   KY ++ + PG AVG
Sbjct: 1127 YNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVG 1186

Query: 1092 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTPIINAVLVNN- 1149
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + N+ 
Sbjct: 1187 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDV 1246

Query: 1150 NDERAARVVKGRVEKTMLSDV 1170
            +DE+A    K  + K +LS+V
Sbjct: 1247 SDEQADTFCKS-ISKVLLSEV 1266

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 7/131 (5%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  L+A +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD---NLGHPVSGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L+A C  C    L   +  +Y  +LR  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLL 125

Query: 129 TSGRIDNLKKM 139
             G ID   K+
Sbjct: 126 QYGLIDESYKL 136

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  419 bits (1076), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 315/991 (31%), Positives = 494/991 (49%), Gaps = 148/991 (14%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + +  + +M  +  +Q  V  +I++         G +SG  KV P+ G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PVPGVKQA 459

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNL----------QYGDIV 463
            ++ V+NGP+  PGA  +  +NE+        +    R  LA  L               V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVY 634
                  DG+    +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKIK 756

Query: 635  IPPKSK-SLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 693
                 K SL NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 694  AMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGKLET 753
             ++ + +L   ++    F+ G+      DDL++  E        + D L  S + G+   
Sbjct: 809  VLSVLGRLFTNYITATAFTCGM------DDLRLTAEG----NKWRTDILKTSVDTGRQAA 858

Query: 754  QPGCNEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI---------- 794
                N ++   A    LL +++E + D         V  ++++++ + ++          
Sbjct: 859  AEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMK 918

Query: 795  ---------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 845
                     MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        +
Sbjct: 919  KFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMA 978

Query: 846  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 905
             G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++
Sbjct: 979  GGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSI 1038

Query: 906  RTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQVMKKTN 965
            R +   +VQF YGG   D +++   +    F    D+               Y ++KK N
Sbjct: 1039 RDADGTLVQFMYGG---DAIDITKESHMTQFEFCLDNY--------------YALLKKYN 1081

Query: 966  EVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHLAHVRK 1025
                                + E LD +E A ++       KTL+   + K     H ++
Sbjct: 1082 P-----------------SALIEHLD-VESALKYSK-----KTLK--YRKKHIKEPHYKQ 1116

Query: 1026 SRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKA----VLKFLEIALSKYRK 1081
            S                    E   D   S +D+  K+ + A      KF  +   KY +
Sbjct: 1117 SIKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKGSKLFKSADGVNEKKFRALMQLKYMR 1176

Query: 1082 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTP 1140
            + + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1177 SLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTP 1236

Query: 1141 IINAVLVNN-NDERAARVVKGRVEKTMLSDV 1170
             +   + ++ +DE+A    K  + K +LS+V
Sbjct: 1237 QMTLPIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 7/131 (5%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  L+A +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD---NLGHPVSGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L+A C  C    L   +  +Y  +LR  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLL 125

Query: 129 TSGRIDNLKKM 139
             G ID   K+
Sbjct: 126 QYGLIDESYKL 136

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  418 bits (1075), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 313/994 (31%), Positives = 493/994 (49%), Gaps = 154/994 (15%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + +  + +M  +  +Q  V  +I++         G +SG  KV PI G  Q 
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PIPGVKQA 459

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNL----------QYGDIV 463
            ++ V+NGP+  PGA  +  +NE+        + +  R  LA  L               V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVY 634
                  DG+    +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIK 756

Query: 635  IPPKSK-SLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 693
                 K SL +E+   DG        +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLESEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 694  AMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGKLET 753
             ++ + +L   ++    F+ G+      DDL++  E        + D L  S + G+   
Sbjct: 809  VLSVLGRLFTNYITATAFTCGM------DDLRLTAEG----NKWRTDILKTSVDTGRQAA 858

Query: 754  QPGCNEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI---------- 794
                N ++   +    LL +++E + D         V  ++++ + + ++          
Sbjct: 859  AEVTNLDKETPSDDPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMK 918

Query: 795  ---------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 845
                     MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        +
Sbjct: 919  KFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMA 978

Query: 846  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 905
             G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++
Sbjct: 979  GGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSI 1038

Query: 906  RTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQVMKKTN 965
            R +   ++QF YGGD +D   +   +    F    D+               Y ++KK N
Sbjct: 1039 RDADGTLIQFMYGGDAVD---ITKESHMTQFEFCLDNY--------------YALLKKYN 1081

Query: 966  EVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHLAHVRK 1025
                                + E LD +E A ++       KTL+   + K     H ++
Sbjct: 1082 P-----------------SALIEHLD-VESALKYSK-----KTLK--YRKKHSKEPHYKQ 1116

Query: 1026 SRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCK-------ITEKAVLKFLEIALSK 1078
            S                    E   D   S +D+  K       + EK     +++   K
Sbjct: 1117 SMKYDPVLAKYSPAKYLGSVSENFQDKLESFLDENSKLFKSTDGVNEKKFRALMQL---K 1173

Query: 1079 YRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTI 1137
            Y ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I
Sbjct: 1174 YMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAI 1233

Query: 1138 STPIINAVLVNN-NDERAARVVKGRVEKTMLSDV 1170
             TP +   + ++ +DE+A    K  + K +LS+V
Sbjct: 1234 KTPQMTLPIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 7/131 (5%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  L+A +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD---NLGHPVSGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L+A C  C    L   +  +Y  +LR  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLL 125

Query: 129 TSGRIDNLKKM 139
             G ID   K+
Sbjct: 126 QYGLIDESYKL 136

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  417 bits (1072), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 292/885 (32%), Positives = 443/885 (50%), Gaps = 125/885 (14%)

Query: 345  GGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT 404
            GGKV PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT
Sbjct: 451  GGKV-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLT 509

Query: 405  YPEKVTRYNRKKLQELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ-- 458
            YPE VT YN  +L++ V+NGP+  PGA  +  +NE+        +    R  LA  L   
Sbjct: 510  YPEPVTSYNIAELRQAVINGPDKWPGAAQI--QNEDGSLVSLVGMSAEQRKALANQLMTP 567

Query: 459  --------YGDIVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPY 509
                        V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      Y
Sbjct: 568  SSNVGTHTLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAY 627

Query: 510  NADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKD 569
            NADFDGDEMN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KD
Sbjct: 628  NADFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKD 687

Query: 570  SFFDRATFTQLLSMM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSP 622
            SFF R  + Q +       DG+    +    PP I KP  LWTGKQ+ S +L+       
Sbjct: 688  SFFTREQYQQYIYGCIRPEDGHATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADM 747

Query: 623  VVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTI 682
              INL + NK+      KS       N+  V+ +   +L G++DKS  G   K  + +++
Sbjct: 748  PGINLTSSNKIKNEYWGKS------SNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSL 800

Query: 683  LRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDL 742
               YGP  AA  ++ + +L   ++ +  F+ G+      DDL++ +E        + D L
Sbjct: 801  HEVYGPSIAAKVLSVLGRLFTNYIMSTAFTCGM------DDLRLSEEG----NKWRSDIL 850

Query: 743  IDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNAPL 793
              S + G+       N ++   A    LL ++ E + D         V  ++++++ + +
Sbjct: 851  KTSVDTGREAAAEVTNLDKDTAADDAELLKRLEEILRDNNKSGILDAVTSSKVNSITSKV 910

Query: 794  I-------------------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 834
            +                   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP
Sbjct: 911  VSKCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLP 970

Query: 835  HFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 894
             F        + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K L
Sbjct: 971  SFKPYETDAMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQL 1030

Query: 895  EDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERG 954
            E +   YDN+VR     ++QF YGGD +D                               
Sbjct: 1031 EGVHVSYDNSVRDGDGTLIQFLYGGDAVD------------------------------- 1059

Query: 955  LLPYQVMKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQ 1014
                 V K+++  +   +  L  YD L N+     L  +E+ D   A +   KTL++  +
Sbjct: 1060 -----VTKESH--MTEFDFCLDNYDALLNKYNPSAL--IEHLDVETALKYSKKTLKN--R 1108

Query: 1015 SKSDHLAHVRKSRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCK-------ITEKA 1067
             K    AH + +                    E+  D   S +D+  K       ++EK 
Sbjct: 1109 KKHAKEAHHKNATKYDPVLSKFNPAKYLGSVSEKFQDKLESYLDKNSKLFKSHDNVSEK- 1167

Query: 1068 VLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRI 1127
              KF  +   KY ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR+
Sbjct: 1168 --KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRM 1225

Query: 1128 KEII-NASKTISTPIIN-AVLVNNNDERAARVVKGRVEKTMLSDV 1170
            +EII  AS  I TP +   +  + +DE+A    K  + K +LS+V
Sbjct: 1226 REIIMTASAAIKTPQMTLPIWQDVSDEQADTFCKS-ISKVVLSEV 1269

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R V    ++GKR L+ EG     +   +  I    +T N V  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 79/176 (44%), Gaps = 15/176 (8%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  L++ +I   S  +I++  + D   N     +G L D  +G    +L C +C
Sbjct: 10  EITSVDFGILTSEEIRQLSAKQITNPTVLD---NLGHPISGGLYDLSLGAFLRNL-CSSC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L+  C  C  + L   +  ++  +LR  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLRLL 125

Query: 129 ------TSGRIDNLKKMGILKKVMDQCKKQR-RCLHCGALNGVVKKAAAGSGTASL 177
                  S +ID++  +G LK  ++  + +    +    LN    K  A   +A L
Sbjct: 126 QYGLIDESYKIDDI-NIGDLKDFLENAQAEEDEAIEDNKLNESTTKRDANDISAQL 180

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  416 bits (1070), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 306/970 (31%), Positives = 477/970 (49%), Gaps = 129/970 (13%)

Query: 265  PPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------AGLEKG--------IS 309
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 310  INNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 369
             + +M  +  +Q  V  +I++            S GG V P+ G  Q L+ K+G FR ++
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-------GSTGGNV-PVPGVKQALEKKEGLFRKHM 475

Query: 370  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMNGPNIHP 429
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ V+NGP+  P
Sbjct: 476  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 535

Query: 430  GANYLLKKNEEARR----NLRYGDRLKLAKNLQYGDIV-----------ERHLEDGDVVL 474
            GA  L  +NE+        +    R  LA  L     V            RH+++ D+V+
Sbjct: 536  GA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVI 593

Query: 475  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 533
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 594  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 653

Query: 534  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMM---SDGNL- 589
            NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +       DG+  
Sbjct: 654  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHAT 713

Query: 590  --QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEM 646
              +    PPA+ KP  LWTGKQ+ + +L+         INL + NK+    K++      
Sbjct: 714  RPKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKSS 769

Query: 647  SRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFL 706
              N+  V+ +   +L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   ++
Sbjct: 770  EENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYI 826

Query: 707  GNRGFSIGISDVTPA--------DDLKIK----KEELVEIAYAKCDDLIDSYN--KGKLE 752
                F+ G+ D+           D LK      +E   E+   + D   D     K   E
Sbjct: 827  MATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQE 886

Query: 753  TQPGCNEEETLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGSTLNVS 808
                 N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +NVS
Sbjct: 887  VLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 946

Query: 809  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAIS 868
            Q++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++
Sbjct: 947  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMA 1006

Query: 869  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPMEME 928
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD        
Sbjct: 1007 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGD-------- 1058

Query: 929  GSAQPVNFNRSWDHALNITFNNNERGLLPYQVMKKTNEVLNPLEERLVRYDNLGNEVMKE 988
                          A+++T  ++         M K +  L   +  L +Y+      + E
Sbjct: 1059 --------------AVDVTKESH---------MTKFDFCLENYDALLKKYNP---SALIE 1092

Query: 989  DLDKLEYADQFDAERDFYKTLRSYIQSKSDHLAHVRKSRXXXXXXXXXXXXXXXXHPDER 1048
             LD +E A ++  +   Y+        K    AH ++S                    E+
Sbjct: 1093 HLD-VESALKYSKKSLKYR-------KKHAKEAHYKQSPKYDPVLAKYNPAKYLGSVSEK 1144

Query: 1049 ATDVSRSSVDQLCK-------ITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEP 1101
              D   + +D+  K       I+EK   KF  +   KY ++ + PG AVG I +QS+GEP
Sbjct: 1145 FQDKLETFIDKNSKLFKHNDDISEK---KFRALMQLKYMRSLINPGEAVGIIASQSVGEP 1201

Query: 1102 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTPIINAVLVNNNDERAARVVKG 1160
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  ++ A     
Sbjct: 1202 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSK 1261

Query: 1161 RVEKTMLSDV 1170
             + K +LS+V
Sbjct: 1262 SISKVLLSEV 1271

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            ++  +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V  V G+E
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGITSNDVSAVLKVYGVE 1560

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1561 AARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1619

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++N++  S  I++G+  ++GTGSF ++
Sbjct: 1620 ETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 7/135 (5%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +IS ++F   SA ++ A S  +I++  + D   N     +G L D  +G    ++ C +C
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD---NLGHPISGGLYDLALGAFLRNM-CASC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +   +  +LR  
Sbjct: 66  GLDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLRLL 125

Query: 129 TSGRIDNLKKMGILK 143
             G ID   K+  LK
Sbjct: 126 QHGLIDEAYKLDELK 140

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  416 bits (1070), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 314/991 (31%), Positives = 491/991 (49%), Gaps = 148/991 (14%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + +  + +M  +  +Q  V  +I++         G +SG  KV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSG--KV-PIPGVKQA 459

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNL----------QYGDIV 463
            ++ V+NGP+  PGA  +  +NE+        +    R  LA  L               V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVY 634
                  DG+    +    PPAI KPY LWTGKQ+ + ++  N   P +  INL + NK+ 
Sbjct: 698  GCIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKIK 756

Query: 635  IPPKSK-SLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 693
                 K SL NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 694  AMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGKLET 753
             ++ + +L   ++    F+ G+      DDL++  E        + D L  S + G+   
Sbjct: 809  VLSVLGRLFTNYITATAFTCGM------DDLRLTAEG----NKWRTDILKTSVDTGRQAA 858

Query: 754  QPGCNEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI---------- 794
                N  +   A    LL +++E + D         V  ++++ + + ++          
Sbjct: 859  AEVTNLNKDTPADDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMK 918

Query: 795  ---------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 845
                     MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        +
Sbjct: 919  KFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMA 978

Query: 846  KGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 905
             G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++
Sbjct: 979  GGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSI 1038

Query: 906  RTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQVMKKTN 965
            R +   +VQF YGG   D +++   +    F    D+               Y ++KK N
Sbjct: 1039 RDADGTLVQFMYGG---DAVDITKESHMTQFEFCLDNY--------------YALLKKYN 1081

Query: 966  EVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHLAHVRK 1025
                                + E LD +E A ++       KTL+   + K     H ++
Sbjct: 1082 P-----------------SALIEHLD-VESALKYSK-----KTLK--YRKKHSKEPHYKQ 1116

Query: 1026 SRXXXXXXXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKA----VLKFLEIALSKYRK 1081
            +                    E   D   S +D+  K+ + A      KF  +   KY +
Sbjct: 1117 AVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSADGVNEKKFRALMQLKYMR 1176

Query: 1082 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTP 1140
            + + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1177 SLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTP 1236

Query: 1141 IINAVLVNN-NDERAARVVKGRVEKTMLSDV 1170
             +   + ++ +DE+A    K  + K +LS+V
Sbjct: 1237 QMTLPIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++++ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  L+A +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD---NLGHPVSGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L+A C  C    L   +  +Y  +L+
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  409 bits (1051), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 311/979 (31%), Positives = 483/979 (49%), Gaps = 124/979 (12%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + I  N +M  +  +Q  V  +I++            S GGKV PI G  Q 
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-------GSTGGKV-PIPGVKQA 439

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  ++
Sbjct: 440  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEM 499

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ----YGDI------V 463
            ++ V+NGP+  PGA  +  +NE+        +    R  LA  L     +G        V
Sbjct: 500  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKV 557

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 558  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 617

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF R  + Q + 
Sbjct: 618  PQNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 677

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYI 635
                  DG+    +    PPA++KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 678  GCIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI-- 735

Query: 636  PPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 695
              K++        N+  VI +   +L G++DKS  G   K+ + +++   YGP  ++  +
Sbjct: 736  --KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 696  NRMSKLCARFLGNRGFSIGISDVTPAD-------DLKIKKEELVEIAYAKCDDLIDSYNK 748
            + + +L   ++ +  F+ G+ D+   D       D+  K  ++   A A+  +L      
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRP 850

Query: 749  GKLETQPGCNEEETLEAKIGGL-------LSKVREEVGDVCINELDNLNAPL----IMAT 797
               E      E    + K+G L       ++ +  EV   C+ +      P      MA 
Sbjct: 851  DDAELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMAL 910

Query: 798  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 857
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 911  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGI 970

Query: 858  TPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 917
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF Y
Sbjct: 971  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLY 1030

Query: 918  GGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQVMKKTNEVLNPLEERLVR 977
            GGD +D +  E       F      AL   +N       P  +++  +       E  ++
Sbjct: 1031 GGDAID-VTKESHMSEFKFCVDNYDALLKRYN-------PSALIQHLD------VESALK 1076

Query: 978  YDNLGNEVMKEDLDKLEYA--DQFDAERDFY---KTLRSYIQSKSDHLAHVRKSRXXXXX 1032
            Y     +  K++L+   YA  D++D     Y   K L S  ++  D L            
Sbjct: 1077 YSKKAMKNRKKNLNLPHYARHDKYDPVLSKYNPSKFLGSVSENFQDKL------------ 1124

Query: 1033 XXXXXXXXXXXHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGA 1092
                          E   D + S       + EK   KF  +   KY ++ + PG AVG 
Sbjct: 1125 --------------ESFIDSNASLFKGQATVNEK---KFRALMQLKYMRSLINPGEAVGI 1167

Query: 1093 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKTISTPIINAVLVNNND 1151
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ +  
Sbjct: 1168 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVT 1227

Query: 1152 ERAARVVKGRVEKTMLSDV 1170
            +  A +      K +LS+V
Sbjct: 1228 DETADIFCKNTTKVILSEV 1246

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            V+K +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 5/130 (3%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSLTCETCH 71
           +IS ++FS +SA++I A S  +I++  + D          G  D  +G    +L C TC 
Sbjct: 10  EISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR--T 129
            +   C GH GHI+L +P +   +F      L++ C  C    L   +  +Y  +L+   
Sbjct: 67  LDEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLKLLQ 126

Query: 130 SGRIDNLKKM 139
            G ID   K+
Sbjct: 127 YGLIDEAYKL 136

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  370 bits (950), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 251/741 (33%), Positives = 387/741 (52%), Gaps = 99/741 (13%)

Query: 250  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------A 302
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 303  GLEKG--------ISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGF 354
             L+K         +  + +M  +  +Q  V  +I++            S GGKV PI G 
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-------GSTGGKV-PIPGV 457

Query: 355  CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR 414
             Q L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN 
Sbjct: 458  KQALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNI 517

Query: 415  KKLQELVMNGPNIHPGANYLLKKNEEA-----------RRNLRYGDRLKLAKNLQYGDI- 462
             +L++ V+NGP+  PGA  +  +NE+            +RN      L  + N     + 
Sbjct: 518  AELRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLN 575

Query: 463  --VERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 519
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 576  KKVFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 635

Query: 520  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQ 579
            +H PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q
Sbjct: 636  MHFPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQ 695

Query: 580  LLSMM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPV---VINLDAK 630
             +       DG+    +    PPA+MKP  LWTGKQ+ + +I   + +P     INL +K
Sbjct: 696  YIYGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIM--NVTPADMPGINLLSK 753

Query: 631  NKVYIPPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQE 690
            NK+    K++      + N+  VI +   +L G++DKS  G   K+ + +++   YGP+ 
Sbjct: 754  NKI----KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPET 806

Query: 691  AANAMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGK 750
            AA  ++ + +L   F+ N  FS G+      DDL++  E   +    + D L  S + G+
Sbjct: 807  AAKVLSVLGRLFTNFITNTAFSCGM------DDLRLTAEGNKD----RKDLLKTSTDVGR 856

Query: 751  --------LETQPGCNEEETLE--------------------AKIGGLLSKVREEVGDVC 782
                    L T    N+ E L+                    +K+  + SKV   V    
Sbjct: 857  QAAAEVTNLPTDTPSNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKG 916

Query: 783  INELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 842
              +    N+   MA  G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F      
Sbjct: 917  TMKKFPQNSMQAMALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETD 976

Query: 843  PQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 902
              + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YD
Sbjct: 977  SMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYD 1036

Query: 903  NTVRTSSNGIVQFTYGGDGLD 923
            NTVR     +VQF YGGD +D
Sbjct: 1037 NTVRDGDGTLVQFLYGGDAVD 1057

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 85/162 (52%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTV-TNHVLEVSSVLGIE 1330
            V++ +P I+R +       +R L  EG   + +   +  I    + +N V  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A     ++ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +IS ++F+  SA +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EISSVDFNVFSAEEIRNLSAKQITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CATC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  366 bits (939), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 238/734 (32%), Positives = 385/734 (52%), Gaps = 95/734 (12%)

Query: 255  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------------ 301
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 302  --AGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLK 359
              +  ++ +  N +M  +  +Q  V  +I++           SS G KV PI G  Q L+
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQSSSGNKV-PIPGLKQALE 461

Query: 360  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQE 419
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQ 521

Query: 420  LVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNL---QYGDI-------VER 465
             V+NGP+  PGA  +  +NE+        +    R  LA  L      D+       V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYR 579

Query: 466  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 524
            H+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 525  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMM 584
             E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +   
Sbjct: 640  NENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 585  ---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYIPP 637
                DG+    +    PPA+MKP  LWTGKQ+ + +L+     +   INL++KNK+    
Sbjct: 700  IRPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI---- 755

Query: 638  KSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNR 697
            K++        N+  V+ +   +L G++DKS  G   K  + +++   YGP  AA  ++ 
Sbjct: 756  KNEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSV 812

Query: 698  MSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGC 757
            + +L   ++    F+ G+      DDL++  E        + D L  S + G++      
Sbjct: 813  LGRLFTNYITATAFTCGM------DDLRLTAEG----NKWRNDILQTSVDIGRVAAAEVT 862

Query: 758  NEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI-------------- 794
            N ++ +++  G LL ++ E + D         +  ++++++ + ++              
Sbjct: 863  NLDKDVKSDDGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPY 922

Query: 795  -----MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFV 849
                 MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G++
Sbjct: 923  NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYI 982

Query: 850  RNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSS 909
            +  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR   
Sbjct: 983  KGRFYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGD 1042

Query: 910  NGIVQFTYGGDGLD 923
              ++QF YGGD +D
Sbjct: 1043 GTLIQFLYGGDAVD 1056

 Score = 92.8 bits (229), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1070 KFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1129
            KF  +   KY ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1165 KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1224

Query: 1130 II-NASKTISTPIINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQ 1175
            II  AS  I TP +   + ++  +  A      + K MLS+V   +Q
Sbjct: 1225 IIMTASAAIKTPQLTMPIRDDVSDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTV-TNHVLEVSSVLGIE 1330
            +++ +P I R V    ++GKR L+ EG   + +   D  I    + +N V  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSLTCETCH 71
           +I+ I+FS L++ +I   S  ++++  + D   +  Q   G  D  +G    +L C TC 
Sbjct: 10  EITSIDFSVLTSDEIRKLSAKQVTNPTVLDNLGHPIQ--GGLYDLALGAFLKNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C    L   +   Y  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLR 123

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  365 bits (936), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 244/753 (32%), Positives = 384/753 (50%), Gaps = 104/753 (13%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + I  + +M  +  +Q  V  +I++            + GGKV PI G  Q 
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTK-------AQGNTGGKV-PIPGVKQA 445

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 446  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 505

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ----------YGDIV 463
            ++ ++NGP+  PGA+ +  +NE+        +    R  LA  L               V
Sbjct: 506  RQAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKV 563

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 564  YRHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 623

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q + 
Sbjct: 624  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 683

Query: 583  MM---SDGN---LQFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVY 634
                  DG+    +    PPAI KP  LWTGKQ+ + ++  N   P +  INL + NK+ 
Sbjct: 684  GCIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI- 741

Query: 635  IPPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 694
               K++        ND  VI +   +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 742  ---KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKV 795

Query: 695  MNRMSKLCARFLGNRGFSIGISDVTPADD------------LKIKKEELVEIA------- 735
            ++ + +L   ++ N  F+ G+ D+    D            + I ++   E+        
Sbjct: 796  LSVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTP 855

Query: 736  ------YAKCDDLIDSYNKGKLETQPGCNEEETLEAKI------GGLLSKVREEVGDVCI 783
                    + ++++   NK  +       +  T+ +K+      GG + K  E       
Sbjct: 856  SNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPE------- 908

Query: 784  NELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 843
                  N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       
Sbjct: 909  ------NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDA 962

Query: 844  QSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 903
             + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN
Sbjct: 963  MAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDN 1022

Query: 904  TVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNF 936
            +VR +   ++QF YGGD +D ++ E      NF
Sbjct: 1023 SVRDADGTLIQFLYGGDAVDVIK-ESHMTEFNF 1054

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 71/121 (58%), Gaps = 4/121 (3%)

Query: 1051 DVSRSSVDQLCKITEKAVLKFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTF 1110
            D S  +  +   I EK   KF  +   KY ++ + PG AVG I +QS+GEP TQMTL TF
Sbjct: 1135 DKSSKTFKEYESINEK---KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTF 1191

Query: 1111 HFAGVASMNVTLGVPRIKEII-NASKTISTPIINAVLVNNNDERAARVVKGRVEKTMLSD 1169
            HFAG  + NVTLG+PR++EII  AS  I TP +   + N+  +  A      + K +LS+
Sbjct: 1192 HFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDETADTFCKSISKVILSE 1251

Query: 1170 V 1170
            V
Sbjct: 1252 V 1252

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R +    ++GKR L+ EG   + +   +  I    +T N +  V    G+E
Sbjct: 1478 IIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGVE 1537

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1538 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1596

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1597 ETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +IS ++F  L+++DI   S   I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EISSVDFGILTSADIRNLSAKRITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CGTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   D  +Y  +LR
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  364 bits (935), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 237/734 (32%), Positives = 380/734 (51%), Gaps = 91/734 (12%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------AGLE 305
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 306  KG--------ISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
            K         +  + +M  +  +Q  V  +I++            + GGKV PI G  Q 
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ----------YGDIV 463
            ++ V+NGP+  PGA+ +  +NE+        +    R  LA  L               V
Sbjct: 515  RQAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKV 572

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLL- 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 692

Query: 582  -----SMMSDGNLQFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYI 635
                         +    PPA+ KP  LWTGKQ+ + +L+         INL++ NK+  
Sbjct: 693  GCIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI-- 750

Query: 636  PPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 695
              K++   N  + ND  VI +   +L G++DKS  G   K+ + +++   YGP  AA  +
Sbjct: 751  --KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVL 805

Query: 696  NRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAY-----AKCDDLIDSYNKGK 750
            + + +L   ++    F+ G+ D+   D+    ++++++ +      A C+          
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACE-------VTN 858

Query: 751  LETQPGCNEEETLE--------------------AKIGGLLSKVREE-VGDVCINELDNL 789
            LE +   ++ E L+                    +K+  + SKV  + V D  + +    
Sbjct: 859  LEKETASDDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-Y 917

Query: 790  NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFV 849
            N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G++
Sbjct: 918  NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYI 977

Query: 850  RNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSS 909
            +  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR   
Sbjct: 978  KGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGD 1037

Query: 910  NGIVQFTYGGDGLD 923
              ++QF YGGD +D
Sbjct: 1038 GTLIQFLYGGDSVD 1051

 Score = 92.4 bits (228), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 1070 KFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1129
            KF  +   KY ++ + PG +VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1160 KFRALMQLKYMRSLINPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1219

Query: 1130 II-NASKTISTPIINAVLVNNNDERAARVVKGRVEKTMLSDV 1170
            II  AS  I TP +   ++++  +  A V    + K +LS+V
Sbjct: 1220 IIMTASAAIKTPQMTLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            V++ +P I R V    ++GKR L+ EG   + +   +  IG   +T N V  V    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 46.6 bits (109), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ I+FS L+A +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSIDFSILTAQEIRNLSAKQITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +Y  +L+
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  362 bits (930), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 241/726 (33%), Positives = 377/726 (51%), Gaps = 99/726 (13%)

Query: 265  PPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------AGLEKG--------IS 309
            PP   R PS +  +   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 310  INNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 369
             + +M  +  +Q  V  +I++            +  GK+ P+ G  Q L+ K+G FR ++
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVPGVKQALEKKEGLFRKHM 465

Query: 370  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMNGPNIHP 429
             GKRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L++ V+NGP+  P
Sbjct: 466  MGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 525

Query: 430  GANYLLKKNEEARR----NLRYGDRLKLAKNLQ----------YGDIVERHLEDGDVVLF 475
            GA  +  +NE+        +    R  LA  L               V RH+++ DVV+ 
Sbjct: 526  GATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIM 583

Query: 476  NRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 534
            NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA N
Sbjct: 584  NRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN 643

Query: 535  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMM---SDG---N 588
            L    +  LTP SG P+    QD I+    ++ KDS+F R  + Q +       DG   N
Sbjct: 644  LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSAN 703

Query: 589  LQFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPV---VINLDAKNKVYIPPKSKSLPNE 645
             +    PPAI+KP  LWTGKQ+ + ++   + SPV    INL +KNK+    K +     
Sbjct: 704  NKLLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWGQH 757

Query: 646  MSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARF 705
               N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L   +
Sbjct: 758  SEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNY 814

Query: 706  LGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEA 765
            + N  F+ G+      DDL++  E        + D L  S ++G+       N E+   A
Sbjct: 815  ITNTAFTCGM------DDLRLTDEG----NKWRTDILKTSVDRGRQAAVEVTNLEKDTSA 864

Query: 766  KIGGLLSKVREEVGD---------VCINELDNLNAPLI-------------------MAT 797
                LL ++ E + D         V  ++++ + + ++                   MA 
Sbjct: 865  DDSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMAL 924

Query: 798  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 857
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 925  SGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGI 984

Query: 858  TPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 917
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F Y
Sbjct: 985  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLY 1044

Query: 918  GGDGLD 923
            GGD +D
Sbjct: 1045 GGDAVD 1050

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 94/164 (57%), Gaps = 6/164 (3%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHVLEVSSVL---G 1328
            VV+ +P I R V    ++GKR L+ EG   + +   +  +    +T++  +VSSVL   G
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGITSN--DVSSVLKTYG 1538

Query: 1329 IEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLA 1388
            +EAAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ 
Sbjct: 1539 VEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLMKM- 1597

Query: 1389 SFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            S+E T   L  A    +++ +   S  I+LG+  ++GTG+F V+
Sbjct: 1598 SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++FS LSA +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFSILSAEEIRNLSTKQITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +Y  +L+  
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLKLL 125

Query: 129 ------TSGRIDNLKKMGILKKVMD 147
                  S +IDNL   G+ + + D
Sbjct: 126 QYGLIEESYQIDNLTIGGLDESITD 150

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  356 bits (913), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 234/729 (32%), Positives = 377/729 (51%), Gaps = 104/729 (14%)

Query: 265  PPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------AGLEKG--------IS 309
            PP   R PS + ++   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 310  INNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNL 369
             + +M  +  +Q  V  +I++         G +SG  KV P+ G  Q L+ K+G FR ++
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTKAQ-----GNTSG--KV-PVPGVKQALEKKEGLFRKHM 470

Query: 370  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQELVMNGPNIHP 429
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L++ V+NGP+  P
Sbjct: 471  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWP 530

Query: 430  GANYLLKKNEEARR----NLRYGDRLKLAKNLQ-----------YGDIVERHLEDGDVVL 474
            GA  +  +NE+        +    R  LA  L                V RH+++ D+V+
Sbjct: 531  GATQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVI 588

Query: 475  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 533
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 589  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 648

Query: 534  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMM---SDGN-- 588
            NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q +       DG+  
Sbjct: 649  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHAT 708

Query: 589  -LQFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVYIPPKSKSLPNE 645
              +    PPA+MKP  LWTGKQ+ + ++  N   P +  INL + NK+      K     
Sbjct: 709  RAKLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKIKNDYWGK----- 762

Query: 646  MSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARF 705
               N+  VI +   +L G++DKS  G   K+ + + +   YGP  +A A++ + +L   +
Sbjct: 763  -GSNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNY 820

Query: 706  LGNRGFSIGISDVTPADDLKIKKEELVEIA-------------------------YAKCD 740
            +    F+ G+ D+   ++    ++E+++ +                           + +
Sbjct: 821  ITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLE 880

Query: 741  DLIDSYNKGKLETQPGCNEEETLEAKI------GGLLSKVREEVGDVCINELDNLNAPLI 794
            ++I   NK  +      ++  T+ +K+      GG + K  E             N+   
Sbjct: 881  EIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE-------------NSMQS 927

Query: 795  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 854
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+
Sbjct: 928  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFY 987

Query: 855  SGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 914
            SG+ P E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q
Sbjct: 988  SGIRPQEYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQ 1047

Query: 915  FTYGGDGLD 923
              YGGD +D
Sbjct: 1048 MLYGGDAID 1056

 Score = 92.0 bits (227), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 1070 KFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1129
            KF  +   KY ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1165 KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLRE 1224

Query: 1130 II-NASKTISTPIINAVLVNNNDERAARVVKGRVEKTMLSDV 1170
            II  AS  I TP +   ++++  +  A      + K +LS+V
Sbjct: 1225 IIMTASAAIKTPQMTLPILDDVTDEQADTFAKSISKVVLSEV 1266

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTV-TNHVLEVSSVLGIE 1330
            V++ +P+I R V    ++GKR L+ EG     +   +  I    + +N V  V    G+E
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGIRSNDVSAVLKTYGVE 1554

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++++ EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++++ S+
Sbjct: 1555 AARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1613

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ +   S  I+LG+  ++GTGSF V+
Sbjct: 1614 ETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 79/166 (47%), Gaps = 13/166 (7%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++FS L++ DI + S  +I +  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFSILTSKDIRSLSAKQIINPTVLD---NLGHPISGGLYDLSLGAFLRNL-CTTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR-- 128
             +   C GH GHI+L +PV++  +F      L++ C  C    L   +  ++  +L+  
Sbjct: 66  GLDEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLKLL 125

Query: 129 TSGRIDNLKKM-----GILKKVMDQCKKQRRCLHCGALNGVVKKAA 169
             G ID   K+     G L+ +MD+ +     +    LNG   KA+
Sbjct: 126 QYGLIDESYKLDEIAVGDLQHLMDEAEND-EAMEDNTLNGGSVKAS 170

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  355 bits (910), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 218/631 (34%), Positives = 338/631 (53%), Gaps = 70/631 (11%)

Query: 343  SGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKV 402
            + GGK+ PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  
Sbjct: 454  TAGGKL-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATK 512

Query: 403  LTYPEKVTRYNRKKLQELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ 458
            LTYPE VT YN  +L++ V+NGP+  PGA  +  +NE+        +    R  LA  L 
Sbjct: 513  LTYPEPVTSYNIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLM 570

Query: 459  ----------YGDIVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCT 507
                          V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+     
Sbjct: 571  TPSSNITTHTLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTG 630

Query: 508  PYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISH 567
             YNADFDGDEMN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ 
Sbjct: 631  AYNADFDGDEMNMHFPQNENARAEASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTS 690

Query: 568  KDSFFDRATFTQLLSMM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHK 620
            KDSFF R  + Q +       DG+    +    PP I KP  LWTGKQ+ S +L+     
Sbjct: 691  KDSFFTREQYQQYIYGCIRPEDGHATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPA 750

Query: 621  SPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFY 680
            +   INL + NK+    K++        N+  V+ +   +L G++DKS  G   K  + +
Sbjct: 751  NMPGINLKSSNKI----KNEYWGTGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVH 803

Query: 681  TILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEELVEIAYAKCD 740
            ++   YGP  AA  ++ + +L   ++ +  F+ G+      DDL++ +E        + D
Sbjct: 804  SLHEVYGPSVAAKVLSVLGRLFTNYIMSTAFTCGM------DDLRLTEEG----NKWRSD 853

Query: 741  DLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD---------VCINELDNLNA 791
             L  S + G+       N ++   A    LL +++E + D         V  ++++++ +
Sbjct: 854  ILKTSVDTGREAAAEVTNLDKDTPANDPELLKRLQEILRDNNKSGILDAVTSSKVNSITS 913

Query: 792  PLI-------------------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRS 832
             ++                   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++
Sbjct: 914  KVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKT 973

Query: 833  LPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 892
            LP F        + G+V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K
Sbjct: 974  LPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTK 1033

Query: 893  SLEDLSCQYDNTVRTSSNGIVQFTYGGDGLD 923
             LE +   YDN+VR +   ++QF YGGD +D
Sbjct: 1034 QLEGIHISYDNSVRDTDGTLIQFLYGGDAVD 1064

 Score = 92.0 bits (227), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 68/103 (66%), Gaps = 3/103 (2%)

Query: 1070 KFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1129
            KF  +   KY ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1173 KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1232

Query: 1130 II-NASKTISTPIINAVLVNN-NDERAARVVKGRVEKTMLSDV 1170
            II  AS  I TP +   + N+ +DE+A    K  + K +LS+V
Sbjct: 1233 IIMTASAAIKTPQMTLPIWNDVSDEQADTFCKS-ISKVVLSEV 1274

 Score = 89.7 bits (221), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            +++ +P I R +    ++GKR L+ EG     +   +  I    +T N V  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  L++ +I   S  +I++  + D   N      G L D  +G    +L C TC
Sbjct: 10  EITSVDFGILTSDEIRQLSAKQITNPTVLD---NLGHPITGGLYDLSLGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  350 bits (899), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 233/729 (31%), Positives = 369/729 (50%), Gaps = 81/729 (11%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLI----------- 300
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 301  --KAGLE-KGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
              K  LE + +  + +M  +  +Q  V  +I++           ++GG  V P  G  Q 
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP--GVKQA 461

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 462  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAEL 521

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQ----------YGDIV 463
            ++ V+NGP+  PGA  +  +NE+        +    R  LA  L               V
Sbjct: 522  RQAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKV 579

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 580  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 639

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF R  + Q + 
Sbjct: 640  PQNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 699

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFS-LLIKPNHKSPVVINLDAKNKVYI 635
                  DG+    +    PP I KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 700  GCIRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI-- 757

Query: 636  PPKSKSLPNEM---SRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA 692
                    NE      N+  VI +   +L G++DK+  G  K + + +++   YGP  AA
Sbjct: 758  -------KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAA 809

Query: 693  NAMNRMSKLCARFLGNRGFSIGISDVTPADD------------LKIKKEELVEIAYAKCD 740
              ++ + +L   ++    F+ G+ D+   D+            +   ++   E+     D
Sbjct: 810  KVLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKD 869

Query: 741  DLIDSYN--KGKLETQPGCNEEETLEAKIGGLLSKVREEVGDVCI--NELDNL--NAPLI 794
               D     K   E     N+   L+A     ++ +  +V   C+    +     N+   
Sbjct: 870  TPADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQA 929

Query: 795  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 854
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 930  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFY 989

Query: 855  SGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 914
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++
Sbjct: 990  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIE 1049

Query: 915  FTYGGDGLD 923
            F YGGD +D
Sbjct: 1050 FLYGGDAVD 1058

 Score = 95.5 bits (236), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1070 KFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1129
            KF  +   KY ++ ++PG +VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1167 KFRALMQLKYMRSLIDPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1226

Query: 1130 II-NASKTISTPIINAVLVNNNDERAARVVKGRVEKTMLSDVA 1171
            II  AS +I TP +N  ++N+   + A      + K +LS V 
Sbjct: 1227 IIMTASSSIKTPQMNLPILNDVSNQQAETFCKSITKVLLSQVT 1269

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIG-SKTVTNHVLEVSSVLGIE 1330
            V++ +P I R V    ++G R L+ EG   + +   D  I   K  +N V  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    + + +   S  I+LG+  ++GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I+ ++F  LS+  I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EITSVDFEILSSDQIRNLSAKQITNPTVLD---NLGHPISGGLYDLALGAFLRNL-CSTC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   D   Y  +L+
Sbjct: 66  GQDEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  344 bits (882), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 238/730 (32%), Positives = 374/730 (51%), Gaps = 83/730 (11%)

Query: 253  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTIKLTEIVWTSSLIK------AGLE 305
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 306  KG--------ISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQR 357
            K         +  N +M  +  +Q  V  +I+       +     + GGKV PI G  Q 
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQA 448

Query: 358  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKL 417
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 449  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEL 508

Query: 418  QELVMNGPNIHPGANYLLKKNEEARR----NLRYGDRLKLAKNLQYGDI----------V 463
            ++ V+NGP+  PGA  +  +NE+        +    R  LA  L               V
Sbjct: 509  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKV 566

Query: 464  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 522
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 567  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 626

Query: 523  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLS 582
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q + 
Sbjct: 627  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 686

Query: 583  MM---SDGNL---QFDIPPPAIMKPYYLWTGKQLFSLLIKPNHKSPVV--INLDAKNKVY 634
                  DG+    +    PPA++KP  LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 687  GCIRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI- 744

Query: 635  IPPKSKSLPNEM---SRNDGFVIIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 691
                     NE      N+  VI +   +L G++DKS  G   K  + +++   YGP  A
Sbjct: 745  --------KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIA 795

Query: 692  ANAMNRMSKLCARFLGNRGFSIGISDVTPADDLKIKKEEL----VEIAYAKCDDLIDSYN 747
               ++ + +L   ++    F+ G+ D+   ++    + E+    V+I  A   ++ +   
Sbjct: 796  GKVLSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEG 855

Query: 748  KGKL----------ETQPGCNEEETLEAKIGGLLSKVREEVGDVCINELDNLNAPL---- 793
              K           E     N+   L+A     ++ +  +V   C+ +      P     
Sbjct: 856  DVKADDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQ 915

Query: 794  IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSF 853
             MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F
Sbjct: 916  AMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRF 975

Query: 854  FSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIV 913
            +SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++
Sbjct: 976  YSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLI 1035

Query: 914  QFTYGGDGLD 923
            QF YGGD +D
Sbjct: 1036 QFLYGGDAVD 1045

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 67/103 (65%), Gaps = 3/103 (2%)

Query: 1070 KFLEIALSKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1129
            KF  +   KY ++ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1154 KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1213

Query: 1130 II-NASKTISTPIIN-AVLVNNNDERAARVVKGRVEKTMLSDV 1170
            II  AS  I TP +   +L +  D++A    K  + K MLS+V
Sbjct: 1214 IIMTASAAIKTPQMTLPILPDVTDDQADTFCKS-ITKVMLSEV 1255

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1272 VVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVT-NHVLEVSSVLGIE 1330
            V+  +P I R V    ++GKR L+ EG   + +   +  I    +T N V  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1331 AARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1390
            AAR++I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1391 EKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVV 1432
            E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 12  KISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGAL-DPRMGVSSSSLTCETC 70
           +I  ++FS L+A +I   S  +I++  + D   N     +G L D  +G    +L C TC
Sbjct: 10  EIISVDFSVLTAQEIRKLSAKQITNPTVLD---NLGHPISGGLYDLSLGAFLRNL-CATC 65

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELR 128
             +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +Y  +L+
Sbjct: 66  GLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 134/291 (46%), Gaps = 30/291 (10%)

Query: 7   SEAP-KKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGVSSSSL 65
           S AP + I  ++F   S  ++ A S  +I   +  D  Q R  K  G  DPR+G    ++
Sbjct: 7   SSAPVRTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNV 65

Query: 66  TCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLH 125
            C+TC   +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LL + ++     
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNE----- 120

Query: 126 ELRTSGRIDNLKKMGILKKVMDQCKKQRRC-LHCGALNGVVKKAA-AGSGTASLKIIHDT 183
           ++  + +I + KK      V   CK +  C     + +   K  +  G G A   I  D 
Sbjct: 121 QMNQAIKIKDPKKR--FNAVWTLCKTKMICETDVPSEDDPTKLVSRGGCGNAQPTIRKDG 178

Query: 184 FRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDCELL 243
            + VG        +W  D N      PE +R        L+  + LN+FK +  ED   L
Sbjct: 179 LKLVG--------SWKKDKNTNDGDEPE-QRV-------LSTEEILNIFKHISSEDYIRL 222

Query: 244 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIV 294
           G +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 223 GFNEEF--ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1290

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 90   VFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELRTSGRIDNLKKMGILKKVMDQC 149
            +   G  + T++I    C+ C  +L+++  K+K+  E + +GR + +K+ G      D C
Sbjct: 1182 ILEAGNGQCTVRIY---CERCKKLLVNESSKEKFTEEWKRTGRQEVMKRFGYW--YCDNC 1236

Query: 150  KKQRR-CLHC 158
             K+   C+ C
Sbjct: 1237 SKRNTLCVLC 1246

>KLLA0D13068g Chr4 complement(1117229..1119862) [2634 bp, 877 aa]
           {ON} weakly similar to uniprot|P32454 Saccharomyces
           cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
           yscII and to YHR047C uniprot|P37898 Saccharomyces
           cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase
          Length = 877

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 340 GASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAV 395
           G SSG GK+ P++ +  + K +QG+F  +++ + +DF   +   P P   +D + V
Sbjct: 233 GTSSGCGKL-PVKVYTAKGKAQQGKFALDVAKRVIDFFSESFEIPYPLPKLDLLCV 287

>CAGL0M01386g Chr13 (155052..159335) [4284 bp, 1427 aa] {ON} similar
           to uniprot|Q06681 Saccharomyces cerevisiae YDR326c
          Length = 1427

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 17/113 (15%)

Query: 617 PNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRG------SNILSGVMDKSVL 670
           PNH    + N + +N  YI      +   +  N G  I RG      +N  S V+D+ + 
Sbjct: 483 PNHPGMPIFNENYRNSSYI-----DVQRHLGLNKGNEIGRGRSRTLPTNDASAVLDQKIE 537

Query: 671 GDGKKHSVFYTILRDYGPQEAANAMNRMSK-LCARFLGNRGFSIGI-SDVTPA 721
           GD K++S   T+  D    E     +R  + L  +FL  R FS  I S V P+
Sbjct: 538 GDSKRNSRITTLSND----EIVGDNDRKPRSLSRKFLNRRSFSPSIGSKVLPS 586

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
            complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 40/96 (41%), Gaps = 4/96 (4%)

Query: 103  LQAICKNCSSVLLSDEDKKKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRR-CLHC-GA 160
            +Q  C  C  +++++  K  +  EL+ +G  D++KK G      D CKK    C+ C   
Sbjct: 1216 VQLFCDKCGKLIVNEFSKTNFNEELKRTGNKDSMKKFGYW--YCDACKKPNSLCVLCEKP 1273

Query: 161  LNGVVKKAAAGSGTASLKIIHDTFRWVGKKSTPEKD 196
            +  +V    A       + + D F   G    P  D
Sbjct: 1274 MKKLVMCVLACGHEGHFQCLRDWFLNEGMNECPAGD 1309

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 35/88 (39%), Gaps = 17/88 (19%)

Query: 316 HWDYLQLTVAMYINADSVNPAMLP--------GASSGGGKVKPIRGFCQRLKGKQGRFRG 367
           H+DY++         DS    + P          SSG     PIR F  + K  QGRF  
Sbjct: 203 HYDYIE---------DSTEKKIYPTLDGYDIRDGSSGTKGSLPIRLFTAKGKSHQGRFAM 253

Query: 368 NLSGKRVDFSGRTVISPDPNLSIDEVAV 395
           N++ + VD        P P   +D V V
Sbjct: 254 NVTRRVVDLFSELFEIPYPLPKLDIVCV 281

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 90   VFHVGYFKATIQILQAICKNCSSVLLSDEDKKKYLHELRTSGRIDNLKKMGILKKVMDQC 149
            +   G  + T++I    C NC  +L+++  K+K+  E + +GR + +K+ G      D C
Sbjct: 1177 ILGSGTGQCTVRIY---CHNCKKLLVNESSKEKFTEEWKRTGRQEAMKRFGYW--YCDLC 1231

Query: 150  KKQRR-CLHC 158
             +    C  C
Sbjct: 1232 SRMNTLCALC 1241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 152,762,047
Number of extensions: 6831905
Number of successful extensions: 19742
Number of sequences better than 10.0: 70
Number of HSP's gapped: 19837
Number of HSP's successfully gapped: 163
Length of query: 1462
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1340
Effective length of database: 39,492,147
Effective search space: 52919476980
Effective search space used: 52919476980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)