Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D046705.351ON73173139450.0
Kpol_339.125.351ON73373332140.0
TPHA0E011205.351ON73372932020.0
YHR072W (ERG7)5.351ON73172631100.0
KNAG0B045805.351ON72972530990.0
Suva_15.2625.351ON73173130990.0
Smik_8.1485.351ON73173130890.0
TDEL0E027605.351ON73173130790.0
CAGL0J10824g5.351ON73372230640.0
NCAS0H016405.351ON72872730570.0
NDAI0C019705.351ON73172530490.0
Skud_8.1315.351ON73173130410.0
TBLA0A031205.351ON74372629900.0
SAKL0G08844g5.351ON74673129570.0
ZYRO0D10164g5.351ON73273229420.0
KLLA0B10175g5.351ON73173128780.0
Kwal_34.159795.351ON72872328630.0
KLTH0H14850g5.351ON72672328450.0
AGR351W5.351ON72972827140.0
Ecym_81825.351ON73273227120.0
TPHA0I032307.533ON324189761.4
TPHA0D022005.372ON51658707.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D04670
         (731 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1524   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1242   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1238   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1202   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1198   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1198   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1194   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1190   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1184   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1182   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1179   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1176   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1156   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1143   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1137   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1113   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1107   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1100   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1050   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1049   0.0  
TPHA0I03230 Chr9 complement(713161..714135) [975 bp, 324 aa] {ON...    34   1.4  
TPHA0D02200 Chr4 complement(454720..456270) [1551 bp, 516 aa] {O...    32   7.6  

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1524 bits (3945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/731 (100%), Positives = 731/731 (100%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP
Sbjct: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
           NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI
Sbjct: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD
Sbjct: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL
Sbjct: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK
Sbjct: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
           AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP
Sbjct: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF
Sbjct: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE
Sbjct: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME
Sbjct: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI
Sbjct: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGAQGI 731
           LYVKEYGAQGI
Sbjct: 721 LYVKEYGAQGI 731

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/733 (78%), Positives = 652/733 (88%), Gaps = 2/733 (0%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           M  FYS+E+GLEKTDP+LWRLRTD LGR++W+Y+   DA+ DPQ+++ QWLLQ+P FP+P
Sbjct: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60

Query: 61  NP--DIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGI 118
           +P  +  N ++++TA DAC+NGA+FFKLLQD NSGIFPCQYKGPMFMTIGY+AVNYIAG+
Sbjct: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120

Query: 119 EIPEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRA 178
           +IP+HE+IELIRYIVNTAHPVDGGWGLHSVDKST FGT +NYV LRLLGLSK H VCV+A
Sbjct: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180

Query: 179 RDTLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGV 238
           RDTL++LGGAIG PHWGK WLS LNLY WEGVNPAPPETWLLPY L IHPGRWWVHTRGV
Sbjct: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240

Query: 239 YLPISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTA 298
           YLPISYLSLVRYS E TPLL E+R+EIY KPFD I+FS+HRNTVCGVDLYYPHS +LD A
Sbjct: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300

Query: 299 NKAIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVES 358
           N  IV YEK+LRP W+ +KS++ +Y+LI+KE +NTDYLCIAPVNQAFCAL TLIEEG +S
Sbjct: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360

Query: 359 KPFRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAF 418
           + F++++ RFKDALFHGPQGMTV GTNGVQ WDCAFAIQY F+AGLAE+PEFYD +  A+
Sbjct: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420

Query: 419 KFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIH 478
           +FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAE+IKAIIMVRNS VF  +H
Sbjct: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480

Query: 479 DEITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYV 538
           D+I+DERL KGID+L+ LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYV
Sbjct: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 539 ECTDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFA 598
           ECTDSSVLGLT+FH+H  YR EEI++RI+LAI YIK+ QQ+DGSWYG WGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600

Query: 599 MEALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWV 658
           MEAL +VGE Y NS+ V KGCDFLVSKQM DGGW ESMKSSELH+YV +++SLVVQTAWV
Sbjct: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660

Query: 659 LIALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 718
           L+ALLLA+YPDK VIDRGI LLK RQ PSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720

Query: 719 LGLYVKEYGAQGI 731
           LGLY K Y   GI
Sbjct: 721 LGLYTKAYSDNGI 733

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/729 (78%), Positives = 645/729 (88%), Gaps = 1/729 (0%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAE-SDPQTTFVQWLLQLPGFPSPNP 62
           FYS+++GL KTDP+ WRLRTD+LGR++W+Y+ + + + +D Q+T+ +WLLQ+P FP+PNP
Sbjct: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64

Query: 63  DIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPE 122
            I +   +F A++AC+NGA+F+KLLQD  SG+FPCQYKGPMFM IGY+AVNYIAGIEIP+
Sbjct: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124

Query: 123 HEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTL 182
           HE+IE+IRYIVNT+HPVDGGWGLHSVDKST FGTA+NYV LRLLGLSK H VCV+ARDTL
Sbjct: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184

Query: 183 LRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPI 242
           +RLGGAIG PHWGKIWLS LNLY WEGVNPAPPETWLLPY LPIHPGRWWVHTRGVY+P+
Sbjct: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244

Query: 243 SYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAI 302
           SYLSL +Y+ E TPLL EIR EIY K F+ I+FS+HRNTVCGVDLYYPHS LLD AN  +
Sbjct: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304

Query: 303 VLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFR 362
           V YE +LRP W+ EKSRK++YELI+KE +NTDYLCIAPVNQAFCAL TLIEEG  SK F 
Sbjct: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364

Query: 363 KYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLC 422
           ++Q R KDALFHGPQGMTV GTNG Q WDCAF IQY F+AGLAE+PEFYDA+SAA+KFLC
Sbjct: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424

Query: 423 RSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEIT 482
           RSQFDTEC PGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSP FAKIH+E +
Sbjct: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484

Query: 483 DERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTD 542
           DERL KGIDIL+ LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVECTD
Sbjct: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544

Query: 543 SSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEAL 602
           SSVLGLTYFH+HY Y+ EEIS RI+LAI YIK+ QQ DGSWYG WGICFTYAGMFAMEAL
Sbjct: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604

Query: 603 QSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIAL 662
           ++VGE Y+NS+ V KGCDFLV KQM DGGWSESMKSSELHTYVS++ SLVVQTAWVLIAL
Sbjct: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIAL 664

Query: 663 LLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 722
           LLAKYP K VIDRGI LLKSRQ+PSGEWKFE VEGVFNHSCAIEY SYRFLFPIKALGLY
Sbjct: 665 LLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLY 724

Query: 723 VKEYGAQGI 731
           VK YG   I
Sbjct: 725 VKNYGNDSI 733

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1202 bits (3110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/726 (76%), Positives = 635/726 (87%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT FYSD +GL KTDPRLWRLRTD+LGR++W+Y+    A +DP +TF QWLLQ P FP P
Sbjct: 1   MTEFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
           +P+       F+A DAC+NGA+FFKLLQ+ +SGIFPCQYKGPMFMTIGYVAVNYIAGIEI
Sbjct: 61  HPERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+IELIRYIVNTAHPVDGGWGLHSVDKST FGT +NYVILRLLGL K H VC +AR 
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARS 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLLRLGGAIG PHWGKIWLS LNLY WEGVNPAPPETWLLPY LP+HPGRWWVHTRGVY+
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLSLV++S   TPLLEE+R EIY KPFD INFS++RNTVCGVDLYYPHST L+ AN 
Sbjct: 241 PVSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANS 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            +V YEK+LR  ++   S+K +Y+LI+ E QNTD LCIAPVNQAFCAL TLIEEGV+S+ 
Sbjct: 301 LVVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEA 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F++ Q RFKDALFHGPQGMT+ GTNGVQTWDCAFAIQY F+AGLAE+PEFY+ + +A+KF
Sbjct: 361 FQRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LC +QFDTECVPGS+RDKR GAWGFSTKTQGYTV+DCTAE+IKAIIMV+NSPVF+++H  
Sbjct: 421 LCHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHM 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           I+ ERL +GID+LL+LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ISSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH+++ YR EEI  RI++AI +IK +Q  DGSWYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALE 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL +VGE YENS  V KGCDFLVSKQM DGGW ESMKSSELH+YV +++SLVVQTAW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+YP+K+VIDRGI LLK+RQE SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEY 726
           +Y + Y
Sbjct: 721 MYSRAY 726

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1198 bits (3099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/725 (76%), Positives = 634/725 (87%), Gaps = 5/725 (0%)

Query: 3   TFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNP 62
             YS+++GL +TDP+ WRLRTD+LGR+TWDYI +   E DPQ++F QWLLQ+    +  P
Sbjct: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAP 64

Query: 63  DIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPE 122
                 +  TA D+C NGA FFK LQD +SG+FPCQYKGPMFMTIGY+AVNYIAGIEIP+
Sbjct: 65  K-----EPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPK 119

Query: 123 HEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTL 182
           HE++E+IRYIVNT+HPVDGGWGLHSVDKST FGT +NYVILRLLGL + H VC++ARDTL
Sbjct: 120 HERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTL 179

Query: 183 LRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPI 242
           LRLGGAIG PHWGKIWLSVLNLY WEGVNPAPPETWLLPY LPIHPG+WWVHTRGVYLPI
Sbjct: 180 LRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPI 239

Query: 243 SYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAI 302
           SYLSLV YS E TPLLEEIR EIY KPFD I+FS+HRNTVCGVDLYYPHS +LD AN AI
Sbjct: 240 SYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAI 299

Query: 303 VLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFR 362
           + YEK+LRP W+ +KS+  +Y LI+KE QNTDYLCIAPVNQAFCAL TLIEEGV+S+ F 
Sbjct: 300 IFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFT 359

Query: 363 KYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLC 422
           K++ RFKDALFHGPQGMTV GTNGVQTWDCAFA+QY F+AGLAE+PEFY+ + AA++FL 
Sbjct: 360 KFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLI 419

Query: 423 RSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEIT 482
           RSQFDTECVPGSFRDKR G+WGFSTKTQGYTVSDCTAE+IKAIIMV+N+P F+ +HDEI 
Sbjct: 420 RSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIE 479

Query: 483 DERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTD 542
           D RL +GID+LL LQN GSFE+GSFATYEKIKAPLI+EKLNPAEVFGNIM+EYPYVECTD
Sbjct: 480 DSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTD 539

Query: 543 SSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEAL 602
           SSVLGLT+FH++YKYR EEIS+RI++AI Y+K AQ+ DGSWYG WGIC+TYAGMFA+EAL
Sbjct: 540 SSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEAL 599

Query: 603 QSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIAL 662
            SV E Y NS  V KGCDFLVSKQ+ DGGW ESMKSSELH+YVST ESLVVQTAW +IAL
Sbjct: 600 HSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIAL 659

Query: 663 LLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 722
           LLA+YPDK+VI+RGI LL+SRQ PSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY
Sbjct: 660 LLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 719

Query: 723 VKEYG 727
            K Y 
Sbjct: 720 NKTYA 724

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1198 bits (3099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/731 (76%), Positives = 632/731 (86%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT FYS+++GL KTDPR WRLRTD LGR++W+Y+    A +DP +TF QWLLQ P FP P
Sbjct: 1   MTEFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
           +P        F+A DAC+NGA+FFKLLQ+ +SGIFPCQYKGPMFMTIGYVAV+YIAGI+I
Sbjct: 61  HPAKNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+IELIRYIVNTAHPVDGGWGLHSVDKST FGT +NYVILRLLGLSK H VCV+ARD
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARD 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLLRLGGAIG PHWGK+WLS LNLY WEGVNPAPPETWLLPY LPIHPGRWWVHTRGVY+
Sbjct: 181 TLLRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLSLV++    TPLLEE+R EIY KPFD INFS HRNTVCGVDLYYPHS +L+ AN 
Sbjct: 241 PVSYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANN 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            +V YEK+LR  ++   S++ +Y+L++KE +NTD LCIAPVNQAFCAL TLIEEGV+S+ 
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F+ +Q RFKDALFHGPQGMT+ GTNGVQTWDCAFAIQY F AGLAE+PEF+D + +A+KF
Sbjct: 361 FKDFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCRSQFDTECVPGSFRDKR GAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVF+ +H  
Sbjct: 421 LCRSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHL 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           IT+ERL +GID+LL+LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITNERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH+ + Y+ EEIS  I++AI YIK +Q  DG WYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALE 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL +VGE YENS  V KGCDFLVSKQM DGGW ESMKSSELH+YV ++ESLVVQTAW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+YP ++VIDRGI LLK RQE SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGAQGI 731
           +Y K Y  + +
Sbjct: 721 MYTKAYEPESL 731

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/731 (74%), Positives = 637/731 (87%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT FYS+ +GL KTDPRLWRLRTD++GR++W+Y+    A ++P +TF QWLLQ P FP P
Sbjct: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
            P+      +F+A DAC+NGA+FFKLLQ+ +SGIFPCQYKGPMFMTIGYVAVNYIAGI+I
Sbjct: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+IE+IRYIVNTAHPVDGGWGLHSVDKST FGTA+NYVILRLLGL K H VCV++R+
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLLRLGGA+G PHWGKIWLS LNLY WEGVNPAPPETWLLPY LP+HPGRWWVHTR VY+
Sbjct: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLSLV+++   TPLLEE+R+EIY KPFD I FS+HRNTVCGVDLYYPHS  L+ AN 
Sbjct: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            +V YEK+LR  ++   S++ +Y+L+ KE QNTD LCIAPVNQAFCAL TLIEEGV+S+ 
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F+K+Q RFKDALFHGPQGMT+ GTNGVQ+WDCAFAIQYLFIAGLAE+ EFY+ + +A+KF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCR+QFDTECVPGSFRDKR GAWGFSTKTQGY VSDCTAE+IKAIIMV+NSPVF ++H+ 
Sbjct: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           I++ERL +GID+LL+LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH+++ Y+ EEI  RI++AI +IK +Q  +GSWYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALE 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL +VGE YENS  V KGCDFLVSKQM DGGW ESMKSSELH+YV +++SLVVQTAWVLI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+YP K VIDRGI LLK+RQE SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGAQGI 731
           +Y K Y    +
Sbjct: 721 MYSKAYEQHAL 731

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/731 (75%), Positives = 622/731 (85%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           M  FYS+E+GLE+TDP LWRLRTD+LGR+TW Y+    A++D Q TF QWLLQ   FP P
Sbjct: 1   MVQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
           +P+  +G   F A DAC NGA+FFKLLQD  SGIFPCQYKGPMF+TIGYVAV+YI+G  I
Sbjct: 61  SPNRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+IE+IRYIVNTAHPVDGGWGLHSVDKSTAFGT +NYVILRLLGL K H VC++AR 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARA 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
            L++LGGAIG PHWGKIWLSVLNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR +YL
Sbjct: 181 LLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYL 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLSL+RYS     LL E+R EIYVKPFD INFS +RNTVCG+DLYYPH+T+L+ AN 
Sbjct: 241 PVSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANN 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            +V YEK LRP WL +K++  +Y LI+KE  NTDYLCIAPVNQAFCAL T IEEG ES  
Sbjct: 301 VMVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSA 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F+K+++R KDALFHGPQGMT+ GTNGVQTWDCAFAIQY F+AGLAE+PE+YD + AA+KF
Sbjct: 361 FKKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCR+QFDTECV GSFRDKRVGAW FSTK QGYTVSDCTAE+IKAIIMVRNSP FA I +E
Sbjct: 421 LCRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNE 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           ITDERLCKGID+LL LQN+ SFE+GSFATYEKIKAPL +EKLNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH  Y YR EEIS RI+LAI YIK  Q +DGSWYG WG+C++YAGMFAME
Sbjct: 541 TDSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAME 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL SVGE Y NS+ V KGCDFLVS+Q+ DGGW ESMKSSELH+YVST+ESLVVQTAWVLI
Sbjct: 601 ALHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALLL KYP+K VID GI LLK RQ  +GEWKFE +EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGAQGI 731
           LY   YG   I
Sbjct: 721 LYTATYGDDSI 731

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/722 (78%), Positives = 628/722 (86%), Gaps = 2/722 (0%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT FYSD VG+ +TDP+ WRLRT +LGR+ W+YI+Q   ++DPQ+TFVQWLLQ   FP+P
Sbjct: 1   MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
           +P  K GDD  +++ ACY GA+F+KLLQD  SGIFPCQYKGPMFMTIGYVAVNYIAG+++
Sbjct: 61  SPR-KEGDD-LSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKL 118

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+IELIRYIVNTAHPVDGGWGLHSVDKST FGT +NYV LRLLGL K H VCVRAR 
Sbjct: 119 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARH 178

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TL RLGGA G PHWGKIWLS+LNLY WEGVNPAPPETWLLPY LPIHPGRWWVHTR VYL
Sbjct: 179 TLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYL 238

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLSL++YS   T LL EIR+EIY K FD INFSQHRNTVCGVDLYYPHS +LDTAN 
Sbjct: 239 PVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTAND 298

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            IV YEK+LRP  ++  S+K +Y LI+KE QNTD LCIAPVNQAFCAL T +EEG +SK 
Sbjct: 299 VIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKA 358

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F ++Q RFKD LFHGPQGMTV GTNGVQTWDCAF IQY F+AGLAE+PEF + +  A+KF
Sbjct: 359 FERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKF 418

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCRSQFDTECV GSFRDKRVGAWGFSTKTQGYTVSDCTAE+IKAIIMVRNSPVF+ +HDE
Sbjct: 419 LCRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDE 478

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           ITDERLCKGID+LL LQN+G FE+GSFATYEKIKAPL +EKLNPAEVFGNIMVEYPYVEC
Sbjct: 479 ITDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVEC 538

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH++Y YR +EIS RI++AI YIK AQQDDG WYG WGICFTYAGMFAME
Sbjct: 539 TDSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAME 598

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL SVGE Y+NS  V KGCDFL+SKQMPDGGW ESMKSSELH YV + +SLVVQTAW LI
Sbjct: 599 ALHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALI 658

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALLLAK P++  I+RGI+LLKSRQ+PSGEWKFES EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 659 ALLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALG 718

Query: 721 LY 722
           LY
Sbjct: 719 LY 720

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1182 bits (3057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/727 (76%), Positives = 625/727 (85%), Gaps = 4/727 (0%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63
            YSDE+GL+KTDP  WRLRT+ LGR TW+YI+     +DPQ+TF +WLLQLP FP+P P 
Sbjct: 5   LYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTPT 64

Query: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123
               ++  TA++ACY+GA+FF+LLQD  SG FPCQYKGPMFMTIGYVAVNYIAG+EIP H
Sbjct: 65  T---EEPRTAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIPNH 121

Query: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183
           E+IE+IRY+VNTAHPVDGGWGLHS DKST FGT INYVILRLLG+SK H VC RAR TLL
Sbjct: 122 ERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKTLL 181

Query: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243
            LGGAIG PHWGK+WLSVLNLY WEGVNPAPPETWLLPY LPIHPGRWWVHTRGVYLPIS
Sbjct: 182 SLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLPIS 241

Query: 244 YLSLVRYSTECTPLLEEIRKEIYV-KPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAI 302
           YLSLV +S E TPLL+EIR+EIY  +PF+ I F+Q+RN VCGVDLYYPHS +LD AN  I
Sbjct: 242 YLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANACI 301

Query: 303 VLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFR 362
           V YE++LRPTWL + S++ +YELI+KE  NTDYLCIAPVNQAFCAL TLIEEGV+S  F+
Sbjct: 302 VKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNAFQ 361

Query: 363 KYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLC 422
           K+  RFKD+LFHGPQGMTV GTNGVQ WDCAFAIQY F+AGLAE+ EFYD +++A+ FLC
Sbjct: 362 KFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAFLC 421

Query: 423 RSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEIT 482
           RSQFDTECV GSFRDKRVG+WGFSTKTQGYTVSDCTAESIKAIIMV+NSPVF  IH  IT
Sbjct: 422 RSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHLIT 481

Query: 483 DERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTD 542
           DE++ +GID+LL LQN+GSFE+GSFATYEKIKAPL LEKLNPAEVFGNIMVEYPYVECTD
Sbjct: 482 DEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVECTD 541

Query: 543 SSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEAL 602
           SSVLGLTYFH +Y YR  EIS RI++A+ YIK+ Q  DGSWYGSWGIC+TYAGMFAMEAL
Sbjct: 542 SSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAMEAL 601

Query: 603 QSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIAL 662
            SVGE Y NS  V KGCDFLV++QM DGGW E MKSSELHTYV+++ S VVQTAWV+IAL
Sbjct: 602 HSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVIAL 661

Query: 663 LLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 722
           LLAKYP K VI +G+ LLKSRQEPSGEWKFES EGVFNHSCAIEYPSYR LFPIKALGLY
Sbjct: 662 LLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALGLY 721

Query: 723 VKEYGAQ 729
            + Y  +
Sbjct: 722 AEIYDKE 728

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/725 (76%), Positives = 626/725 (86%), Gaps = 6/725 (0%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPN-P 62
            YS+E+GLEKTDP LWRLRT+  GRQ+W+YI +  + +DPQ+ F +WLLQLP FP+P  P
Sbjct: 5   LYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQYP 64

Query: 63  D-IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIP 121
           D IK+     +A+  C  GA FF+LLQD  SG FPCQYKGPMFMTIGYVAVNY+A I+IP
Sbjct: 65  DNIKD----VSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIP 120

Query: 122 EHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDT 181
           E E+IE+IRYIVNTAHPVDGGWGLHS DKST FGT +NY+ILRLLGL  +H VC++ARDT
Sbjct: 121 ESERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDT 180

Query: 182 LLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLP 241
           LLRLGGAI  PHWGK+WLSVLNLY WEGVNPAPPETWLLPY++PIHPGRWWVHTRGVYLP
Sbjct: 181 LLRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLP 240

Query: 242 ISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKA 301
           ISYLSLV Y  E T LL+EIR EIYVKPFD I+FS+HRNTVCGVDLYYPHS  LD AN  
Sbjct: 241 ISYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSL 300

Query: 302 IVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPF 361
           IV YEK+LRP  L + S+  +Y+LI+KE +NTDYLCIAPVNQAFCAL TL+EEG +SK F
Sbjct: 301 IVPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAF 360

Query: 362 RKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFL 421
            ++Q RFKDALF GPQGMTV GTNGVQTWDCAFAIQYLF+AGLA++PEFY+ +S A+KFL
Sbjct: 361 ERFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFL 420

Query: 422 CRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEI 481
           CRSQFDT+CV GSFRDKR GAWGFSTKTQGYTVSDCTAESIKAIIMVRNS +F  IHDEI
Sbjct: 421 CRSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEI 480

Query: 482 TDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECT 541
           +DERL K +DILLDLQN GSFEFGSFATYEKIKAPL LE LNPAEVFGNIMVEYPYVECT
Sbjct: 481 SDERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECT 540

Query: 542 DSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEA 601
           DSSVLGLT FH+HY YR +EIS RI +AI YIK  Q+DDGSWYGSWGIC+TYAGMFAMEA
Sbjct: 541 DSSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEA 600

Query: 602 LQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIA 661
           L SVGE Y NS  V KGCDFLV++Q+ DGGW ESMKSSELHTYVSTKESLVVQTAWV++A
Sbjct: 601 LHSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLA 660

Query: 662 LLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 721
           LLLA+YP+K +ID+GI+LLK RQ+ SGEWKFES EGVFNHSCAIEYPSYRFLFPIKALGL
Sbjct: 661 LLLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGL 720

Query: 722 YVKEY 726
           Y + Y
Sbjct: 721 YSQIY 725

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1176 bits (3041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/731 (75%), Positives = 629/731 (86%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT FYS+ +GL KTDPRLWRLRTD+LGR++W+Y+    A ++P +TF QWLLQ P F  P
Sbjct: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
            P        F+A DAC+NGA+FF+LLQD  SGIFPCQYKGPMF+TIGYVAVNYIAG++I
Sbjct: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+IE+IRYIVNTAHPVDGGWGLHSVDKST FGT +NYVILRLLGL K H VC +AR 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLLRLGGAIG PHWGKIWLS LNLY WEGVNPAPPETWLLPY LP+HPGRWWVHTRGVY+
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLSLV++S   TPLLEEIRKEIY KPFD I+FS HRNTVCGVDLYYPHS  LD AN 
Sbjct: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            +V YEK+LR  ++   S++ +Y+LI+ E +NTD LCIAPVNQAFCAL T IEEGV+S+ 
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F+K+Q RFKDALFHGPQGMT+ GTNGVQTWDCAFAIQY FIAGLAE+PEFY+ + +A+KF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCR+QFDTECVPGSFR+KR G+WGFSTKTQGYTV+DCTAESIKAIIMV+NSPVF+++H  
Sbjct: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           IT ERL +GID+LL LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH+ + Y+ EEI  RI++AI YIK AQ  DGSWYGSWGICFTYAGMFAME
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL +VGE YENS  V KGCDFLVSKQM DGGW ESMKSSELH+YV + +SLVVQ+AW LI
Sbjct: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL  A+YP+K+VIDRGI LLK+RQE SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGAQGI 731
           +Y K Y   G+
Sbjct: 721 MYAKAYEQPGL 731

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/726 (73%), Positives = 619/726 (85%), Gaps = 3/726 (0%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63
            YSDE+ L KTDPR WRL TD LGR++W+Y+ + D++  PQ+TFV+WLLQ+P FP+P P 
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKPK 73

Query: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123
           IK GD +FT  DA  NGA FFKLLQD  SGIFPCQYKGPMF+TIGYVAV YIAGI+IPEH
Sbjct: 74  IKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPEH 133

Query: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183
           E++E+IRYIVNTAHPVDGGWGLHSVDKST FGT +NYVILRLLGL K H VCV+AR TL+
Sbjct: 134 ERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTLI 193

Query: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243
           RLGGAIG PHWGKIWLSVLNLY WEGVNPAPPETWLLPY LPIHPGRWWVHTRGVYLP+S
Sbjct: 194 RLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPVS 253

Query: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303
           YL L +++   TPL+EEIRKEIY   +D I+FS+HRNTVCGVDLYYPHS +LD AN  +V
Sbjct: 254 YLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNILV 313

Query: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363
            YEK++RP ++  KS++ + +LIEKE  NTDYLCIAPVNQAFC+L  L+E+GV SK F +
Sbjct: 314 FYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFER 373

Query: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423
            Q RFKDALFHGPQGMTV GTNGVQTWDCAFA+QY F+AGLAE+PEF D +  ++KFLCR
Sbjct: 374 CQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLCR 433

Query: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483
           SQFDTECVPGSFRDKR+G WGFSTKTQGYTVSDCTAESIKAIIMVRNSP F ++HDEI+D
Sbjct: 434 SQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEISD 493

Query: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543
           ERL +GI+IL+ LQN+G FE+GSFATYEKIKAPL +E LNPAEVF NIMVEYPYVECTDS
Sbjct: 494 ERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTDS 553

Query: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603
           SVLGLTYFH+HY Y+++EI  RI+LAI YIK AQ +DGSWYGSWGICFTYA MFA+EAL+
Sbjct: 554 SVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEALE 613

Query: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKE---SLVVQTAWVLI 660
           ++GE Y NS+ V KGCDF+VSKQ  DGGWSE+MKSSE+H YV + +   S VVQT+W +I
Sbjct: 614 TIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSVI 673

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+LA YPDK V+ RGI  +KS+Q PSGEW+F++VEGVFNHSC IEYPSYRFLFPIKALG
Sbjct: 674 GLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKALG 733

Query: 721 LYVKEY 726
           LY   Y
Sbjct: 734 LYRTRY 739

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/731 (72%), Positives = 613/731 (83%), Gaps = 1/731 (0%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT  YSD++GL KTDP  WRL TD+LGR+TW+Y+    A  +PQ+++V++LLQLP FP+P
Sbjct: 17  MTKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAP 76

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
            P+  + D  FTA DA YNGA F +LLQ+  SGIFPCQYKGPMF+TIGYVA  Y AGIEI
Sbjct: 77  KPERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEI 135

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHE+ E++RYIVN AHPVDGGWGLHS DKSTAFGT+INYVILRLLGL   H VC RAR 
Sbjct: 136 PEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARS 195

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLL+LGGAIG PHWGKIWLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR VY+
Sbjct: 196 TLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYM 255

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+ YLS  ++  E TPLL+EIR EIY K +D I+FS+HRNTVCG+DLYYPH+ LLD AN 
Sbjct: 256 PVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANW 315

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            +V YEK+LRP W    + K +YELI+KE  NTDYLCIAPVN AFCA+ TLIEEGV+S  
Sbjct: 316 GMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHE 375

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F ++++RFKD LFHGPQGMT+ GTNGVQ WDCAFA+QYLF+A LAE PEF   +  A+KF
Sbjct: 376 FNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKF 435

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCRSQFDTEC PGSFRDKRVG W FSTKTQGYTVSDCTAE++KAIIMVRNSP F +  +E
Sbjct: 436 LCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNE 495

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           I+DERL K +DILL+LQN+GSFE+GSFA+YEKIKA  ++EKLNPAEVFGNIMVE+PYVEC
Sbjct: 496 ISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVEC 555

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH+HY YR ++I+  I++AI YIK +Q  +GSWYGSWG+CFTYAGMFA+E
Sbjct: 556 TDSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALE 615

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL +VGE YENS+ V KGCDFLVS+QM DGGW ES KSSELH YVS+++SLVVQTAW +I
Sbjct: 616 ALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVI 675

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
            LLLA+YPDK+VIDRGI LLKSRQ PSGEWKFES+EGVFNHSC IEYPSY+FLFPIKALG
Sbjct: 676 GLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALG 735

Query: 721 LYVKEYGAQGI 731
           LY K YG   I
Sbjct: 736 LYAKRYGNDAI 746

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/732 (71%), Positives = 615/732 (84%), Gaps = 1/732 (0%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           MT  YS+E+ LE+TDP LWRLR D LGR++W+YI + DA++DPQ+ +VQWLLQLP FP P
Sbjct: 1   MTKLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKP 60

Query: 61  NPDIKNGD-DSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIE 119
           +P I +G+   F A +AC NGA+F++LLQD +SGIFPCQYKGPMFMTIGYV V+Y+AGIE
Sbjct: 61  SPKIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIE 120

Query: 120 IPEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRAR 179
           IP+ +++E+IRYIVNT+HPVDGGWGLHS DKST FGTAINYV LRLLGL + H VCV+AR
Sbjct: 121 IPKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKAR 180

Query: 180 DTLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVY 239
            TL +LGGA+G PHWGKIWLSVLNLY WEGVNPAPPETWLLPY+LPIHPGRWWVHTR +Y
Sbjct: 181 RTLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIY 240

Query: 240 LPISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTAN 299
           LP+SYLSL+RY    TPLL+E+R+E+YVKPF+ I+F  +RNTVCGVDLYYPHS +LD  N
Sbjct: 241 LPVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMN 300

Query: 300 KAIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESK 359
             +V YEK LR  W+   ++  +Y LI+KE  NTDYLCIAPVNQAFCAL TLIEEGV S 
Sbjct: 301 SVLVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSP 360

Query: 360 PFRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFK 419
            F+++Q RF DALFHGPQGMT+ GTNGVQTWDCAF IQ LF AGLAE+ ++Y+ V  A++
Sbjct: 361 QFKRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYE 420

Query: 420 FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHD 479
           FL R+QF  ECVPGSFRD R GAWGFSTKTQGYTVSDCTAESIKAIIMV+ SP +AK+H 
Sbjct: 421 FLNRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHS 480

Query: 480 EITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVE 539
            I DERLC+ ID+LL LQN+G FE+GSFATYE IKAPL++EKLNPAEVFGNIMVEYPYVE
Sbjct: 481 LIDDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVE 540

Query: 540 CTDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAM 599
           CTDS+VLGLT FH +  YR +EISDRI +A+ YIK  Q +DGSWYG WG+CFTYAGMFA+
Sbjct: 541 CTDSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFAL 600

Query: 600 EALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVL 659
           EAL SVGE Y NS  V KGCDFLV +QM DGGW E+MKS ELHTYV ++ES+VVQT+WV+
Sbjct: 601 EALHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVI 660

Query: 660 IALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 719
           IALLL+KYP+K VIDR +  L++RQE SGEWKF+ VEGVFNHSCAIEYP+YRF+FPIKAL
Sbjct: 661 IALLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKAL 720

Query: 720 GLYVKEYGAQGI 731
           GLYV  +G + I
Sbjct: 721 GLYVNAFGKEAI 732

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/731 (70%), Positives = 600/731 (82%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           M   YS+ +GL +TDP+ WRL TDDLGRQTW+Y+ + D++  PQ+TF +WLL+   FP P
Sbjct: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
           +P+I +    FTA +A +NGA FF+LLQD +SG FPCQYKGPMFMTIGYV   YIA IEI
Sbjct: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PEHEK E+IRY+ N AHPVDGGWGLH VDKST  GT +NYV++RLLGL K H VCVRARD
Sbjct: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TLLRLGGAI  PHW KIWLS+LNLY WEGVNPAPPE W+LPY L IHP RWWVHTRG+YL
Sbjct: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYLS  +YS E  PLLEEIR EIY +PF+ I+F +HRNTVCGVDLYYPH+ +LDT N 
Sbjct: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
            I  YE+++RP WL +KS   +YEL++KE  NTDYLCIAPVN AFCA+ TLIEEG +S+ 
Sbjct: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F ++  RFKD LFHGPQG+TV GTNGVQ WDCAF IQY+F+AGLAE PEF++ +  +FKF
Sbjct: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCRSQF  +CV GSFRDKR+GAW FSTKTQGYTVSDCTAE+IKAIIMV NS  +  +   
Sbjct: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
              E+L  GID+LL LQN+ SFE+GSFATYEKIKAPL++EKLNPAEVFGNIMVE+PYVEC
Sbjct: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYF R++ YR ++I   I  AI YIK +QQ +GSWYG WGIC+TYAGMFA+E
Sbjct: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660
           AL ++GE YENS+ V KGCDF V+KQ+PDGGWSE MKSSELHTYVS KES VVQTAWVLI
Sbjct: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660

Query: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+LAK+PDK VIDR I+LLK RQ+PSGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 LYVKEYGAQGI 731
           LYVKEYG   I
Sbjct: 721 LYVKEYGHSAI 731

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/723 (70%), Positives = 596/723 (82%), Gaps = 1/723 (0%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63
            YS+E+GL KTD + WRL+TD LG + W+Y+ +++A+  PQ+ +V++LLQLP F +P P 
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61

Query: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123
           +      FTAKDA +NGA FF LLQ+ +SGIFPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120

Query: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183
            K E+IRYIVN++HPVDGGWGLH VDKST FGT INYVILRLLGL   + VC RAR TL 
Sbjct: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180

Query: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243
           RLGGA+G PHWGK WLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR +Y  + 
Sbjct: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240

Query: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303
           YLS  +YS   TPLLEEIR EIY +PF+ I+FS+ +N VCGVDLYYPH+ LL+ AN +++
Sbjct: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300

Query: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363
            YEK+L+P W  + S + +YELI+KE +NTDYLCIAPV+ AFCA+ TLIEEG +S  F++
Sbjct: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360

Query: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423
           + ERF+D LF GPQGMTV GTNGVQ WDCAFAIQY F+AGLAE PEF++ +  A+KFLCR
Sbjct: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420

Query: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483
           SQFDTEC PGSFRDKR+GAW FSTKTQGYTVSDCTAES+KAIIMVRNSP FA + DEI+D
Sbjct: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480

Query: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543
           ERL K +D+LL LQN GSFE+GSFATYEKIKA   LEKLNPAEVFGNIMVE+PYVECTDS
Sbjct: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540

Query: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603
           SVLGLTYF +HY YR EEI   I++AI+YIKNAQ+ DGSWYG WGICFTYAGMFA+EAL 
Sbjct: 541 SVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEALH 600

Query: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL 663
           +V E YENS+ V KGCDFLVSKQ PDGGWSESMKSSELH+YV +  S  VQTAW LI LL
Sbjct: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660

Query: 664 LAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723
           LA+YP+K++ID+GI+LLK RQ  SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALGLY 
Sbjct: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720

Query: 724 KEY 726
           K+Y
Sbjct: 721 KKY 723

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/723 (71%), Positives = 594/723 (82%), Gaps = 1/723 (0%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63
            Y+DE+GL  TD  LWRLRTD+LG + W+Y+ + +A++DPQ+++V++LLQ P F +P P 
Sbjct: 3   LYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEPL 62

Query: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123
             +  D FTA DA +NGA FF LLQ+ ++GIFPCQYKGPMF+TIGYVA  Y A I +PEH
Sbjct: 63  RSSKCDEFTAGDAAFNGAQFFSLLQE-DTGIFPCQYKGPMFLTIGYVATLYCARIPVPEH 121

Query: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183
            KIE+IRYIVN+AHPVDGGWGLH VDKST FGTAINYVILRLLGL   H VC RAR TL 
Sbjct: 122 IKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTLH 181

Query: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243
           RLGGAIG PHWGK WLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR VY  + 
Sbjct: 182 RLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQALG 241

Query: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303
           YLS  +Y  E TPLL+EIRKEIYVKPF+ I+FS+H+NTV GVDLYYPH+ LL+ AN A+ 
Sbjct: 242 YLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVALT 301

Query: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363
           LYE +L+P W  + S + +YELI+KE +NTDYLCIAPV+ AFCA+ TLIEEG +S  F++
Sbjct: 302 LYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFKR 361

Query: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423
           + + F++ LF GPQGMTV GTNGVQ WDCAFAIQY F+AGLAE PEF D +  A+KFLCR
Sbjct: 362 FVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLCR 421

Query: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483
           SQFDTEC PGSFRDKRVGAW FSTKTQGYTVSDCTAE++KAIIMVRNSP F  +  EI+D
Sbjct: 422 SQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEISD 481

Query: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543
           ERL K +DILL LQN GSFE+GSFATYEKIKA   LEKLNPAEVFGNIMVE+PYVECTDS
Sbjct: 482 ERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTDS 541

Query: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603
           SVLGLTYF ++Y YR +EI+  I++AI+YIK  Q  DGSWYG WG+CFTYAGMFA+EAL 
Sbjct: 542 SVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEALY 601

Query: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL 663
           +VGE YENS+ V KGCDF  S+Q  DGGWSESMKSSELHTYV    S VVQTAW LI LL
Sbjct: 602 TVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGLL 661

Query: 664 LAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723
           LAKYP++ VIDRGI+LLK RQ PSGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALGLY 
Sbjct: 662 LAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLYS 721

Query: 724 KEY 726
           K Y
Sbjct: 722 KRY 724

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/728 (65%), Positives = 584/728 (80%)

Query: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63
            YSDE+GL  TD R WRL  D++G + W+Y+D+ +    PQTT VQWLL +P FP+P P+
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61

Query: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123
           + + D  FTA +A YNGA F  LLQD  SG FPC Y+GPMFMTIGYV   ++ G+ IPE 
Sbjct: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121

Query: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183
           ++ EL+RY+VNTAHPVDGGWGLHS DKST  GTA+NYV+LRLLG+ + H V  RAR TLL
Sbjct: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181

Query: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243
           R+GGAIG P+WGK+WLSVLNLY WEGVNPAPPE WLLPY  P HP RWWVHTR ++LP+S
Sbjct: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241

Query: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303
           YL+ VRY    TPLLEEIR EI+ +PF++I+F+ +RN VCG+DLYYPH+T+L+T NK IV
Sbjct: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301

Query: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363
            YEK+LRP WL + S   IYELI+ E QNTDYLCIAPVN A  A+ T IEEG +S  F +
Sbjct: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361

Query: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423
           + +RFK+ LF GPQGM V GTNGVQ WDCAF IQ +F A L ++PEFY+ +  A++FLCR
Sbjct: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421

Query: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483
           SQ   +CVPGS+RD R+GAW FSTKTQGY VSDCTAE+ K++++VRNSPVF ++ DEI+ 
Sbjct: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481

Query: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543
           E+L K ID LL LQN+GSF++GSFA+YEKI+APL +E LN AEVF NIMVE+PYVECTDS
Sbjct: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541

Query: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603
           SVLGL+++ +++ YR +E+   I++A+++IK+AQ+ DGSWYG WGIC+TYAGMFA+EAL 
Sbjct: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601

Query: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL 663
           + GE Y +S+ V KGC+FLVSKQ+PDGGWSE+MKSSELHTYVS K S VVQTAW LI LL
Sbjct: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661

Query: 664 LAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723
           LA YPD++VIDRGI LLK RQ PSGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+Y 
Sbjct: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721

Query: 724 KEYGAQGI 731
           K+Y    +
Sbjct: 722 KKYAKDAL 729

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1049 bits (2712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/732 (66%), Positives = 574/732 (78%), Gaps = 1/732 (0%)

Query: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60
           M   YSD +GL  TDP  WRL    LG  +W YI + D++  PQ    +WLL    F +P
Sbjct: 1   MVELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTP 60

Query: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120
            PD+ NGD +F A +A YNGA+F KLLQ+ +SG FP QYKGPMFMTI YV   Y+   EI
Sbjct: 61  EPDVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEI 120

Query: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180
           PE EKIE+IRYIVNTAHPVDGGWGLH+  KST FGT +NY++LRLLG+SK H VC RAR 
Sbjct: 121 PECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARS 180

Query: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240
           TL RLGGAIG PHWGKIWLS+LNLY WEGVNPAP E W LPY +PIHP RWW+HTR +YL
Sbjct: 181 TLHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYL 240

Query: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300
           P+SYL  + Y+ E TPLL+EIR EIY   FD+I FS+HRNTVC VDLY+PHST+L+  N 
Sbjct: 241 PMSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINS 300

Query: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360
           AIV Y+ +LRP WL + S K +YELI KE  NT+YLC+APV+ AFC++ T IEEG +S  
Sbjct: 301 AIVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPE 360

Query: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420
           F +  E F   +FHGPQGMTV GTNG Q WDC+F +QYLF+A LAE PEF DAV+ A+KF
Sbjct: 361 FERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKF 420

Query: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480
           LCRSQF  ECV GS+RDKRVG W FSTKTQGYTVSDCTAE++KA+IMV+ SPVFA IHDE
Sbjct: 421 LCRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDE 480

Query: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540
           I++E L K ID+LL LQN+GS E+GSFATYEKI+APLI+EKLNPAEVF NIMVEYPYVEC
Sbjct: 481 ISEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600
           TDS +LGLTYF  +Y YR ++I   +++A  YIK  Q  DGSWYG WGIC+TYAGMFA+E
Sbjct: 541 TDSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALE 600

Query: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVS-TKESLVVQTAWVL 659
           AL ++GE YENS+ V +GCDFLV KQ+ DGGWSES+KS+EL  Y++  K SLVV T+W L
Sbjct: 601 ALYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWAL 660

Query: 660 IALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 719
           I LLLA YPDK+VIDRGI LLKSRQ  SGEWKFE +EG+FNHSCAIEYP+YRFLFPIKAL
Sbjct: 661 IGLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKAL 720

Query: 720 GLYVKEYGAQGI 731
           G+Y K+YG + I
Sbjct: 721 GIYAKKYGKRAI 732

>TPHA0I03230 Chr9 complement(713161..714135) [975 bp, 324 aa] {ON}
           Anc_7.533 YPR176C
          Length = 324

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 76/189 (40%), Gaps = 30/189 (15%)

Query: 519 LEKLNPAEVFGNIMVEYPYVECTDSSVLGLTYFHRHYKYRHEEISD-------------- 564
           L  LN  + F    V    + C D    G   F +H  +    +S               
Sbjct: 46  LSLLNAKDTFKREDVIKFVLSCFDDQYGGFAPFPKHDGHLLSTLSGLQILATYNSLDALT 105

Query: 565 --RIQLAIRYIKNAQQDDGSWYGS-WGICFTYAGMFAMEALQSVGELYENSDAVHKGCDF 621
             R +  I++IK  Q  DGS+ G  +G   T     A+ +L  +GEL  +SD V    DF
Sbjct: 106 VIRREKCIKFIKGNQLPDGSFQGDRFGEVDTRFSYNALSSLSILGEL--SSDVVDPAVDF 163

Query: 622 LVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL--LAKYPDKQVIDRGISL 679
           ++     DGG+  S   +E H       S  V T    +A++  L +  D Q+ + G  L
Sbjct: 164 ILKCYNFDGGFG-SCPGAESH-------SAQVFTCLGALAIVNKLDRLSDHQIEEIGWWL 215

Query: 680 LKSRQEPSG 688
            + RQ P G
Sbjct: 216 CE-RQLPEG 223

>TPHA0D02200 Chr4 complement(454720..456270) [1551 bp, 516 aa] {ON}
           Anc_5.372 YDR329C
          Length = 516

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 239 YLPISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLD 296
           Y P   LSL+ +S   + +   I KE++     +I  SQ  N +   D++ P  + +D
Sbjct: 307 YNPKDTLSLMEFSNNMSNIFHSINKELFTNNISEIETSQPINNIS--DIFLPEDSKID 362

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,089,326
Number of extensions: 3516688
Number of successful extensions: 7108
Number of sequences better than 10.0: 23
Number of HSP's gapped: 7174
Number of HSP's successfully gapped: 23
Length of query: 731
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 614
Effective length of database: 40,065,477
Effective search space: 24600202878
Effective search space used: 24600202878
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)