Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D04130na 1ON64464430310.0
KAFR0D04120na 2ON64864922780.0
KAFR0D041401.50ON63764321530.0
Smik_3.531.50ON63364319360.0
Suva_3.1891.50ON63364219070.0
Skud_3.381.50ON63364219040.0
YCL025C (AGP1)1.50ON63364219030.0
Kpol_2000.921.50ON63764618990.0
NCAS0A004201.50ON67964618960.0
Suva_2.6881.50ON66166118790.0
Skud_4.7841.50ON66366118740.0
CAGL0K05753g1.50ON66066118710.0
TDEL0C065101.50ON64264718640.0
YDR508C (GNP1)1.50ON66366118630.0
Smik_4.7901.50ON66366318510.0
CAGL0B01012g1.50ON62357918450.0
NDAI0F043901.50ON66764518370.0
TBLA0A051801.50ON67666418240.0
KNAG0F002701.50ON63462418140.0
TPHA0E036601.50ON64766318120.0
NDAI0A006401.50ON64164118030.0
TPHA0B047501.50ON63964717800.0
TBLA0A05190na 2ON66761617750.0
KNAG0C005901.50ON63464317680.0
SAKL0C01650g1.50ON61362717490.0
SAKL0C01232gsingletonON61362717370.0
KAFR0D005001.50ON61757117260.0
NCAS0B085801.50ON62761017210.0
KAFR0D00510na 1ON61763717120.0
KLTH0F01584g1.50ON59659816970.0
KAFR0D00520na 2ON59857616910.0
Kpol_2002.441.50ON62763316760.0
Kwal_33.132041.50ON60760116440.0
ZYRO0F17446g1.50ON63363416300.0
Ecym_10561.50ON60662416010.0
AFR698C1.50ON60962915970.0
KLLA0C01606g1.50ON62064815870.0
KLTH0F01606gna 2ON60457515550.0
Kwal_33.13215na 2ON59856815120.0
SAKL0D02948gna 3ON59457114850.0
YBR068C (BAP2)3.284ON60959514610.0
SAKL0D02926g3.285ON58360714570.0
AGR039Cna 3ON58659014540.0
Skud_2.1913.284ON60959514390.0
KNAG0J022003.284ON60759914290.0
Smik_2.2013.284ON60962514270.0
NCAS0I015303.284ON59557114140.0
Ecym_26643.285ON57553714030.0
NDAI0A074903.284ON59657414020.0
SAKL0D02970g3.284ON60162314000.0
NCAS0A106803.284ON59361113960.0
NDAI0A056203.284ON57157613920.0
KAFR0A011203.284ON59260713910.0
Suva_4.3073.284ON60959513920.0
CAGL0L07546g3.284ON63460913900.0
AGR040C3.285ON57357213800.0
KNAG0H011503.284ON61757113750.0
Suva_2.2033.284ON60462113700.0
TPHA0M012003.284ON60759413571e-180
Skud_4.3003.284ON60462113551e-180
YDR046C (BAP3)3.284ON60462113521e-180
Kpol_1065.133.284ON59659413471e-179
Smik_4.2843.284ON60462113461e-179
Kwal_27.105383.284ON60256913341e-177
KLTH0C05170g3.284ON59861313341e-177
Ecym_2663na 3ON58957313221e-175
AGR038C3.284ON58056813171e-175
CAGL0H08393g3.284ON61258013201e-175
TPHA0A039603.284ON61561113181e-174
Ecym_26623.284ON58957612921e-171
KAFR0C004003.284ON58262312771e-169
Smik_2.2023.285ON61755912781e-168
Kpol_1052.163.284ON61361512601e-166
KNAG0J022103.285ON58160412561e-166
Skud_2.1923.285ON61961512581e-165
Suva_4.3083.285ON61858512541e-165
TBLA0I020003.284ON66458612501e-164
YBR069C (TAT1)3.285ON61949512451e-163
TBLA0G031203.284ON67350512471e-163
TBLA0I020103.285ON62849412391e-162
Kpol_1052.143.285ON60251012181e-160
ZYRO0G12342g3.284ON62062012051e-157
NCAS0I015203.285ON61450711941e-156
NDAI0A075003.285ON61959511941e-156
SAKL0H08184gna 4ON59849811361e-147
Kwal_27.126811.244ON59360611291e-146
NDAI0B052201.244ON61156811181e-144
ADL272Wna 4ON56449611031e-143
TPHA0B010901.244ON60665411001e-142
KLTH0E15642g1.244ON59656910991e-142
Ecym_8297na 4ON56950510901e-141
SAKL0D04664g1.244ON59360610871e-140
ZYRO0D03762g1.244ON60063910871e-140
SAKL0G14014g5.158ON60553510681e-137
KLLA0F01012gna 4ON55650310591e-136
KNAG0C02140singletonON59859710601e-136
KLLA0A06886gsingletonON58762010581e-136
TPHA0A002405.158ON60352710511e-135
Kpol_543.791.244ON60563910501e-134
TDEL0C00930singletonON59556810481e-134
YKR039W (GAP1)1.244ON60253410481e-134
CAGL0L03267g1.244ON59754410461e-134
Smik_16.1155.158ON60353810411e-133
Skud_11.2751.244ON60253910391e-133
Suva_11.2731.244ON60157510391e-133
NCAS0B079001.244ON61963710361e-132
CAGL0B03773g5.158ON60552310341e-132
Skud_7.5255.158ON60360010311e-132
Suva_7.4855.158ON60352810271e-131
KAFR0E018505.158ON56049510191e-130
YGR191W (HIP1)5.158ON60352910191e-130
KLTH0B02046g5.158ON58958410171e-130
Ecym_60211.244ON60062310131e-129
NDAI0D021605.158ON58758110061e-128
AGR319W5.158ON62661410071e-128
Kpol_1010.325.158ON59953510041e-128
Suva_2.716singletonON60364310041e-128
Kwal_33.154075.158ON58758710001e-127
NCAS0D018705.158ON59559010001e-127
Kwal_33.14276na 5ON5965209981e-127
KLLA0A06930g1.244ON5876389941e-126
KNAG0G009005.158ON6135359911e-125
NCAS0A071105.158ON5925889861e-125
TPHA0A047005.158ON5694879831e-125
Ecym_47895.158ON5885729751e-123
NDAI0C029505.158ON6096229731e-123
Kpol_543.78singletonON6055969721e-123
KLLA0A11770g5.158ON5815239701e-123
Kpol_534.221.368ON5926369661e-122
Smik_11.3021.244ON5535539551e-121
TBLA0B077605.158ON6585199611e-120
SAKL0D00836gna 5ON6015209561e-120
AFR230C1.244ON6045719551e-120
NCAS0A089201.368ON5995299331e-117
TPHA0A025001.368ON5905759271e-116
Skud_15.1381.368ON5925299201e-115
TBLA0C012101.368ON6005879211e-115
YOL020W (TAT2)1.368ON5925299161e-114
CAGL0D02178g1.368ON5776129121e-114
Smik_15.1461.368ON5935299101e-114
NDAI0G060301.368ON5995268991e-112
KLTH0H13398g1.368ON5875268941e-111
Suva_15.1481.368ON5925298901e-111
Ecym_27161.368ON5926548861e-110
AEL030W1.368ON5825708761e-109
KLLA0A10813g1.368ON5845268501e-105
Sklu_YGOB_Anc_1.3681.368ON5415618331e-103
TDEL0B00130singletonON5845458131e-99
Kwal_34.16254singletonOFF4814697874e-97
Kwal_YGOB_34.162541.368ON4914697876e-97
TDEL0E05700singletonON5845527956e-97
KAFR0F04410singletonON5805267931e-96
KAFR0B00220singletonON5855857746e-94
SAKL0D04048gna 6ON5865747739e-94
KLTH0C08052gna 6ON5995497661e-92
TDEL0H04510singletonON5845377616e-92
YPL274W (SAM3)na 6ON5875227591e-91
TPHA0G03770singletonON6045747601e-91
Smik_12.2na 7ON5835227563e-91
YLL061W (MMP1)na 7ON5835227539e-91
ZYRO0D17952gna 6ON5855817484e-90
AER405Cna 6ON4974917399e-90
KLLA0B06776gna 6ON5885327407e-89
Smik_6.483na 6ON5905857391e-88
Suva_16.18na 6ON5835757284e-87
Suva_16.31singletonON5864887242e-86
Kwal_56.22951na 6ON5965457112e-84
Ecym_4758na 6ON5875226841e-80
SAKL0C02662g1.83ON5485166652e-78
Ecym_10871.83ON5705006523e-76
Ecym_10881.84ON5675166507e-76
TDEL0E00250singletonON5875826517e-76
TBLA0A07060na 8ON6255056484e-75
TDEL0C061701.84ON5735076412e-74
SAKL0C02640gsingletonON5484986382e-74
KLTH0F02420g1.84ON6215496432e-74
TBLA0A054601.84ON6084986388e-74
Kwal_33.134011.83ON5594966331e-73
CAGL0A01199gna 8ON6135236352e-73
ZYRO0F16632g1.84ON6075106352e-73
TPHA0B044701.84ON5995176291e-72
Kwal_33.134111.84ON5604996243e-72
KLLA0E16281gna 8ON6055146249e-72
KAFR0D039401.83ON5975146221e-71
Smik_5.241.83ON5905026221e-71
KNAG0C05920singletonON5995026212e-71
SAKL0C02728g1.84ON5624776174e-71
NCAS0A006101.84ON6074966186e-71
YEL063C (CAN1)1.83ON5904686169e-71
NDAI0F041901.84ON5994996161e-70
KLTH0F02398g1.83ON5555526102e-70
CAGL0J08162g1.84ON5975026133e-70
YNL268W (LYP1)1.84ON6115196125e-70
SAKL0C02684gsingletonON5884876099e-70
Skud_14.711.84ON6125026082e-69
TBLA0A054501.83ON6064876054e-69
Smik_6.473na 8ON6065056055e-69
NCAS0B085701.83ON5325075996e-69
Suva_14.751.84ON6115026048e-69
YPL265W (DIP5)na 8ON6085056012e-68
Skud_16.12na 8ON6075075994e-68
Ecym_2480na 8ON5865145974e-68
Kpol_2000.641.84ON6105025968e-68
NCAS0A006001.83ON5444965911e-67
Smik_14.681.84ON6114995942e-67
CAGL0J08184g1.83ON5725135922e-67
KLLA0C02343g1.83ON5814825922e-67
KNAG0C007901.83ON5795035922e-67
KNAG0F004801.84ON5974995932e-67
Kpol_358.3na 8ON5755045903e-67
SAKL0G14916gna 8ON5815145913e-67
NDAI0A006101.83ON5655055884e-67
TPHA0M00130singletonON6114875914e-67
Suva_5.41.83ON5905025888e-67
Skud_5.261.83ON5904995843e-66
YNL270C (ALP1)1.83ON5735075816e-66
KNAG0L02470singletonON6385035856e-66
TPHA0H028507.44ON6015215802e-65
Skud_14.701.83ON5734985772e-65
KNAG0L02460singletonON5885605773e-65
Kwal_33.15545na 8ON5765175773e-65
Smik_14.671.83ON5735015763e-65
KLTH0B01166gna 8ON5775085755e-65
KAFR0C051607.44ON5845055755e-65
NDAI0F042001.83ON5665025745e-65
TDEL0C061801.83ON5835015731e-64
NDAI0I02660na 8ON5945125731e-64
Suva_16.40na 8ON6065055713e-64
Smik_15.5327.44ON6315115724e-64
AFR668W1.83ON5564945665e-64
AFR667C1.84ON5635015659e-64
YOR348C (PUT4)7.44ON6275135691e-63
KLLA0C02365g1.84ON5795265661e-63
TPHA0B044801.83ON6034995652e-63
Suva_14.731.83ON4974605582e-63
ACL135Wna 8ON5885095642e-63
Skud_47.1singletonON3283265434e-63
NCAS0D02260na 8ON5975555625e-63
ZYRO0F16654g1.83ON5805165615e-63
CAGL0E05632g7.44ON5985275563e-62
KAFR0D007001.83ON5745255536e-62
Kpol_2000.651.83ON5954775521e-61
Suva_8.4027.44ON6834965552e-61
SAKL0B10956g7.44ON5725055441e-60
Skud_15.5157.44ON6265115471e-60
KAFR0B06430singletonON5935245432e-60
Ecym_80357.44ON5635335317e-59
Kwal_26.69407.44ON5705035301e-58
KNAG0E003907.44ON5995865311e-58
KLLA0F23419g7.44ON5735135291e-58
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D04130
         (644 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}             1172   0.0  
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   882   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              833   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   750   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   739   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   738   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   737   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   736   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   734   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   728   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   726   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   725   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   722   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   722   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   717   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   715   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   712   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   707   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   703   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   702   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   699   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   690   0.0  
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   688   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   685   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   678   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   673   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      669   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   667   0.0  
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      664   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   658   0.0  
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   655   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   650   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   637   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   632   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   621   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   619   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   615   0.0  
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   603   0.0  
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   587   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   576   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   567   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   565   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   564   0.0  
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   558   0.0  
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   555   0.0  
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   554   0.0  
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              549   0.0  
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   545   0.0  
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   544   0.0  
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   543   0.0  
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   542   0.0  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            540   0.0  
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   540   0.0  
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   540   0.0  
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   540   0.0  
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   536   0.0  
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              534   0.0  
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   532   0.0  
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   527   e-180
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   526   e-180
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   525   e-180
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   523   e-179
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   523   e-179
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   518   e-177
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   518   e-177
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   513   e-175
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   511   e-175
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   513   e-175
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              512   e-174
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   502   e-171
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                496   e-169
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   496   e-168
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   489   e-166
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   488   e-166
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   489   e-165
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   487   e-165
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   486   e-164
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   484   e-163
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              484   e-163
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   481   e-162
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   473   e-160
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   468   e-157
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              464   e-156
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   464   e-156
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   442   e-147
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   439   e-146
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   435   e-144
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   429   e-143
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   428   e-142
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   427   e-142
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   424   e-141
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   423   e-140
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   423   e-140
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   416   e-137
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   412   e-136
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   412   e-136
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   412   e-136
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   409   e-135
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   409   e-134
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   408   e-134
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   408   e-134
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   407   e-134
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   405   e-133
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   404   e-133
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   404   e-133
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   403   e-132
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   402   e-132
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   401   e-132
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   400   e-131
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   397   e-130
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   397   e-130
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   396   e-130
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   394   e-129
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    392   e-128
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   392   e-128
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   391   e-128
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   391   e-128
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   389   e-127
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   389   e-127
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   389   e-127
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   387   e-126
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   386   e-125
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   384   e-125
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   383   e-125
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   380   e-123
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    379   e-123
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   379   e-123
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   378   e-123
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   376   e-122
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   372   e-121
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   374   e-120
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   372   e-120
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   372   e-120
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   363   e-117
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   361   e-116
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   358   e-115
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   359   e-115
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   357   e-114
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   355   e-114
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   355   e-114
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   350   e-112
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   348   e-111
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   347   e-111
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   345   e-110
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   342   e-109
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   332   e-105
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   325   e-103
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                317   1e-99
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   307   4e-97
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   307   6e-97
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   310   6e-97
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              310   1e-96
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      302   6e-94
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   302   9e-94
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   299   1e-92
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   297   6e-92
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   296   1e-91
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   297   1e-91
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    295   3e-91
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   294   9e-91
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   292   4e-90
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   289   9e-90
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   289   7e-89
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   289   1e-88
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   285   4e-87
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   283   2e-86
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   278   2e-84
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   268   1e-80
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   260   2e-78
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   255   3e-76
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   254   7e-76
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                255   7e-76
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   254   4e-75
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   251   2e-74
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   250   2e-74
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   252   2e-74
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   250   8e-74
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   248   1e-73
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   249   2e-73
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   249   2e-73
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   246   1e-72
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   244   3e-72
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   244   9e-72
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   244   1e-71
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   244   1e-71
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            243   2e-71
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   242   4e-71
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              242   6e-71
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   241   9e-71
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   241   1e-70
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   239   2e-70
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   240   3e-70
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   240   5e-70
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   239   9e-70
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   238   2e-69
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   237   4e-69
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   237   5e-69
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            235   6e-69
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   237   8e-69
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   236   2e-68
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   235   4e-68
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   234   4e-68
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   234   8e-68
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   232   1e-67
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   233   2e-67
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   232   2e-67
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   232   2e-67
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              232   2e-67
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                233   2e-67
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   231   3e-67
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   232   3e-67
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   231   4e-67
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     232   4e-67
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   231   8e-67
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   229   3e-66
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   228   6e-66
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             229   6e-66
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   228   2e-65
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   226   2e-65
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             226   3e-65
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   226   3e-65
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   226   3e-65
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   226   5e-65
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   226   5e-65
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            225   5e-65
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   225   1e-64
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   225   1e-64
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   224   3e-64
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   224   4e-64
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   222   5e-64
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   222   9e-64
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   223   1e-63
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   222   1e-63
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   222   2e-63
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   219   2e-63
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   221   2e-63
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         213   4e-63
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              221   5e-63
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   220   5e-63
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   218   3e-62
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   217   6e-62
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   217   1e-61
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   218   2e-61
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   214   1e-60
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   215   1e-60
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   213   2e-60
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   209   7e-59
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   208   1e-58
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   209   1e-58
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   208   1e-58
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   209   1e-58
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   207   3e-58
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   202   1e-56
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   203   2e-56
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   201   1e-55
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   198   3e-55
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     198   9e-55
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   195   5e-54
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     187   3e-53
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     187   3e-53
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   191   1e-52
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   189   3e-52
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      190   4e-52
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     189   1e-51
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   188   1e-51
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             177   2e-51
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   187   3e-51
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      187   4e-51
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   187   5e-51
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   187   7e-51
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   186   1e-50
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            185   1e-50
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   185   2e-50
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   184   5e-50
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   183   9e-50
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   182   2e-49
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   182   3e-49
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   182   4e-49
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   181   6e-49
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   180   1e-48
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   179   3e-48
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   178   1e-47
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   177   2e-47
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              176   3e-47
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   177   4e-47
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    175   5e-47
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   175   2e-46
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   173   3e-46
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   173   6e-46
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   172   9e-46
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   172   1e-45
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   171   4e-45
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   159   4e-45
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   170   7e-45
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   169   1e-44
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   167   1e-44
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   169   1e-44
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   167   3e-44
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   157   1e-43
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   166   1e-43
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   165   4e-43
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              164   5e-43
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   164   6e-43
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                164   1e-42
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   163   2e-42
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            162   2e-42
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   162   6e-42
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   160   1e-41
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   159   3e-41
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   159   5e-41
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   159   7e-41
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   158   1e-40
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   147   6e-40
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   155   9e-40
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   154   2e-39
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   153   8e-39
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   152   9e-39
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   150   4e-38
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   150   7e-38
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   148   4e-37
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   145   1e-36
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     128   4e-34
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   132   1e-31
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   125   4e-29
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   120   2e-27
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   115   4e-26
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   114   2e-25
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   112   4e-25
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   112   7e-25
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   110   2e-24
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   108   6e-24
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   108   9e-24
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      98   9e-24
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     102   2e-23
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   107   2e-23
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   107   3e-23
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    102   6e-23
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   101   2e-21
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   100   2e-21
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          94   4e-21
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...    96   9e-20
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...    85   3e-16
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...    84   4e-16
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...    80   8e-15
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...    79   2e-14
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...    77   5e-14
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...    75   3e-13
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          68   2e-12
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    63   9e-10
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              54   4e-08
NDAI0K00670 Chr11 (145793..146326) [534 bp, 177 aa] {ON} Anc_8.803     34   0.67 
Smik_12.301 Chr12 (561707..564052) [2346 bp, 781 aa] {ON} YLR241...    33   3.0  
AGL114C Chr7 complement(490370..492730) [2361 bp, 786 aa] {ON} S...    32   4.2  
Skud_12.316 Chr12 (564758..567103) [2346 bp, 781 aa] {ON} YLR241...    32   4.9  
YLR241W Chr12 (620473..622821) [2349 bp, 782 aa] {ON} Putative p...    32   5.3  
Suva_4.22 Chr4 complement(49235..49357,49383..50132) [873 bp, 29...    31   8.7  

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score = 1172 bits (3031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/644 (89%), Positives = 577/644 (89%)

Query: 1   MSSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSY 60
           MSSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSY
Sbjct: 1   MSSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSY 60

Query: 61  AGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITS 120
           AGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHM        SPLSAAIKEHDVAITS
Sbjct: 61  AGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMETELTTTLSPLSAAIKEHDVAITS 120

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           KEEDAHLRKSIQPRHVLMSSLA          NGSALHKAGPAGLVIGYAIMGTCLYCII
Sbjct: 121 KEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCII 180

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
           QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT
Sbjct: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240

Query: 241 TKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS 300
           TKVNND                GAKGYAEADFFFNTCKVLMITGFFIL          TS
Sbjct: 241 TKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTS 300

Query: 301 GYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 360
           GYIGAKYWHDPGAFRGDRSIDRFKDVM          GASEFIAIGASEQSNPRRAIPSA
Sbjct: 301 GYIGAKYWHDPGAFRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSA 360

Query: 361 AKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFIN 420
           AKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFIN
Sbjct: 361 AKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFIN 420

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC
Sbjct: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
           ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS
Sbjct: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600
           VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI
Sbjct: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600

Query: 601 RAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           RAKNIDLITHRNIFDA             LKNGPTWKRLVHFWC
Sbjct: 601 RAKNIDLITHRNIFDAEIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/649 (66%), Positives = 498/649 (76%), Gaps = 9/649 (1%)

Query: 2   SSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTD----QSSSNED 57
           SSSN  D D    ++  +YE+K+ +K         E +NIVEYF  +T      + S+ D
Sbjct: 3   SSSNQKDSDRISFSTESKYEMKEITK--NSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60

Query: 58  LSYAGRKKWY-ELGVKEPHLKRFIDSFKRAEEGTEET-KHMXXXXXXXXSPLSAAIKEHD 115
             Y G+KK      +K+PHL++ IDSF+RAE+    T + +        SPLSA  K+  
Sbjct: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT-KDPQ 119

Query: 116 VAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTC 175
            A  ++E+D HL+K+I+PRHVL+ SL           NGSALHKAGP GLVIGYAIMG+C
Sbjct: 120 FAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSC 179

Query: 176 LYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMT 235
           LYCIIQACGEMAV+YS LPGNFNAYP+FLVDE FGF+VAWVYC+QWLCVMPLELVTASMT
Sbjct: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239

Query: 236 IDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXX 295
           I YWTT VN D                GAKGYAEA+FFFN+CKVLM+ GFFIL       
Sbjct: 240 IQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299

Query: 296 XXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRR 355
                GYIGAKYWH+PGAFRGD+SIDRFKDVM          GASEFIAIGASEQSNPRR
Sbjct: 300 GAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRR 359

Query: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVV 415
           AIPSAAK MIYRILFIFL+SI LVGFLVPY+S+ELMGSGS  TKASPYV+A++SHGVRVV
Sbjct: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVV 419

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           PHFINAVILL+VLSV+NSAFYSSCRIL+SLSQQGYAP WFNYIDREGRPARAMI+S LF 
Sbjct: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
           +IAFCACSSKEE+VFTWLLAISGLSQ+FTW+AIC+SHIRFRRAM VQGRS+ E+GF+SQ+
Sbjct: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
           GVWGS YAA M+ LALIAEFWVSIAPIGEDHLDA++FFENYLAMPILIV YFGYKI  RD
Sbjct: 540 GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD 599

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           WKLFIRAK+IDL++HR I+D              L+NGP WK++V FWC
Sbjct: 600 WKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNGPFWKKVVAFWC 648

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/643 (63%), Positives = 488/643 (75%), Gaps = 8/643 (1%)

Query: 3   SSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAG 62
           S +N D  D++ +S  ++E+ D   +++    + E +NIVE+F  S    S++   SY+ 
Sbjct: 2   SQSNKDHHDYVPDS--KFEMVDI--VKKPEIKNSEQDNIVEFFTSSNTAHSASSSESYSR 57

Query: 63  RKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKE 122
                  G+ +PH+++F+DSF+RAE+  E  + +        SP S + + H     + +
Sbjct: 58  SPDKPLFGITKPHVRKFVDSFRRAEDDEETAEDLENELVSTLSP-SKSKQLH--GQKNGD 114

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +DAHL+KSI+PRHVLM SL           NGSAL KAGP  LVIGY IMG+CLYCIIQA
Sbjct: 115 DDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQA 174

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
           CGEMAV YS LPGNFNAYP+FLVDEG  F VAWVYC+QWLCVMPLELVTASMTIDYWTTK
Sbjct: 175 CGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTK 234

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           VN+D                GAKGYAEA+FFFN+CKVLM+ GFFIL            GY
Sbjct: 235 VNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 294

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IGAKYWH+PGAFRGD+SIDRFKDVM          GASEFIAIGASEQSNPRRAIPSAAK
Sbjct: 295 IGAKYWHNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAK 354

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS-PYVLAISSHGVRVVPHFINA 421
            MIYRILFIFL+SI LVGFLVPYDS+EL+GSG   +  + PYV+A++SHGVRVVPHFINA
Sbjct: 355 TMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINA 414

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           VILL+VLSV+NSA+YSSCRIL+SL+QQGYAP+WF YIDREGRPARAM+++ +FG+IAFC+
Sbjct: 415 VILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCS 474

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
           CS KEE+VF WLL+I+GLSQ+FTW AICLSHIRFRRAM VQGRS+ E+GF+SQ+GVWGS 
Sbjct: 475 CSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSG 534

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIR 601
           YAA M+ LALIAEFWVSIAPIGEDHLDA++FFENYLAMPILIV YFGYKIY +DWKLFIR
Sbjct: 535 YAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIR 594

Query: 602 AKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           AK+IDLI+HR IFD              L+NGP WKR+V FWC
Sbjct: 595 AKDIDLISHRTIFDGELVRQEEEEYKEKLRNGPKWKRVVAFWC 637

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/643 (58%), Positives = 446/643 (69%), Gaps = 21/643 (3%)

Query: 13  IDNSNVEYELKDASKLRRRSFNDLENENIVEYF-GKSTDQSSSNEDLSYAGRKKWYELGV 71
           + +S   YELKD  K      +  E +N VEYF   S D SSS   L Y           
Sbjct: 1   MSSSKSPYELKDL-KNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHNT------ 53

Query: 72  KEPHLKRFIDSFKRAEEGTEE---TKHMXXXXXXXXSPLSAAIKE-------HDVAITSK 121
               L+RF DSFK+A++  EE   T  M        SP S   +E        ++   + 
Sbjct: 54  --SALRRFFDSFKKADQSAEERVETAQMNDLASAI-SPSSRQRQELEKNESSDNIGARTG 110

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
            +   L+K+IQPRHVLM +L           NG+AL  AGPAGL+IGY IMG+ LYCIIQ
Sbjct: 111 NKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQ 170

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           ACGEMA+ YSNL G +NAYP+FLVD+GFGFAVAWVYC+QWLCV PLELVTASMTI YWTT
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            VN D                GA+GYAEA+FFFN CK+LM+TGFFIL            G
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDG 290

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           +IG KYWHDPGAF G  SIDRFK V+          G SEFIAI  +EQ+NPR+A+P AA
Sbjct: 291 FIGGKYWHDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAA 350

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINA 421
           K MIYRILF+FL++I L+GFLVPY+S++L+GS  GGTKASPYV+A++SHGVRVVPHFINA
Sbjct: 351 KQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINA 410

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           VILL+VLS++NS+FYSS RIL +LS+QGYAP+ F YID+ GRP  AM +S LFG+IAFCA
Sbjct: 411 VILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCA 470

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            S KE++VFTWLLAISGLSQ+FTW AICLSHIRFRRAM VQGRS+ ELGFRSQ GVWGS 
Sbjct: 471 ASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGST 530

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIR 601
           YA  M+ L LI +FWV+IAPIGE  LDA++FFENYLAMPILI  Y GYKI+ +DWKLFIR
Sbjct: 531 YACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIR 590

Query: 602 AKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           A  IDLI+HR IFD              LKNGP WKR+V FWC
Sbjct: 591 ADKIDLISHRQIFDEELIKQEDEEFRERLKNGPCWKRVVAFWC 633

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/642 (57%), Positives = 444/642 (69%), Gaps = 19/642 (2%)

Query: 13  IDNSNVEYELKDASKLRRRSFNDLENENIVEYF-GKSTDQSSSNEDLSYAGRKKWYELGV 71
           + +S   YELKD  K      +  E EN +EYF   S D+ S    L Y           
Sbjct: 1   MSSSTSPYELKDL-KNSSTEVHAAEQENEIEYFETDSNDRPSQQPHLDYEQHNT------ 53

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXX--XXXXXSPLSAAIKEHDVAITSKEEDAH--- 126
               ++RF+DSFKRA++  E+   +          SP S    E +   T+ +   H   
Sbjct: 54  --SAVRRFLDSFKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGH 111

Query: 127 ----LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
               L+K+IQPRHVLM +L           NG+AL  AGPAGL+IGYAIMG+ LYCIIQA
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
           CGEMA+ YSNL G +NAYP+FLVD+GFGFAVAWVYC+QWLCV PLELVTASMTI YWTT 
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           VN D                GA+GYAEA+FFFN CK+LM+TGFFIL            GY
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGY 291

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYWH+PGAF G  +IDRFK V+          G SEFIAI  +EQSNPR+AIP AAK
Sbjct: 292 IGGKYWHEPGAFNGVHAIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAK 351

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            MIYRILF+FL++I +VGFLVPY+S +L+GS  GGTKASPYV+AI+SHGVRV PHF+NAV
Sbjct: 352 QMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAV 411

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           ILL+VLS++NS+FYSS R+  +LS+QGYAP+ F+YIDR GRP  AM +S LF +IAFCA 
Sbjct: 412 ILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAA 471

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S KE++VFTWLLAISGLSQ+FTW AICLSHIRFRRAM VQGRS+ ELGF+SQ GVWGS+Y
Sbjct: 472 SPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIY 531

Query: 543 AATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRA 602
           +  M+ L LI +FWV+IAPIGE  LDA++FFENYLAMPILIV Y GYK++N+DWKLFIRA
Sbjct: 532 SCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRA 591

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
             IDL +HR IFD              L+ GP W+R++ FWC
Sbjct: 592 DKIDLTSHRQIFDEELIKQEDDEYRERLRTGPYWRRVLAFWC 633

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/642 (57%), Positives = 445/642 (69%), Gaps = 19/642 (2%)

Query: 13  IDNSNVEYELKDASKLRRRSFNDLENENIVEYF-GKSTDQSSSNEDLSYAGRKKWYELGV 71
           + +S   YE KD  K      +  E +N +EYF   S D+ SS   L Y           
Sbjct: 1   MSSSKSPYEQKDL-KNSSTEIHATEQDNEIEYFETDSNDRPSSQPHLDYEQHNT------ 53

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXX--XXXXXSPLS---AAIKEHD----VAITSKE 122
               ++RF DSFKRA++G ++              SP S     ++++D    +   +  
Sbjct: 54  --SAVRRFFDSFKRADQGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGN 111

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +   L+K+IQPRHVLM +L           NG+AL  AGPAGL+IGYAIMG+ LYCIIQA
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
           CGE+A+ YSNL G +NAYP+FLVD+GFGFAVAWVYC+QWLCV PLELVTASMTI YWTT 
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           VN D                GA+GYAEA+FFFN CK+LM+TGFFIL            G+
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYWHDPGAF G  SIDRFK V+          G SEFIAI  +EQSNPR+AIP AAK
Sbjct: 292 IGGKYWHDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAK 351

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            MIYRILF+FL++I ++GFLVPY+S +L+GSG GGTKASPYV+AI+SHGVRVVPHF+NAV
Sbjct: 352 QMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAV 411

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           ILL+VLS++NS+FYSS R+  +LS+QGYAP++F+YIDR GRP  AM +S LF +IAFCA 
Sbjct: 412 ILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAA 471

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S KEE+VFTWLLAISGLSQ+FTW AIC SHIRFRRAM VQGRS+ ELGF+SQ GVWGS+Y
Sbjct: 472 SPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMY 531

Query: 543 AATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRA 602
           A  M+ L LI +FWV+IAPIGE  LDA++FFENYLAMPILI  Y GYKI+ +DWKLFIRA
Sbjct: 532 ACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRA 591

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
             IDL +HR IFD              L+NGP WKR+  FWC
Sbjct: 592 DKIDLESHRQIFDEELIKQEDEEYRERLRNGPYWKRVAAFWC 633

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/642 (57%), Positives = 443/642 (69%), Gaps = 19/642 (2%)

Query: 13  IDNSNVEYELKDASKLRRRSFNDLENENIVEYFGK-STDQSSSNEDLSYAGRKKWYELGV 71
           + +S   YELKD  K      +    +N +EYF   S D+ SS   L Y           
Sbjct: 1   MSSSKSLYELKDL-KNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNT------ 53

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXX--XXXXXSPLSAAIKE-------HDVAITSKE 122
               ++RF DSFKRA++G ++              SP S   +E        ++   +  
Sbjct: 54  --SAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGH 111

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +   L+K+IQPRHVLM +L           NG+AL  AGPAGL+IGYAIMG+ LYCIIQA
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
           CGEMA+ YSNL G +NAYP+FLVD+GFGFAVAWVYC+QWLCV PLELVTASMTI YWTT 
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           VN D                GA+GYAEA+FFFN CK+LM+TGFFIL            G+
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYWHDPGAF G  +IDRFK V           G SEFIAI  +EQSNPR+AIP AAK
Sbjct: 292 IGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAK 351

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            MIYRILF+FL++I L+GFLVPY+S +L+GS  GGTKASPYV+A++SHGVRVVPHFINAV
Sbjct: 352 QMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAV 411

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           ILL+VLS++NS+FYSS R+  +LS+QGYAP+ F+YIDR GRP  AM +S LF +IAFCA 
Sbjct: 412 ILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAA 471

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S KEE+VFTWLLAISGLSQ+FTW AICLSH+RFRRAM VQGRS+ ELGF+SQ GVWGS Y
Sbjct: 472 SPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAY 531

Query: 543 AATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRA 602
           A  M+ L LIA+FWV+IAPIGE  LDA++FFENYLAMPILI  Y GYK++++DWKLFIRA
Sbjct: 532 ACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRA 591

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
             IDL +HR IFD              L+NGP WKR+V FWC
Sbjct: 592 DKIDLDSHRQIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC 633

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/646 (58%), Positives = 452/646 (69%), Gaps = 27/646 (4%)

Query: 15  NSNVEYELKD--ASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVK 72
           ++   YELKD  +      S  D E E + +    S D+SS     +  G          
Sbjct: 3   DTKAPYELKDLKSGSAVITSTTDREVEYLDDQINNSYDESSVRNRKTKEGT--------- 53

Query: 73  EPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXS--PLSAAIKEH--DVAITS-------- 120
              ++ FIDSFKRA+  +     +        S   + AA+ +   D AI+S        
Sbjct: 54  --FVRSFIDSFKRADRNSNPLHDLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKG 111

Query: 121 --KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
              E+   L+K+I+PRHV+M SL           NG  L KAGPA LVIGYAIMGTCLYC
Sbjct: 112 HQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYC 171

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           IIQA GE+AV YS+L G FNAYP+FLVD   GF+VAWVYC+QWLCV PLELVTASMTI Y
Sbjct: 172 IIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKY 231

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           WTTKV+ D                GA+GYAEA+FFFN CKVLM+TGFFIL          
Sbjct: 232 WTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAG 291

Query: 299 TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
             GY+GAKYWHDPGAF GD+SIDRFK VM          GA+EFIA+ A+EQSNPR+AIP
Sbjct: 292 NDGYLGAKYWHDPGAFNGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIP 351

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHF 418
           SAAK ++YRI+ IFL+SI L+GFLVPY+S +L+GSG  G KASPYV+A+SSHGVRVVPHF
Sbjct: 352 SAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHF 411

Query: 419 INAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIA 478
           INAVILL+VLSV NSAFYSS R+L SL+QQGYAP+WF+Y+DREGRP RAM++S LFG+IA
Sbjct: 412 INAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIA 471

Query: 479 FCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVW 538
           FCA S KE EVF+WLLAISGLSQ+FTW+ IC+SHIRFRRAM VQGRS+ E+G+ SQ GV+
Sbjct: 472 FCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVY 531

Query: 539 GSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKL 598
           GS YAA MLFLALIA+FWV+IAPIGE  LDA++FF+NYLAMPILI FYFGY+++ RDWKL
Sbjct: 532 GSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKL 591

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           FIRAK+IDL THR IFD              L+NGP W+R + FWC
Sbjct: 592 FIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/646 (57%), Positives = 445/646 (68%), Gaps = 23/646 (3%)

Query: 19  EYELKDASKLRRR--SFNDLENENIVEYFGKST--DQSSSNEDLSYAGRKKWYELGVKEP 74
           ++E+KD     R   + +  E ENI+EYFG+ +  D SSS     Y     + E   K  
Sbjct: 37  DFEMKDVKPKEREIGTASITEQENIIEYFGEKSNDDTSSSPVTRQYVSGADFEEHTTKPS 96

Query: 75  HLKRFIDSFKRAEEGTEETKH------------MXXXXXXXXSPLSAAIKEHDVAITSKE 122
            ++ F+DSFKRAE+      +            +         PL      HD  I    
Sbjct: 97  RIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLP---HHHDAQINDNS 153

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +   L+K+I+PRHVLM SL            GS+L +AGPAGL+IG+ IMG+CLYCIIQA
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+AV+YS+L G FNAYP+FLVDE F FAVAW+Y IQWLCV PLELVTASMTI YWTTK
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 243 VNNDX-XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
           V+ D                 GA GYAEA+F FN+CK++M+ GFFIL          T G
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIGAKYWHDPGA RGD SI RFK  M          G SEFI + ASEQSNPR+AIPSAA
Sbjct: 334 YIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAA 393

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINA 421
           K MIYRIL +FLSSI +VGFLVPY+S +L+GS   G KASPYVLAIS+HGVRVVPHFINA
Sbjct: 394 KKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINA 453

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           VIL++VLSV+NSA+YSS R+L SL++QGYAP+ ++YIDREGRP   M  + +FG+IAFCA
Sbjct: 454 VILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCA 513

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            S KE+EVF WLLAISGLSQ+FTWMAIC+SHIRFRRAMHVQGRSI ELGFRSQ+G +GS 
Sbjct: 514 TSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSA 573

Query: 542 YAATMLFLALIAEFWVSIAPIGED---HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKL 598
           YAA M+F+ LIA+FWV++ PI  D    LDAK+FFENYLAMPIL+ FYFGYKI+ +DWKL
Sbjct: 574 YAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKL 633

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           FIRAKNIDLI+HRNIFD              L+ GP W+R+  FWC
Sbjct: 634 FIRAKNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/661 (55%), Positives = 451/661 (68%), Gaps = 34/661 (5%)

Query: 4   SNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGR 63
           S+N +  D + +    YE+K+  + + R  N +  EN VEYF  + +++   E+L Y G 
Sbjct: 15  SSNTNNSDGVSH----YEMKEI-QAKEREINSIAPENEVEYFENTMEKTM--ENLEYEGD 67

Query: 64  KKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAA------------- 110
           +K         HL+RFIDSFKRAE     +           +P+S               
Sbjct: 68  RK-------ASHLRRFIDSFKRAEGSHPNSPDSSNSIGGGATPISTNDSSSQLDNELNPK 120

Query: 111 ---IKEHDVAITSKEEDAH---LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
              + E  +   S+E+D +   L+K+I+PRH++M SL           N   L+ AGPAG
Sbjct: 121 GSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAG 180

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           LVIGYAIMG+C+YCIIQACGE+AV YS+L G FN YP+FLVD   GF+VAWVYC+QWLCV
Sbjct: 181 LVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCV 240

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
            PLELVTASMTI YWT KV+ D                GAKGYAEADFFFN CK+LMI G
Sbjct: 241 CPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIG 300

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIA 344
           FFIL          T GYIG++YWH+PGAFRG+  I RFK V+          G SE +A
Sbjct: 301 FFILAIIIDCGGAGTDGYIGSRYWHNPGAFRGNTGIQRFKGVVATFVTAAFAFGMSEQLA 360

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYV 404
           + ASEQSNPR+AIPSAAK MIYRILF+FL S+ LVGFLVPY S +L+G+    TKASPYV
Sbjct: 361 MTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYV 420

Query: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464
           +A++SHGVRVVPHFINAVILL+VLSV+N AFYSS RIL SL++QG AP+ F+YIDREGRP
Sbjct: 421 IAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRP 480

Query: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524
           A AM++S +FGIIAFCA S KEE+VFTWLLAISGLSQ+FTW+ ICLSHIRFRRAM VQGR
Sbjct: 481 AVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGR 540

Query: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPI-GEDHLDAKSFFENYLAMPILI 583
           S+ E+G++SQ+G+WGS+YA  M+ LALIA+FWV+I+PI G   L A+SFFENYLAMPILI
Sbjct: 541 SLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILI 600

Query: 584 VFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFW 643
             Y  YK++ +DW LFI A  IDL+T R IFD              L+NGP WKR+V FW
Sbjct: 601 ALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEEYQEKLRNGPYWKRVVDFW 660

Query: 644 C 644
           C
Sbjct: 661 C 661

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/661 (55%), Positives = 455/661 (68%), Gaps = 30/661 (4%)

Query: 2   SSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYA 61
           SS+ N + +D  D S+  YE+K+    + +    +E EN VEYF  + +++   E++ Y 
Sbjct: 15  SSNMNMNDNDLDDVSH--YEMKEIQP-KEKENASIERENEVEYFENTMEKTM--ENMEYK 69

Query: 62  GRKKWYELGVKEPHLKRFIDSFKRAE------------EGTE--ETKHMXXXXXXXXSPL 107
           G  +         +  RFIDSF+RAE             G+    TK          +P 
Sbjct: 70  GDHQ-------RSYFHRFIDSFRRAEGSHPNSPDSTNLNGSTPISTKDSSSRLDNELNPK 122

Query: 108 SAAIKEHDVAITSKEEDA---HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           S+ I    +  +S+E++    +L+KSI+PRH +M SL           N   L+ AGP G
Sbjct: 123 SSYITVDGIKQSSQEQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGG 182

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           L+IGYAIMG+C+YCIIQACGE+AV YS+L G FN YP+FLVD   GF+VAW++C+QWLCV
Sbjct: 183 LIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCV 242

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
            PLELVTASMTI YWT KVN D                GAKGYAEADFFFN CK+LMITG
Sbjct: 243 CPLELVTASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITG 302

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIA 344
           FFIL          T GYIG++YW DPGAFRGD SI RFK V+          G SE +A
Sbjct: 303 FFILAIIIDCGGAGTDGYIGSRYWRDPGAFRGDTSIQRFKGVVATFVTAAFAFGMSEQLA 362

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYV 404
           + ASEQSNPR+AIPSAAK MIYRILF+FL+S+ALVGFLVPY S +L+G+    TKASPYV
Sbjct: 363 MTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYV 422

Query: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464
           +A+SSHGVRVVPHFINAVILL+VLSV+NSAFY+S RIL SL++QG AP+ F+YIDREGRP
Sbjct: 423 IAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRP 482

Query: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524
           A AMI+S +FG+IAFCA S KEE+VFTWLLAISGLSQ+FTW+ ICLSHIRFR+ M VQGR
Sbjct: 483 AVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGR 542

Query: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILI 583
           S+ E+G++SQ+GVWGS YA  ++ LALI +FWV+I+PIG D  L A+SFFENYLAMPILI
Sbjct: 543 SLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILI 602

Query: 584 VFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFW 643
             Y  YK++ RDW LFI A  IDL++HRNIFD              L+NGP WKR++ FW
Sbjct: 603 ALYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFW 662

Query: 644 C 644
           C
Sbjct: 663 C 663

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/661 (56%), Positives = 458/661 (69%), Gaps = 32/661 (4%)

Query: 4   SNNADKDDFIDNSNVEYELKDASKLRRRSFNDL------ENENIVEYFGK-STDQSSSNE 56
           S + D ++  D SN E    D SK   + +++L         + VEYF K + D  + +E
Sbjct: 12  SQSPDSEE-ADVSNYELHNIDDSK---KGYDNLGSGSRGATTSAVEYFDKENVDGVNIDE 67

Query: 57  DLSYAGRKKWYELGVKE---PHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKE 113
            L     +   E G  E    +++RFIDSFKRAE+   +  ++        + L+ AI  
Sbjct: 68  KL-----QSTTEFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLE---NDLTTAISM 119

Query: 114 HDVAITS---------KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           + +             K E+  L+KSI+PRHV+M SL           N  ALH AGPAG
Sbjct: 120 NSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAG 179

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           LVIGYAIMG+C+YCIIQA GEMAV YSNL G FN YP+ LVD GFGFAVAWVYC+QWLCV
Sbjct: 180 LVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCV 239

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
            PLELVT S+TI YWTT VN D                GA+GYAEA+FFFN CK+LMI G
Sbjct: 240 CPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIG 299

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIA 344
           F+IL            GY+GAKYWHDPGAFRG   I RFK +M          GA+EFIA
Sbjct: 300 FYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIA 359

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYV 404
           + A+EQSNPR+AIPSAAK ++YR++ IF+ +IAL+GFLVP+DS +LMG+G   TKASPYV
Sbjct: 360 LTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYV 419

Query: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464
           LAIS HGVRVVPHFINAVIL++V SV+NSAFYSS R+L  L+QQGYAP++F+Y+DR+GRP
Sbjct: 420 LAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRP 479

Query: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524
            RAM  + LFG+IAFCA S KE++VFTWLLAISGLSQ+FTW+AIC+SHIRFRRAM VQGR
Sbjct: 480 FRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGR 539

Query: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILI 583
           S+ E+GF++QLGV+GS YA  M+ LALIA+FWV+IAPIG +  LDA+ FFENYLAMPILI
Sbjct: 540 SLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILI 599

Query: 584 VFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFW 643
            FYFGYK++ RDW+LFIRAK+IDL ++R +FD              LKNGP WKR+V FW
Sbjct: 600 AFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDFW 659

Query: 644 C 644
           C
Sbjct: 660 C 660

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/647 (59%), Positives = 450/647 (69%), Gaps = 13/647 (2%)

Query: 4   SNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGR 63
           S+++ K D I      YEL+D  K+ + + ++ E EN VEYF      ++ +E     GR
Sbjct: 3   SSSSSKADIIP----PYELQDVKKVEQPAISNQELENEVEYFSGEPQGTNESEPHGNTGR 58

Query: 64  KKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSP--LSAAIKEHDVA---- 117
               +   K      FID F+R        + +        SP  LS   K  D      
Sbjct: 59  N---DGSAKGNIFVNFIDGFRRQTNHNSAAEDLENELTTCVSPATLSDYKKSGDSGSVDE 115

Query: 118 ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
           +  K ++ HL+KSI+PRHV+M SL           N  AL+ AGPAGL IGYAIMG+C+Y
Sbjct: 116 LEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIY 175

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
           CIIQA GEMAV+YSNL G FNAYP+FLV    GFAVAWVY +QW CV PLELVTASMTI 
Sbjct: 176 CIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIK 235

Query: 238 YWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX 297
           YWTTKVN D                GA+GYAEA+FFFN CKVLMITGFFIL         
Sbjct: 236 YWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGA 295

Query: 298 XTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
              GYIG KYWHDPGAFRGD++IDRFK V           G SEFIA+ ASEQSNPR+AI
Sbjct: 296 GNDGYIGGKYWHDPGAFRGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAI 355

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P+AAK ++YRI+ IFL SI +VGFLVP++S +LMGS S  TKASPYV+AISSHGVRVVPH
Sbjct: 356 PAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPH 415

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
           F+NAVILL+VLSV NSAFYSS RIL SLSQQGYAP++FNYIDREGRPARAM+I  LF +I
Sbjct: 416 FVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVI 475

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AFCA SSKEE+VFTWLLAISGLSQIFTW AICLSHIRFRRAMHVQGRS+ E+GF+S+LGV
Sbjct: 476 AFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGV 535

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           WGS YAA M+FL LIA+FWV +APIG + LDA+SFFE+YLAM +LI FY GY  + +DW 
Sbjct: 536 WGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWT 595

Query: 598 LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           LFIRAK+IDL  HR IFD              L+NGP WKR+++FWC
Sbjct: 596 LFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNFWC 642

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/661 (55%), Positives = 451/661 (68%), Gaps = 30/661 (4%)

Query: 2   SSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYA 61
           SS+ N +++D  D S+  YE+K+    + +    +E EN VEYF K+ +++   E++ Y 
Sbjct: 15  SSNMNMNRNDLDDVSH--YEMKEIQP-KEKQIGSIEPENEVEYFEKTVEKTI--ENMEYE 69

Query: 62  GRKKWYELGVKEPHLKRFIDSFKRAE------------EGTE--ETKHMXXXXXXXXSPL 107
           G            +L+RFIDSF+RAE             GT    TK          +  
Sbjct: 70  GEHH-------ASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELNRK 122

Query: 108 SAAIKEHDVAITSKEEDA---HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           S+ I    +  + +E++    +L+KSI+PRH +M SL           N   L+ AGP G
Sbjct: 123 SSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGG 182

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           L+IGYAIMG+C+YCIIQACGE+AV YS+L G FN YP FLVD   GF+VAW++C+QWLCV
Sbjct: 183 LIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCV 242

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
            PLELVTASMTI YWTT VN D                GAKGYAEADFFFN CK+LMI G
Sbjct: 243 CPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVG 302

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIA 344
           FFIL          T GYIG+KYW DPGAFRGD  I RFK V+          G SE +A
Sbjct: 303 FFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLA 362

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYV 404
           + ASEQSNPR+AIPSAAK MIYRILF+FL+S+ LVGFLVPY S +L+G+    TKASPYV
Sbjct: 363 MTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYV 422

Query: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464
           +A+SSHGVRVVPHFINAVILL+VLSV+N AFY+S RIL SL++QG AP+ F+YIDREGRP
Sbjct: 423 IAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRP 482

Query: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524
           A AM++S LFG+IAFCA S KEE+VFTWLLAISGLSQ+FTW+ ICLSHIRFRRAM VQGR
Sbjct: 483 AAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGR 542

Query: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPI-GEDHLDAKSFFENYLAMPILI 583
           S+ E+G++SQ+GVWGS YA  M+ LALIA+FWV+IAPI G   L A+SFFENYLAMPI I
Sbjct: 543 SLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWI 602

Query: 584 VFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFW 643
             Y  YK++ +DW LFI A  +DL++HRNIFD              L+NGP WKR++ FW
Sbjct: 603 ALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRVLDFW 662

Query: 644 C 644
           C
Sbjct: 663 C 663

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/663 (54%), Positives = 449/663 (67%), Gaps = 34/663 (5%)

Query: 2   SSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYA 61
           SS+ N + DD +DN +  YE+K+    + +    +E EN +EYF ++ +++   E + Y 
Sbjct: 15  SSNMNMNGDD-LDNVS-HYEMKEIQP-KEKEIGSIEPENEIEYFEETVEKNI--ESMEYQ 69

Query: 62  GRKKWYELGVKEPHLKRFIDSFKRAEEG------------------TEETKHMXXXXXXX 103
           G            +L+RFIDSFKRAE                     + +  +       
Sbjct: 70  GENH-------ASYLRRFIDSFKRAEGSHANSSDSSNSNTTTPIFTNDSSSQLDNELNRK 122

Query: 104 XSPLSA-AIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGP 162
            S ++   IK+       K+E+  L+KSI+PRH +M SL           N   L+ AGP
Sbjct: 123 SSYITVDGIKQAPQEQEQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGP 180

Query: 163 AGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWL 222
            GL+IGYAIMG+C+YCIIQACGE+AV YS+L G FN YP FLVD   GF+VAW++C+QWL
Sbjct: 181 GGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWL 240

Query: 223 CVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMI 282
           CV PLELVTASMTI YWT KV+ D                GAKGYAEADFFFN CK+LMI
Sbjct: 241 CVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMI 300

Query: 283 TGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEF 342
            GFFIL          T GYIG+KYW DPGAFRGD  I RFK ++          G SE 
Sbjct: 301 IGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGIVATFVTAAFAFGMSEQ 360

Query: 343 IAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASP 402
           +A+ ASEQSNPR+AIPSAAK MIYRILF+FL+S+ LVGFLVPY S +L+G+    TKASP
Sbjct: 361 LAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASP 420

Query: 403 YVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREG 462
           YV+A+SSHGVRVVPHFINAVILL+VLSV+NSAFY+S RIL SL++QG AP+ F+YIDREG
Sbjct: 421 YVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREG 480

Query: 463 RPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQ 522
           RPA AM++S LFG+IAFCA S KEE+VFTWLLAISGLSQ+FTW+ ICLSHIRFRRAM VQ
Sbjct: 481 RPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQ 540

Query: 523 GRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPI-GEDHLDAKSFFENYLAMPI 581
           GRS+ E+G++SQ+GVWGS YA  M+ LALIA+FWV+IAPI G   L A+SFFENYLAMPI
Sbjct: 541 GRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPI 600

Query: 582 LIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVH 641
           LI  Y  +K++  DW LFI A  +DL++HRNIFD              L+NGP WKR+V 
Sbjct: 601 LIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRIVD 660

Query: 642 FWC 644
           FWC
Sbjct: 661 FWC 663

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/579 (60%), Positives = 412/579 (71%), Gaps = 9/579 (1%)

Query: 75  HLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKE-------HDVAITSK--EEDA 125
             +RF+DSFKRAE+                  L    KE        +  +T K  +++ 
Sbjct: 45  QFRRFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNK 104

Query: 126 HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGE 185
            L+++I+PRHV++ SL           N  ALH AGPAGL+IGY+IMGTCLYCIIQA GE
Sbjct: 105 ELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGE 164

Query: 186 MAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNN 245
           +AVSYS+L G FN YP+FLVD  FGF+VAWVYCIQWLCV PLELVTASMTI YWTT VN 
Sbjct: 165 LAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNA 224

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
           D                GA+GYAEA+FFFN CK+LM+ GFFIL            GYIG 
Sbjct: 225 DIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGD 284

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           +YWH PGAF GDR ID FK +M          GA+EFIA+ A+EQSNPR+AIPSAAK ++
Sbjct: 285 RYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVL 344

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           YRILFIFL SI LVGFLVPYDS +LMGSG   TKASPYVLA+S+HGV+VVPHFINAVILL
Sbjct: 345 YRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILL 404

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           +VLSV NSAFYSS R+L+SL+QQG AP++F+Y+DREGRP RAM+ + +F II+FCA S K
Sbjct: 405 SVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPK 464

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
           EE+VFTWLLAISGLSQ+FTW AICLSHIRFR+AM VQ RS+ E+GF++Q GVWGS Y   
Sbjct: 465 EEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCF 524

Query: 546 MLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNI 605
           ML + LIA+FWV+IAPIGE  LDA+ FFENYLAMPILI+FY GYKI+ +DW LFIRA NI
Sbjct: 525 MLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNI 584

Query: 606 DLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           DL  HR IFD              LKNG   KR+  FWC
Sbjct: 585 DLDKHRQIFDEELLKQEDEEYREKLKNGGYLKRIAAFWC 623

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/645 (56%), Positives = 445/645 (68%), Gaps = 18/645 (2%)

Query: 13  IDNSNV-EYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGV 71
           + + NV  YE+K+     +    + ENE  VEYF  +  Q    +D S   +   YE  +
Sbjct: 28  VHSDNVTRYEMKNLKPKEKEISTEQENE--VEYFENTKIQEGGIDD-STITQTNDYEQNI 84

Query: 72  KEP--HLKRFIDSFKRAEEGTEETKH---------MXXXXXXXXSPLSAAIKEHDVAITS 120
            +P   ++ FIDSFK AE      K          M        S L          I +
Sbjct: 85  TKPTSRVRNFIDSFKPAEVKNSPEKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIEN 144

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K ++  L+K+I+PRHVLM SL            GS+L  AGPAGL++G+ IMGTCLYCII
Sbjct: 145 KSDE--LKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
           QA GEMAV+YS+L G FNAYP+FLVD  FGF+VAWVY +QWLCV PLELVTASMTI YWT
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 241 TKVNNDXXXXX-XXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXT 299
           TKV+ D                 GA GYAEA+F FN+CK+LM+ GFFIL           
Sbjct: 263 TKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGN 322

Query: 300 SGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPS 359
            GYIG KYWH+PGAFRG+ +IDRFK VM          G SEFI + ASEQSNPR+AIPS
Sbjct: 323 DGYIGGKYWHEPGAFRGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 382

Query: 360 AAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFI 419
           AAK M+YRI+ +FL+SI +VGFLVPYDS +L+GS  GG KASPYVLA+S+HGV+VVPHFI
Sbjct: 383 AAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFI 442

Query: 420 NAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAF 479
           NAVIL++VLSV+NSAFYSS R+L SL++QGYAP+ F YIDREGRP   M ++ LFG+IAF
Sbjct: 443 NAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAF 502

Query: 480 CACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWG 539
           CA S KE+EVF WLLAISGLSQ+FTW+AIC+SH+RFRRAMHVQG+SI ELGFRSQ+G WG
Sbjct: 503 CATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWG 562

Query: 540 SVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLF 599
           S YAA M+   LIA+FWV+IAPIGE  LDAK+FFENYLAMPIL+  YFGYKIY ++W +F
Sbjct: 563 SSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIF 622

Query: 600 IRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           IRAK+IDL++HRNIFD              L+NGP W+R+  FWC
Sbjct: 623 IRAKDIDLVSHRNIFDEEIIKQEEEEYREKLRNGPMWRRVYDFWC 667

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/664 (54%), Positives = 435/664 (65%), Gaps = 52/664 (7%)

Query: 32  SFNDLENENIVE----YFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAE 87
           S  D+  EN+ +    Y   S D +++  D S    +K +   +K   ++ F++ FKRAE
Sbjct: 14  SLQDITTENVTQDRFSYDDGSID-TNNGSDSSQNSSQKDFISNIKNKRIRNFLEGFKRAE 72

Query: 88  E-----------------GTEETKHMXXXXXXXXSPLS---------------------- 108
                               E T++         SP S                      
Sbjct: 73  HHDESSLANVDRITIAPSKDEPTEYPGNNQYQRSSPFSNGLEDDQKVGPDIYIDDLENKQ 132

Query: 109 ------AAIKEHDVAITSKEED--AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKA 160
                   I++ ++    K+ED  A LR++I+PRHV+M SL           N   L  A
Sbjct: 133 QVELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAA 192

Query: 161 GPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQ 220
           GPA LVIGY IMGTC+YCIIQACGEMAV+Y NL G+FN +P+FLVD GF FAVAWVYCIQ
Sbjct: 193 GPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQ 252

Query: 221 WLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVL 280
           WLCV PLELVTASMTI YWTTKV+ D                GAKGYAEA+F FNTCKVL
Sbjct: 253 WLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVL 312

Query: 281 MITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGAS 340
           MI GFFIL          T GYIGAKYW+DPGAFRG   I+RFK VM          GA+
Sbjct: 313 MICGFFILAICIDTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGAT 372

Query: 341 EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA 400
           EFIA+ A+EQSNPR+AIPSAAK +IYR+L IFL++I L+GFLVPYDS +L+GSG   TKA
Sbjct: 373 EFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKA 432

Query: 401 SPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDR 460
           SPYVLAIS HGVRV  HF+NAVIL++V+SV NSAFYSS R+L SL+QQG AP+ F+Y+DR
Sbjct: 433 SPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDR 492

Query: 461 EGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMH 520
           EGRP  AM  S +  +IAFCA S KE EVFTWL+AI+GLSQ+FTW AICLSH+RFRRAM 
Sbjct: 493 EGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMK 552

Query: 521 VQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMP 580
           VQGRS+ E+G+ SQ G+ GS+YAA M+ LALIA+FWV++ P+G    DA SFF NYLAMP
Sbjct: 553 VQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMP 612

Query: 581 ILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLV 640
           ILIVFYFGYKI+ RDW+LFIRAK+IDLI+HR I+D              L+NGP WKR+ 
Sbjct: 613 ILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEEYREKLRNGPKWKRVA 672

Query: 641 HFWC 644
            FWC
Sbjct: 673 AFWC 676

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/624 (56%), Positives = 433/624 (69%), Gaps = 31/624 (4%)

Query: 20  YELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRF 79
           ++ +++S  ++ +  D E+ N V    K+ +++  N D            G       +F
Sbjct: 41  FQFQESSSAKKETKTD-ESNNAVLIQEKTQEETIHNSD------------GSSRSPFGKF 87

Query: 80  IDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMS 139
           +DSFKR +E                S L + + E         E++ L+++I+ RHVL+ 
Sbjct: 88  VDSFKRVDE------------KQTTSDLESGLGE------VPGENSDLKQTIKKRHVLLI 129

Query: 140 SLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNA 199
           SL           N   L  AGP GLVIGY+IMG+CLYCIIQACGE+AV YS+LP NFN 
Sbjct: 130 SLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNI 189

Query: 200 YPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXX 259
           YPTFLVD+ FGFAVAWVYC+QWLCV PLELVTASMTI YWTT VN D             
Sbjct: 190 YPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVI 249

Query: 260 XXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRS 319
              GA+GYAEA+FFFN+CKVLM+ GFFIL          TSGYIGAKYWH PGAF G+R 
Sbjct: 250 NTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYWHSPGAFNGNRP 309

Query: 320 IDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALV 379
           ID FK VM          GASEFI++ A+EQSNPR+AIP AAK+MIYRILF+FLSSI L+
Sbjct: 310 IDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLI 369

Query: 380 GFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSC 439
           GFLVPY+S  L+GSGS  TKASPYV+A++SHGVRVVPHFINAVILL+VLSV NSAFYSS 
Sbjct: 370 GFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSS 429

Query: 440 RILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGL 499
           R+L SL+QQGYAP+ F YID+ GRP  AM+ S LF  IAFCA S KEE+VFTWLLAISGL
Sbjct: 430 RLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGL 489

Query: 500 SQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSI 559
           SQ+FTW+AIC+SH+RFRRA+ VQG S+ E+GF+SQ+G++GS+YAATML LALIA+FWV++
Sbjct: 490 SQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVAL 549

Query: 560 APIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXX 619
           APIG + LDA++FF+NYLAMPIL+V YFGYKI  RDWK +I A  IDL++HR +FD    
Sbjct: 550 APIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDEDIL 609

Query: 620 XXXXXXXXXXLKNGPTWKRLVHFW 643
                      KN  T +++  F+
Sbjct: 610 KQEVAEIEQEKKNLSTGRKIQEFF 633

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/663 (54%), Positives = 448/663 (67%), Gaps = 35/663 (5%)

Query: 1   MSSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDL---ENENIVEYFGKSTDQSSSN-- 55
           MS+S N        +SN   EL+D      ++   +    NEN VEY       +S++  
Sbjct: 1   MSNSRNG-------SSNEHIELQDYKGNSEKNSTTVYIDSNENEVEYLSDKDASTSADYT 53

Query: 56  -EDLSYAGRKKWYELGVKEPHLKRFIDSFKR-----------AEEGTEETKHMXXXXXXX 103
            +DL+ + +KK       + ++KRFIDSFK+           AE   E+   +       
Sbjct: 54  YKDLNPSDKKK-------KSNIKRFIDSFKQPIRPNSDYIDAAELDYEQA--LENGITTS 104

Query: 104 XSPLSAAIKEHDV--AITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAG 161
            SP +  +++ +     T   ++  L+++I+PRHV+M SL           NG+AL  AG
Sbjct: 105 VSPSAPNLRKLNQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAG 164

Query: 162 PAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQW 221
           PAGLVIGY+IMG+ +YCIIQA GEMA++YSNLPG +N YP+FLV++GFGFA+AWVYCIQW
Sbjct: 165 PAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQW 224

Query: 222 LCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLM 281
           L V PLELVTAS+TI YWTT VN+D                GAKGYAEA+FF N CKVLM
Sbjct: 225 LTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLM 284

Query: 282 ITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASE 341
           + GFFIL            GY+G  YWH PGAFRGD SID FK +           G +E
Sbjct: 285 MIGFFILSITITAGGAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGTE 344

Query: 342 FIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS 401
           F+A+ A+EQSNPR AIPSAAK ++YRI+ ++L SI ++GFLVP+DS+ L+GS    T AS
Sbjct: 345 FLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSAS 404

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           PYVLA S HGVRVVPHFINAVIL++VLSV NSAFYSS R+L SL++QGYAP+WF+YIDRE
Sbjct: 405 PYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDRE 464

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           GRPARAM++S LFG+IAFCA S KE EVFTWLLAISGLSQ+FTW AICLSHIRFR AM V
Sbjct: 465 GRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKV 524

Query: 522 QGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPI 581
           QGRS+ E+G+ +Q GVWGS YA  M+FL  IA+FWV+IAPIG   L A++FFENYLAMPI
Sbjct: 525 QGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPI 584

Query: 582 LIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVH 641
           LIV Y GYKIY +DW L I+A++IDL +HR IFD              LKNGP W+R+V 
Sbjct: 585 LIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVD 644

Query: 642 FWC 644
           FWC
Sbjct: 645 FWC 647

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/641 (54%), Positives = 434/641 (67%), Gaps = 17/641 (2%)

Query: 15  NSNV---EYELKDASKLRRRS-FNDLENENIVEYFGKSTDQ----SSSNEDLSYAGRKKW 66
           N NV    YE+ D  K  + S F   ENE  VEYF ++  Q    + SN+    +  +  
Sbjct: 7   NENVGHSRYEMNDLKKKSKTSEFETTENE--VEYFAQTDSQLPSSTLSNDFEPISQDQNT 64

Query: 67  YELGVKEPHLKRFIDSFKRAEEGTEET--KHMXXXXXXXXSPLSAAIKEHDVAITSKEED 124
                     + FIDSFKRA++    T    +         P     +  +VA  S+E  
Sbjct: 65  TSHSRTRAKFQNFIDSFKRADKEQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGKSEE-- 122

Query: 125 AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACG 184
             L+ SI+PRHV+M SL           NG++L  +GPAGLVIGYAIMG+C+YCIIQA G
Sbjct: 123 --LKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATG 180

Query: 185 EMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN 244
           EMAV YS L G FN+YP+FL++   GF+VAWVYCIQWLCV PLELVTASMTI YWTTKV+
Sbjct: 181 EMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVD 240

Query: 245 NDXXXXX-XXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYI 303
            D                 GA GYAEA+FFFN+CK+LM+ GFFIL            GYI
Sbjct: 241 PDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYI 300

Query: 304 GAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKI 363
           G +YWHDPGAFRG+ +IDRFK V+          G SE I + ASEQSNPR+AIPSAAK 
Sbjct: 301 GGRYWHDPGAFRGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKK 360

Query: 364 MIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVI 423
           MIYRI+ I+L S+ +VGFLVP++S +L+GS  GG KASPYVLA+S+HGVRVVPHFINAVI
Sbjct: 361 MIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINAVI 420

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           LL+VLSV+NSAFYSS R+L  L++QGYAP+ F Y+DREGRP   M ++ L  +I+FCA S
Sbjct: 421 LLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATS 480

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
            KE++VF WLLAISGLSQ+FTW AICLSHIRFRRAM VQGRS+ E+GF+SQ GVWGS YA
Sbjct: 481 PKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYA 540

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAK 603
             M+ L LIA+FWV+IAPIGE  LD ++FFENYLA PILI  YFGYKIY +DW+LFIRAK
Sbjct: 541 FIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAK 600

Query: 604 NIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +IDL  +R++FD              ++N P W+++  FWC
Sbjct: 601 DIDLDINRDVFDEELIRQEEEEYKEKMRNAPIWQKIYEFWC 641

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/647 (55%), Positives = 439/647 (67%), Gaps = 37/647 (5%)

Query: 20  YELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEP----- 74
           YE+ D +K     F+  ENE  VEY     +  SS+ +             +KEP     
Sbjct: 8   YEMSD-TKAEAHVFSSQENE--VEYLDSQLNGDSSSNN------------SIKEPTSTGA 52

Query: 75  --HLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLS-----AAIKEHDVAITSKEEDAH- 126
             H K F+DSF+R +        +        S  S     +  +E D  + S     H 
Sbjct: 53  KGHFKSFVDSFRRGDHAKNALHDLENDITTSISHASLVHAVSKAREDDEIMQSVASAEHR 112

Query: 127 ---------LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
                    L+K+I+PRHV+M SL           N S L  AGPA LVIGY+IMG+CLY
Sbjct: 113 KVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLY 172

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
           CIIQA GEMAV YS+L G FN YP+FL+D   GF+VAWVYC+QWLCV PLELVTAS+TI 
Sbjct: 173 CIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIK 232

Query: 238 YWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX 297
           YWTTKV+ D                GA+GYAEA+FFFN CKVLM+ GFFIL         
Sbjct: 233 YWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGA 292

Query: 298 XTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
              GY+GAKYWH+PGAFRG+ ++DRFK VM          GA+EFIA+ A+EQSNPR+AI
Sbjct: 293 GNDGYLGAKYWHEPGAFRGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAI 352

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           PSAAK ++YRI+ IFL SI ++GFLVPYDS +L+GS   G KASPYVLA+S HGVRVVPH
Sbjct: 353 PSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPH 412

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
           FINAVILL+VLSV NSAFYSS R+L SLSQQGYAP+WF+Y+DR+GRPARAM++S LFG+I
Sbjct: 413 FINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVI 472

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AFCA S KE +VF WLLAISGLSQ+FTW AIC+SH+RFR AM VQGRSI E+GF SQ GV
Sbjct: 473 AFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGV 532

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           +GS+YAATM+ LAL+A+FWV+IAP+ E  LDA++FF++YLAMPILI  YFGYK+Y RDWK
Sbjct: 533 YGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWK 592

Query: 598 LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           L+I+A  IDLI+HR IFD              L+NGP W+R+  FWC
Sbjct: 593 LYIKADKIDLISHRQIFDENILKQEDEEYKEKLRNGPAWRRIADFWC 639

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/616 (56%), Positives = 426/616 (69%), Gaps = 22/616 (3%)

Query: 50  DQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAE----------EGTEETKHMXXX 99
           + +++N+  S  G  K+    VK    + ++DSFKRAE          E   E   M   
Sbjct: 53  ESTNNNQSSSPHGASKFLP-QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEF 111

Query: 100 XXXXXSPLS-----------AAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXX 148
                +  S           A +      +  ++E+A L+++I+PRHV+M SL       
Sbjct: 112 DNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTG 171

Query: 149 XXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEG 208
               NG+ L +AGPA LVIGY IMGTCLYCIIQACGE+AV+YS + G+FN +P+FLVD G
Sbjct: 172 LLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPG 231

Query: 209 FGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYA 268
           F FAVAWVYCIQWLCV PLELVT+SMTI YWTTKV+ D                GAKGYA
Sbjct: 232 FNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYA 291

Query: 269 EADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMX 328
           EA+FFFN CKV+M+ GFFI+          T GYIGAKYW+DPGAFRG   I+RFK VM 
Sbjct: 292 EAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMD 351

Query: 329 XXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSS 388
                    GA+EFIA+ A+EQSNPR+AIPSAAK + YRIL IFL+SI L+GFLVPY+S 
Sbjct: 352 TFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSD 411

Query: 389 ELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQ 448
           +LMGS SGG  ASPYVLA S HGV VV HFINAVILL+VLSV+NSAFYSS R+L  L+Q 
Sbjct: 412 QLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQV 471

Query: 449 GYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAI 508
           GYAP+WF+Y+DR GRP R+M+ + +  +IAFCA S KE +VFTWLLAISGLSQIFTW AI
Sbjct: 472 GYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAI 531

Query: 509 CLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLD 568
           C+SHIRFRR M VQGRS+ ELGFR+Q GV GS YAA MLFLAL+A+FWV++ P+    LD
Sbjct: 532 CVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLD 591

Query: 569 AKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXX 628
           A++FF+NYLAMPIL+  Y G+K++ RD++LFIRAKNIDLI+HR IFD             
Sbjct: 592 AENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKE 651

Query: 629 XLKNGPTWKRLVHFWC 644
            L+NGP WKR+V FWC
Sbjct: 652 KLRNGPKWKRVVDFWC 667

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/643 (54%), Positives = 443/643 (68%), Gaps = 26/643 (4%)

Query: 14  DNSNVEYELKDASKLRRRSFN-DLENENIVEYFG--KSTDQSSSNEDL------SYAGRK 64
           D  N  YELK+ +K  ++ +N   E EN +EYF   K  + +++ E+       S +GRK
Sbjct: 6   DLENSNYELKEVNK--KQDYNVSTEQENEIEYFETLKGKNAATTREEEYDFTTDSTSGRK 63

Query: 65  KWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEED 124
           +    GVK  + + FIDSFK AE     T              S  I++H       E D
Sbjct: 64  RH---GVKG-YFRDFIDSFKPAENPQPHTN----LDMELVGVTSETIEQHK----KDEGD 111

Query: 125 A--HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
               L+K+IQPRHV++ SL           NG+ L +AGPAGLVIGY IMG+ +YCIIQA
Sbjct: 112 TGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQA 171

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
           CGEMAV+Y  L G FNAYPTFL+D GF FA AWVYC+QWLCV PLELVTASMTI YWTTK
Sbjct: 172 CGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTK 231

Query: 243 VNNDXXXXXXXX-XXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
           V+ D                 GA+GYAEA+F FN+CK+LM+ GFFIL          T G
Sbjct: 232 VDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDG 291

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIG +YWHDPGAFRG+R++DRFK V+          G SEFIA+ ASEQSNPRRAIPSAA
Sbjct: 292 YIGGRYWHDPGAFRGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAA 351

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINA 421
           K +IYR L I+L+SI L+GFLVPY+SS+L+G+ S G KASPYVLA+++HGVRVVPHFINA
Sbjct: 352 KKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFINA 411

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           VI+++VLSVSNSAFYSS R+L +LSQQG+AP+ F+Y+DR GRP   +I++ LF +IAFCA
Sbjct: 412 VIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCA 471

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            S KE++VFTWLLA+SGLSQIFTWM+ICLSH+RFRRAM VQGRS+ E GF SQ+G++GS 
Sbjct: 472 TSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSA 531

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIR 601
           Y+  +L L L+ +FWV++ P+G   +DA SFFENYLA PI I  Y GYK Y +DW+L+I+
Sbjct: 532 YSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIK 591

Query: 602 AKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +++IDL+ HR I+D              LKNGP WKR   FWC
Sbjct: 592 SQDIDLVAHRQIYDEDILRQEREEETERLKNGPYWKRAYSFWC 634

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/627 (55%), Positives = 419/627 (66%), Gaps = 31/627 (4%)

Query: 18  VEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLK 77
           V  ELKD         +D  N N  +Y  K++ Q+S  E L   G              +
Sbjct: 18  VGNELKDVKSGAVVGSSDFTN-NETDYLEKTSVQNSDFEYLENEGN-----------LFR 65

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVL 137
           RF +SFKRA                   P S    + D +    + D  L+K+I+ RHV+
Sbjct: 66  RFANSFKRA-------------------PGSNNPDKEDGSDAGDKGDNKLKKTIKSRHVV 106

Query: 138 MSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNF 197
           M SL           NG AL   GPAGLVIGYAIMG+CLYCIIQA GE+AV Y++L G F
Sbjct: 107 MISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGF 166

Query: 198 NAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXX 257
           NAYP+ L+D   GF+VAWVYC+QWLCVMPLELVTAS+TI YWTT VN D           
Sbjct: 167 NAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVLTI 226

Query: 258 XXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGD 317
                GA+GYAEA+FFFNTCKVLMITGFFIL            GYIG KYW+DPG+F GD
Sbjct: 227 AINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSFSGD 286

Query: 318 RSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIA 377
           + ID FK V+          GA+EFIA+ A+EQ+NPR++IPSAAK ++YRI+ IFL SI 
Sbjct: 287 KPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSIT 346

Query: 378 LVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYS 437
           LVGFLVP++S ELMGSG   T ASPYV+AI+SHGV+VVPHFINAVILL+VLSV NSAFYS
Sbjct: 347 LVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYS 406

Query: 438 SCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAIS 497
           S R+L SL++QGYAP +  Y+DREGRP  AMIIS +FG+I+F A S KEE VFTWLLAIS
Sbjct: 407 SSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAIS 466

Query: 498 GLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWV 557
           GLSQ+FTW AICLSHIRFRRAM VQGRS+ ELGF+SQ+GVWGS YA  M+ L LI +FW 
Sbjct: 467 GLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWT 526

Query: 558 SIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAX 617
           +IAPIGE  LDA++FFENYLAMPILI  YFGYK++ RDW L+I A  IDLI++R IFD  
Sbjct: 527 AIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDED 586

Query: 618 XXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                       L+N    +R   FWC
Sbjct: 587 VLKQEDAEFREKLRNSGWLRRAAEFWC 613

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/627 (54%), Positives = 417/627 (66%), Gaps = 31/627 (4%)

Query: 18  VEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLK 77
           V  ELK+ +       +D  N N  +Y  K++ Q+S  E L   G              +
Sbjct: 18  VSNELKENNPGAVVGSSDFTN-NETDYLEKTSVQNSGFEYLENEGN-----------LFR 65

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVL 137
           RF +SFKRA                   P S    + D +    + D  L+K+I+ RHV+
Sbjct: 66  RFANSFKRA-------------------PGSNNPDKEDGSDAGDKGDNKLKKTIKSRHVV 106

Query: 138 MSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNF 197
           M SL           NG AL   GPAGLVIGYAIMG+CLYCIIQA GE+AV Y++L G F
Sbjct: 107 MISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGF 166

Query: 198 NAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXX 257
           NAYP+ L+D   GF+VAWVYC+QWLCVMPLELVTAS+TI YWTT VN D           
Sbjct: 167 NAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVVII 226

Query: 258 XXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGD 317
                GA+GYAEA+FFFNT KVLMI+GF IL            GYIG KYW+DPG+F GD
Sbjct: 227 TINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSFSGD 286

Query: 318 RSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIA 377
           + ID FK V+          GA+EFIA+ A+EQ+NPR++IPSAAK ++YRIL +++ SI 
Sbjct: 287 KPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSII 346

Query: 378 LVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYS 437
           L+GFLVP++S ELMGSG   T ASPYV+AI+SHGV+VVPH INAVILL+V+S+ NSAFYS
Sbjct: 347 LIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYS 406

Query: 438 SCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAIS 497
           S R+L +L++QGYAP +  Y+DREGRP  AM+IS +FG+I+F A S KEE VFTWLLAIS
Sbjct: 407 SSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAIS 466

Query: 498 GLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWV 557
           GLSQ+FTW AICLSHIRFRRAM VQGRS+ ELGF+SQ+GVWGS YA  M+ L LI +FW 
Sbjct: 467 GLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWT 526

Query: 558 SIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAX 617
           +IAPIGE  LDA++FFENYLAMPILI  YFGYK++ RDW L+I A  IDLI++R IFD  
Sbjct: 527 AIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDED 586

Query: 618 XXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                       L+N    +R   FWC
Sbjct: 587 VLKQEDAEYREKLRNSGWLRRAAEFWC 613

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/571 (55%), Positives = 400/571 (70%), Gaps = 4/571 (0%)

Query: 75  HLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPR 134
               FIDSF+RAE+       M        S    A+ E  ++    + +  L+K+IQPR
Sbjct: 50  RFDEFIDSFRRAEDVRILPNEMNPILSHE-SVFDTAVVE--ISAVDNQINEKLKKTIQPR 106

Query: 135 HVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLP 194
           HV+M +L           NG+ L  AGPAGL+IGYAIM TC+YC++QA GEMAV+Y  L 
Sbjct: 107 HVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLI 166

Query: 195 GNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXX 254
           G F+AYP FL+D G  FAV+W+YCIQW CV PLELVTASMTI YWTTKVN D        
Sbjct: 167 GGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYL 226

Query: 255 XXXXXXX-XGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGA 313
                    GA+GYAEA+FF N CK+LM+TGFFIL           SG+IGA+YWH PGA
Sbjct: 227 LMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGA 286

Query: 314 FRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFL 373
           FRGD  I+RFK ++          G +EF+AI ASEQ+NPR+AIPSAAK +IYR L I++
Sbjct: 287 FRGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYV 346

Query: 374 SSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNS 433
            SI +VGFLVPY+SSEL+GS    TKASPYV+A++SHG+RVVPHFINAVIL++V SV++S
Sbjct: 347 GSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADS 406

Query: 434 AFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWL 493
           AFYSS R+L +L++QG+AP+ F Y+D+ GRP    ++  +  II+FCACSSKE +VF WL
Sbjct: 407 AFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWL 466

Query: 494 LAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIA 553
           L+ISGLS++FTW  I LSHIRFRRAM VQGRS+ E+GF+SQ GVWGSVYA  M+ L LI 
Sbjct: 467 LSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIG 526

Query: 554 EFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNI 613
           +FWV I P+GED  DA SFF+ YLAMP+ IV YFGYKI+NRDW+LFIRAKNIDLI HR+I
Sbjct: 527 QFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHI 586

Query: 614 FDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +D               +N P W+++ +FWC
Sbjct: 587 YDPELLRQERKEMRERARNAPLWRKIYNFWC 617

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/610 (55%), Positives = 418/610 (68%), Gaps = 17/610 (2%)

Query: 39  ENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAE---EGTEETKH 95
           +N V YF ++  Q SSN   S                 +RFIDSFK+AE    G+ +   
Sbjct: 31  DNEVTYF-ENVKQGSSNSTYSLESDHH----AASNTRFRRFIDSFKKAEGPQPGSLDHDV 85

Query: 96  MXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGS 155
           +         P +   K+ D           L+K+I+PRHV+M SL           NG+
Sbjct: 86  LAGDSDIEGKPRTEPEKDDDAR--------ELKKTIKPRHVVMISLGTGIGTGMLVGNGT 137

Query: 156 ALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAW 215
           +L  +GPAGLVIGYAIMG+C+YCIIQA GE+AV Y+ L G FNAYP+ L+D  FGFAVAW
Sbjct: 138 SLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAW 197

Query: 216 VYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXX-XXXXXXXXXXXGAKGYAEADFFF 274
           VYCIQWLCV PLELVTASMTI YWTTKV+ D                 GA GYAEA+FFF
Sbjct: 198 VYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFF 257

Query: 275 NTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXX 334
           N+ K+LM+TGFFIL            GYIG + WH+PG+FRGD+ +DRFK V+       
Sbjct: 258 NSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFRGDKPVDRFKGVVSTLVNAA 317

Query: 335 XXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG 394
              G SEF+ + ASEQSNPR+AIPSAAK M+YRI+ I+L S+ +VGFLVPYDS +L+GS 
Sbjct: 318 FAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSS 377

Query: 395 SGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQW 454
              TKASPYVLAIS HGVRVVPHFINAVILL+VLSV NSAFYSS R L SLSQ GYAP +
Sbjct: 378 GAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSF 437

Query: 455 FNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIR 514
            NY+DR GRP +A  +S L G+IAFCA S KE++VF WLLAISGLSQ+FTW +ICLSH+R
Sbjct: 438 LNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLR 497

Query: 515 FRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFE 574
           FRRAM VQGRS+ E+GF+SQ+G++GS+Y+  M+ L LIA+FW ++ P+GE   D ++FFE
Sbjct: 498 FRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFE 557

Query: 575 NYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGP 634
           NYLAMPI IV YFG+KI+ +DW+LFIRA++IDL++HR IFD              L++GP
Sbjct: 558 NYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRKLRDGP 617

Query: 635 TWKRLVHFWC 644
            W+R+  FWC
Sbjct: 618 MWRRVYDFWC 627

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/637 (52%), Positives = 416/637 (65%), Gaps = 25/637 (3%)

Query: 11  DFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELG 70
           D   +S   YE  D +K   + FND++  +I        D +  N +L  +         
Sbjct: 3   DTPGSSKESYEKNDITKSSAK-FNDVDVIDI--------DSAERNYELPTSS-------- 45

Query: 71  VKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAH--LR 128
                 + FIDSFK       ET H             +   +  V I+  +++ +  L+
Sbjct: 46  TTHSRFRNFIDSFK-----PPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLK 100

Query: 129 KSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAV 188
           K+IQPRHV+M SL           NG+ L  AGPAGLVIGYAIM +C+YCIIQA GEMAV
Sbjct: 101 KTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAV 160

Query: 189 SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXX 248
           +Y  L G FNAYP FLVD    F++AW+YCIQW CV PLELVTASMTI YWTTKVN D  
Sbjct: 161 NYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIF 220

Query: 249 XXXXXXXXXXXXX-XGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKY 307
                          GA+GYAE +F  N+CK+LM+ GFFIL            G+IG KY
Sbjct: 221 VLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKY 280

Query: 308 WHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYR 367
           W DPGAFRG    +RFK V+          G +EF+AI ASEQSNPR+AIPSAAK +IYR
Sbjct: 281 WRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 340

Query: 368 ILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAV 427
            L I+L+SI +VG LVPYDSSEL+GS S  TKASPYVLA+S+HGVRVVPHFINAVIL++V
Sbjct: 341 ALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISV 400

Query: 428 LSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEE 487
            SV++SAFYSS R+L +L++QGYAP+ F ++DR GRP+   ++  +  ++AFCACSSKE 
Sbjct: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460

Query: 488 EVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATML 547
           EVF WLLAISGLSQ+FTW  ICLSHIRFRRAM VQGRSI E+G++SQ+GVWGS YA  M+
Sbjct: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520

Query: 548 FLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDL 607
            L +I + WV I P+GE   D ++FF++YLAMP+ IV Y GYKI+ RDW+LFIRAK+IDL
Sbjct: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580

Query: 608 ITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           I+HR+I D              L+NGP W+R+  FWC
Sbjct: 581 ISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/598 (55%), Positives = 401/598 (67%), Gaps = 18/598 (3%)

Query: 47  KSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSP 106
           KS   S S E +S       Y  G      +R  +SFKRA E                  
Sbjct: 17  KSNTGSESIEKVSLPASDYQYHDGQVLSRFQRLTNSFKRAGEHGR--------------- 61

Query: 107 LSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLV 166
               +      +  +E    L+++I  RH+ M SL           NG ALH  GPAGL 
Sbjct: 62  -GGDVDAEGQPVAPRETK--LKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLA 118

Query: 167 IGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMP 226
           IGYAIMG+C+YCIIQA GEMAVSYS+L GNFNAYP+ L+D   GF+VAWVYC+QWLCV+P
Sbjct: 119 IGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLP 178

Query: 227 LELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFF 286
           LELVTA++TI YWTT VN D                GA+GYAEA+FFFNTCKVLMITGFF
Sbjct: 179 LELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFF 238

Query: 287 ILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIG 346
           IL            GY+G KYWHDPGA  G + I  FK ++          GA+EFIA+ 
Sbjct: 239 ILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIHHFKGIIATMVTAAFAFGATEFIALT 298

Query: 347 ASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLA 406
           A+EQ+NPRRAIPSAAK ++YR+L IFL+ I L+GFLVPY+S ELMGSG   T ASPYV+A
Sbjct: 299 AAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIA 358

Query: 407 ISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPAR 466
           I+SHGV+VVPHFINAVILL+VLSV NSAFYSS R+L SLS+Q YAP W NYIDREGRP R
Sbjct: 359 IASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIR 418

Query: 467 AMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSI 526
           AM++S +FG+IAF A S KEE VFTWLLAISGLSQ+FTW+ IC+SHIRFR+A+ VQG+S+
Sbjct: 419 AMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSL 478

Query: 527 SELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFY 586
            ELG++SQ GV GS YA  ++   L  +FWV+IAP+G D LDA +FFENYLAMPILI  Y
Sbjct: 479 GELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALY 538

Query: 587 FGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           FGY+++ RDWKL+I  + IDL++HR +FD              ++N     R+ HFWC
Sbjct: 539 FGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHFWC 596

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/576 (54%), Positives = 405/576 (70%), Gaps = 22/576 (3%)

Query: 75  HLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEE-----DAHLRK 129
           +LK F+DSFK+ ++   + +                I+++++     ++     +  L+K
Sbjct: 39  NLKDFVDSFKKIDDNNNQYE----------------IEKNEINNIKSDQFNDKLNNQLQK 82

Query: 130 SIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVS 189
           +IQPRHV+M SL           NG+ LH AGPAGL+IGY IM +C+YCIIQACGEMAV+
Sbjct: 83  TIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVN 142

Query: 190 YSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXX 249
           Y  L G FN YP+FLVD  + FAVAWVYCIQWLCV PLELVTASMTI YW  KV+ D   
Sbjct: 143 YLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFV 202

Query: 250 XXXXXXXXXXXX-XGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYW 308
                         GA+GYAEA+FFFN CK+LMI GFFIL          TSGYIG  YW
Sbjct: 203 TIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYW 262

Query: 309 HDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRI 368
           ++PGAFRG     RFK ++          G +EF+AI ASEQSNPR+AIPSAAK +IYR 
Sbjct: 263 NNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 322

Query: 369 LFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVL 428
           LFI++ SI +VGFLVPY+S EL+GS S  TKASPYV+A++SHG+R+ PHFINAVIL++VL
Sbjct: 323 LFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVL 382

Query: 429 SVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEE 488
           SV+NS+FYSS R+L +L++QGYAP+ F Y+DR+GRP   +I + L   IAFCA S KE E
Sbjct: 383 SVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETE 442

Query: 489 VFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLF 548
           VF+WLLAISGLSQ+FTW  ICLSHIRFRRAM +QGRS++ELG++SQ+GVWGS+YAAT++F
Sbjct: 443 VFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMF 502

Query: 549 LALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLI 608
           L LI +FWV++ P+  +  +  +FF+ YLAMPIL++FYFGYK + +DW LFIRAK+IDLI
Sbjct: 503 LILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562

Query: 609 THRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +HR+I+D              LKNG  W ++  FWC
Sbjct: 563 SHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/633 (53%), Positives = 428/633 (67%), Gaps = 32/633 (5%)

Query: 20  YELKDASKLRRRS--FNDLE-NENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHL 76
           YEL D  K   ++   +DLE N+N VEY     +    +  ++ +  KK       + +L
Sbjct: 19  YELSDVKKPDGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESPAKK-------KSNL 71

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136
           +RF+DSFKRAE       HM           +A   E +  + S E++  L+++I+PRHV
Sbjct: 72  RRFVDSFKRAE-------HMIPADDKINEMTTA---EPEAEMASVEDN--LKQTIKPRHV 119

Query: 137 LMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196
           +M SL           NGSAL KAGPAGLV GYAIMGTC+YCIIQ+ GEMAV YS L G 
Sbjct: 120 IMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGG 179

Query: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASM-----TIDYWTTKVNNDXXXXX 251
           FNAYPT LV+ GF     WV C   +    ++ ++  +        YWTT+V+ D     
Sbjct: 180 FNAYPTMLVEPGF-----WVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPDVFVVI 234

Query: 252 XXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDP 311
                      GA+GYAEA+FFFN CKVLM+ GFFIL            GY+G  YW +P
Sbjct: 235 FYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNP 294

Query: 312 GAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFI 371
           GAFRGD+ ID FK V+          G +EFIA+ A+EQSNPR+AIPSAAK ++YRI+ +
Sbjct: 295 GAFRGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLV 354

Query: 372 FLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVS 431
           +L+SI L+GFLVP+ S EL+GSGS  T ASPYV+A++SHGVRVVPHFINAVILL+VLSV 
Sbjct: 355 YLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVG 414

Query: 432 NSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFT 491
           NSAFYSS R+L SLS+QGYAP+WF+Y+DREGRP+RAMI+S LFG+IAFCA S KE EVFT
Sbjct: 415 NSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFT 474

Query: 492 WLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLAL 551
           WLLAISGLSQIFTW++ICLSHIRFR AM  QGRS+ E+GF++Q G+WGS Y+  ++ L L
Sbjct: 475 WLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTL 534

Query: 552 IAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHR 611
           I +FWV+IAPIG   L A++FFENYLAMPILI FYFGYKI+ +DW L+I+A++IDLI+HR
Sbjct: 535 IGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHR 594

Query: 612 NIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            IFD              LKNGP W+R+V FWC
Sbjct: 595 QIFDEELLKQEDYELKEKLKNGPVWRRIVAFWC 627

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/601 (53%), Positives = 405/601 (67%), Gaps = 21/601 (3%)

Query: 47  KSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSP 106
           KS   S S E +S  G    +     +   +RF  +F RA+                   
Sbjct: 25  KSNTGSESVERISLPGDDYKFHEDDSKSRFRRFARTFHRADG------------------ 66

Query: 107 LSAAIKEHDV---AITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPA 163
           L      +DV   A  +++ +  L+++I  RHV M SL           NG ALH  GPA
Sbjct: 67  LGDGASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPA 126

Query: 164 GLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLC 223
           GLVIGYAIMG+CLYCIIQA GE+AVSYS+L GNFNAYP+ L+++ FGF+VAW+YC+QWLC
Sbjct: 127 GLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLC 186

Query: 224 VMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMIT 283
           V+PLELVTAS+TI YWTT VN D                GA+GYAEA+FFFN CKVLMI 
Sbjct: 187 VLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMII 246

Query: 284 GFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFI 343
           GFFIL            GYIG +YW++PGAF G + I  FK ++          GA+EFI
Sbjct: 247 GFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFI 306

Query: 344 AIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPY 403
           A+ A+EQ+NPRRAIPSAAK ++YRIL IFL+ I L+GFLVP++S ELMGSGS  T ASPY
Sbjct: 307 ALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPY 366

Query: 404 VLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGR 463
           V+A++SHGVRVVPHFINAVILL+VLSV NSAFYSS R+L +L+ Q YAP W  +IDR GR
Sbjct: 367 VIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGR 426

Query: 464 PARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQG 523
           P RAM++S +FG+I+F A S KEE VFTWLLAISGLSQ+FTW++IC+SHIRFR+A+ VQG
Sbjct: 427 PMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQG 486

Query: 524 RSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILI 583
           + I ELG++SQ GV GS YA  ++   LI +FWV+IAP+G   LDA SFFENYLA+P+ +
Sbjct: 487 KPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFV 546

Query: 584 VFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFW 643
           V YFG+KI+ RDW+L+I  + IDL +HR  FD              ++N    +R+ H+W
Sbjct: 547 VLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYW 606

Query: 644 C 644
           C
Sbjct: 607 C 607

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/634 (50%), Positives = 427/634 (67%), Gaps = 11/634 (1%)

Query: 14  DNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTD--QSSSNEDLSYAGRKKWYELGV 71
           +++   YEL+D  K    S +    +N VEYF K  D  Q +SN +      +      +
Sbjct: 4   EDTITPYELQDV-KGEAVSASRSPPDNEVEYFDKLGDARQYTSNLEGEGTPTEGVSRHRI 62

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKE---EDAHLR 128
           K P  + FIDSFKR E     T  +        + +S  +  +  +I S E   +   L+
Sbjct: 63  KNPLFRNFIDSFKRGET----TARIADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEELK 118

Query: 129 KSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAV 188
           + I  RH++  ++           N S L+ AGPAGL+IGYA+MGTC+YC+IQA GE+ V
Sbjct: 119 RDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGV 178

Query: 189 SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXX 248
           +Y+NL G FNAYP  LV   F F+V W+Y +QWLC+ PLELVTAS+TI YWTTKV+ D  
Sbjct: 179 TYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVF 238

Query: 249 XXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYW 308
                         G+KGYAEADFFFN  K+ MI+GFFIL            GY+G KYW
Sbjct: 239 VVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYW 298

Query: 309 HDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRI 368
           H+PGAFRG+++ID FK V           G SEF+A+ ASEQ+NPR++IPSAAK+++YRI
Sbjct: 299 HNPGAFRGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRI 358

Query: 369 LFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVL 428
           ++++L+SI ++GFLVP+DS +L  S S G K SPYV+AI+ HGV+VVPH INAVIL+AVL
Sbjct: 359 IWVYLTSITILGFLVPWDSPQLQPS-SDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVL 417

Query: 429 SVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEE 488
           SVSNSAF+ S R+L SLSQ+GYAP+WF+Y+DR+GRP RAM+IS LFG+I FCA S KE +
Sbjct: 418 SVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETD 477

Query: 489 VFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLF 548
           VF+WLLAISGLS IFT+ +IC+SHIR R AM VQGRS+ ELGFRSQ+G +GS YA  +L 
Sbjct: 478 VFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLV 537

Query: 549 LALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLI 608
           L+L+AEFWV++APIGE  LDA+SFFENYLA PI IVFYFGY I+ +D+++FIR+K+IDL 
Sbjct: 538 LSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLD 597

Query: 609 THRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHF 642
             R +FD              ++N P W++++ F
Sbjct: 598 FKRQVFDEDLIKQEDEEYAEQMRNAPRWRKVIAF 631

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/624 (50%), Positives = 400/624 (64%), Gaps = 38/624 (6%)

Query: 21  ELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFI 80
           ELKD      +S N L   +  E+F K++ Q S  E         ++E    E   +RF+
Sbjct: 21  ELKDV-----KSGNVLTGSDTTEFFEKASVQKSDFE---------YFE--GDETKFRRFV 64

Query: 81  DSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSS 140
           +SFK+A  G E  +                      ++    +   L+++I+PRHV+M S
Sbjct: 65  NSFKKAP-GRENDQE---------------------SLQDNNKHEKLKQTIRPRHVVMIS 102

Query: 141 LAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAY 200
           L            G AL+  GP GL +G+ +MGTC+YC+IQA GEMAV+Y  L G FNAY
Sbjct: 103 LGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAY 162

Query: 201 PTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXX 260
           P+FLVD GFGFA AW+YCIQWLCV PLELVTAS+TI YWTT +N D              
Sbjct: 163 PSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTAINPDIFVAVFYLLIIVIN 222

Query: 261 XXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSI 320
             GA+GYAEA+FFFNTCKVLMI GFFI+            GYIGAKYW +PG+F G  +I
Sbjct: 223 FFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGGHTAI 282

Query: 321 DRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVG 380
           D FK V+          G SEF+A+ A+EQ+NPR+++PSAAK M+Y++  +FL S+ L+G
Sbjct: 283 DHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIG 342

Query: 381 FLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCR 440
           FLVP +SSELMGS       SPYV+A++SHGVRVVPHFINAVILL+VLSV NSAFYSS R
Sbjct: 343 FLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSR 402

Query: 441 ILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLS 500
           +L SL++QGYAP  F YIDR+GRP  AM++SI  G + F A S KEE VF WLLAISGLS
Sbjct: 403 LLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLS 462

Query: 501 QIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIA 560
           Q+FTW +IC+SHIRFR+A+ VQGR    LGF++Q GVWGS Y+A ++ L  IA+FW  + 
Sbjct: 463 QLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLI 522

Query: 561 PIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXX 620
           P+G    +A+SFFE YLA PI +  YFGYKIYN++W+LFI A+ IDL  HR IFDA    
Sbjct: 523 PMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLK 582

Query: 621 XXXXXXXXXLKNGPTWKRLVHFWC 644
                    L++   W R+   WC
Sbjct: 583 QEDAEYRAKLRDSSMWHRIAALWC 606

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/629 (50%), Positives = 394/629 (62%), Gaps = 39/629 (6%)

Query: 18  VEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLK 77
           V+ ELKD           +      E+F K++ Q S   D  Y        L   +   K
Sbjct: 18  VDGELKDIKS------GKVVTTETTEFFEKTSAQKS---DFEY--------LEGDDTRFK 60

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVL 137
           RF+ SFKRA                                 +K E+  L+++I+ RH++
Sbjct: 61  RFLSSFKRAHGSGGTDTEGGGGQ------------------NAKHEN--LKQTIKSRHMI 100

Query: 138 MSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNF 197
           M SL           +G+ALH  GPAG  IG+ IMG C+YC+IQA GE+AV Y++L G F
Sbjct: 101 MISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGF 160

Query: 198 NAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYW--TTKVNNDXXXXXXXXX 255
           NAYP+FL+D   GFA AWVYC+QWLCV PLELVTAS+TI +W  +  VN D         
Sbjct: 161 NAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVL 220

Query: 256 XXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR 315
                  GA+GYAEA+FFFN+CKVLM+ GFFI+          TSGYIG KYW DPG+  
Sbjct: 221 IIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLG 280

Query: 316 GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSS 375
           G    D FK ++          G SEF+A+ A+EQ+NPR++IP+AAK MIY+I  +FL S
Sbjct: 281 GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGS 340

Query: 376 IALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAF 435
           + L+GFLVP DS ELMGS       SPYV+A+  HGV VVP FINAVILL+VLSV NSAF
Sbjct: 341 VILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAF 400

Query: 436 YSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLA 495
           YSS R+L SL++Q YAP+ F YIDR GRP  AMIISILFG I F A S KEEEVF WLLA
Sbjct: 401 YSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLA 460

Query: 496 ISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEF 555
           ISGLSQ+FTW  ICLSHIRFRRA+ VQG S  ELGF++Q G+ GS  +A M+ LALI +F
Sbjct: 461 ISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQF 520

Query: 556 WVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
           WVS+ P+G    DA+SFF  YLAMP+ ++FYFGYKI+N+DW+LFIRA  IDL++HR IFD
Sbjct: 521 WVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFD 580

Query: 616 AXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           A             L+N   W R+ +FWC
Sbjct: 581 ADVLKQEDIEYRAKLRNSSIWHRIANFWC 609

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/648 (49%), Positives = 413/648 (63%), Gaps = 32/648 (4%)

Query: 1   MSSSNNADKDDFID--NSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDL 58
           M+ +  +   DFI    S+V++  K  + ++   F  +E E   EY+ K+  QS    D 
Sbjct: 1   MTGATGSSNSDFISPVGSDVKHNDKSDTIIQSEGFPSIEGE--AEYYEKTFSQS----DE 54

Query: 59  SYAGRKK-WYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVA 117
            YA +   W+          RF DSFKRA+                    +A ++ +   
Sbjct: 55  EYAAKSSVWH----------RFKDSFKRADHINTNIHG------------NAELELNPSQ 92

Query: 118 ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
               E+ A L++ I+PRHV+M SLA          NG AL   GPAGL IGYAIMG+CLY
Sbjct: 93  SLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLY 152

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
            IIQA GE+AV+Y  L GNFN YP+FLVD    FA A +YCIQWLCV PLE+++A++TI 
Sbjct: 153 SIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIK 212

Query: 238 YWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX 297
           YW T +N +                G+ GYAEADFFFNTCK+LM  GFFIL         
Sbjct: 213 YWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGA 272

Query: 298 XTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
             S YIG KYW+DPGAF GD  I RFK ++          GASE +A+ ASEQ+NPR+AI
Sbjct: 273 GDSVYIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAI 332

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           PSAAK ++YRI+ I+L+SI LVGFLVPY+S ELMGSGS    +SPYV+A++SHGV+VVP 
Sbjct: 333 PSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPS 392

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
           FINAVIL++VLSV N +FYSS RIL  LS+ GYAP++F Y+DR+GRP  AMI+  L G I
Sbjct: 393 FINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCI 452

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
            F + SS EE VFTWL+A+SGLSQ+FTW  IC+SH+RFR+AM VQ RSI ELGFRSQ+GV
Sbjct: 453 CFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGV 512

Query: 538 WGSVYAATMLFLALIAEFWVSIAPI-GEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596
           WGS Y   M+ L  I +FWV++ P+ G D  DA++FF NYLAMP+ +  YFG+KI+ +DW
Sbjct: 513 WGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDW 572

Query: 597 KLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +L+I A  IDLI+HR IFD              +K+   W +L +FWC
Sbjct: 573 RLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC 620

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/575 (52%), Positives = 391/575 (68%), Gaps = 5/575 (0%)

Query: 70  GVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRK 129
           G ++    RF+DSFKR EE       +              +   D   +SK +   L++
Sbjct: 35  GSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDD---SSKHKT--LKQ 89

Query: 130 SIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVS 189
           +I+PRHVLM SLA          NG +LH  GPA L+IGYAI+ T LYC+IQ+  E+A+ 
Sbjct: 90  NIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAII 149

Query: 190 YSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXX 249
           Y++L G FNAYP  LVD+ F F+V+WVYC+QWLC++PLELVTASMTI YW   +N D   
Sbjct: 150 YTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFV 209

Query: 250 XXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWH 309
                        GA GYAEA+FFFNTCKVLM+ GFFIL            GY+G+ YWH
Sbjct: 210 VIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWH 269

Query: 310 DPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRIL 369
           DPGAFRG+  I+RFK ++          G +EF  + A+EQ NP+++I SA+K ++YRI+
Sbjct: 270 DPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRII 329

Query: 370 FIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLS 429
            I+L + AL+GFLVPY+S EL+GSGS  T ASP+V+AI+SHGV+VVPH INAVILL+VLS
Sbjct: 330 GIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLS 389

Query: 430 VSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEV 489
           V+NSA YSS RIL SLS+QG+AP+ FNY+DR GRP R +++S +FG++ F A S KEE V
Sbjct: 390 VANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETV 449

Query: 490 FTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFL 549
           FTWLLAISGLS++FTW +I LSH+RFRR+M VQGRS+ ELG++S  GVWG+ YA  M+ L
Sbjct: 450 FTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILL 509

Query: 550 ALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLIT 609
            LI +FWV+I+P+G + LDA +FFENYLAMPILI  Y GYK++ RDW++ I A  +DL++
Sbjct: 510 ILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVS 569

Query: 610 HRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           HR IFDA             L++    KR   FWC
Sbjct: 570 HRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/568 (52%), Positives = 384/568 (67%), Gaps = 11/568 (1%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136
           +RF DSF+R E                 +P+ +A K              L+++I+PRHV
Sbjct: 42  RRFADSFRRHEAHNGGGGDGDDEDHEGLTPIESASKHKT-----------LKQNIRPRHV 90

Query: 137 LMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196
           LM SLA          NG +LH  GPA LVIGYAI+ + LYC+IQ+  E+A+ Y++L G 
Sbjct: 91  LMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGG 150

Query: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXX 256
           FNAYP+ LVD+ FGF+V+WVYC+QWLCV+PLELVTASMTI YW   +N D          
Sbjct: 151 FNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVL 210

Query: 257 XXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG 316
                 GA GYAEA+FFFN CKVLMI GFFIL            GY+GA+YWHDPGAFRG
Sbjct: 211 VAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFRG 270

Query: 317 DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376
             SI+RFK ++          G +EF  + A+EQ NP+++I SA+K ++YRIL I++ + 
Sbjct: 271 SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTA 330

Query: 377 ALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
            L+GFLVP++S EL+GSG   T ASP+V+A++SHGVRVVPHFINAVILL+VLSV+NSA Y
Sbjct: 331 ILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFINAVILLSVLSVANSALY 390

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           SS RIL SLS+QG+AP++ NY+DR GRP   +++S +FG+++F A S KEE VFTWLLAI
Sbjct: 391 SSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAI 450

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
           SGLS++FTW +I LSH+R RRAM VQGRS  ELG+ +  GVWG+ YA  M+   L+ +FW
Sbjct: 451 SGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFW 510

Query: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           V+I+P+G + LDA +FFENYLAMPILI  Y GYKI+ RDW+L I +  +DL+ HR IFDA
Sbjct: 511 VAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDA 570

Query: 617 XXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                        L++ P   RL +FWC
Sbjct: 571 EVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/571 (49%), Positives = 369/571 (64%), Gaps = 13/571 (2%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRH 135
           ++ F+DSFKRAE   +  +                ++ +D   T K+    ++++++ RH
Sbjct: 35  VRNFMDSFKRAEPQGQTIREEKLENGL------ETVRTNDYNATQKK----MKQTMKSRH 84

Query: 136 VLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPG 195
           + M SL           NG ALH  GP GLVIGY    T LYC+IQAC E+ VSY+ LPG
Sbjct: 85  ITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPG 144

Query: 196 NFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXX 255
           N+N+YP+FLVD GF FAVAWVY +QW  V+PLELVT+SMTI YW   +N D         
Sbjct: 145 NYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCF 204

Query: 256 XXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR 315
                  G++GYAE++F FN+CKVLM+ GF I+           SGYIG KYWH PGAF 
Sbjct: 205 IVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGAS-KSGYIGGKYWHTPGAFV 263

Query: 316 GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSS 375
           G+++ID FK +           G SEFIA+ A+EQ+NPR+++P A K  +YR+L +FL+ 
Sbjct: 264 GEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTP 323

Query: 376 IALVGFLVPYDSSELMGS-GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSA 434
           I LVGFLVPYDS  L+GS G   + ASP+V+A +SHGV+VVPH INAVIL++V+SV NSA
Sbjct: 324 IILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSA 383

Query: 435 FYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLL 494
           FYS+ RIL SL++QG  P+ F Y+DR+GRP   M+   +FG+I+F A S  EE VFTWL 
Sbjct: 384 FYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLS 443

Query: 495 AISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAE 554
           AI  LSQ+FTW AI LSHIRFR AM  QGRS+ ELG+++  G WGS YA     + L A+
Sbjct: 444 AIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQ 503

Query: 555 FWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNI 613
           FWV+IAPIG    LD  +FF+NYLA P+L+ FYFGYK++ RDWKLFI A  +DL +HR I
Sbjct: 504 FWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLESHRKI 563

Query: 614 FDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           FDA             ++N   W R + FWC
Sbjct: 564 FDADLIKQEDFEHKERIRNSSFWVRALDFWC 594

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/595 (47%), Positives = 370/595 (62%), Gaps = 18/595 (3%)

Query: 51  QSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAA 110
           QSSS+E  +Y+ +K        +  + RF DSFKRAE  T  TK            ++  
Sbjct: 32  QSSSSEK-TYSKQKSG-----SDKLIHRFADSFKRAEGSTTRTKQ-----------INEN 74

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
             + +  + S   D+ L+KS++ RHV+M SL           N   LH  GPA L+IGY 
Sbjct: 75  TSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYI 134

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
           ++    Y +IQA GEMAV+Y  LP NFNAY +  + + FGFA  W+YC QWL V+PLEL+
Sbjct: 135 LVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELI 194

Query: 231 TASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
           TASMTI +W  K+N D                G K Y E +F FN CK+LMI GF IL  
Sbjct: 195 TASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSI 254

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                     GYIGA YWH+PGAF GD SI RFK+V           G  E  A+   EQ
Sbjct: 255 VINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQ 314

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
           SNPR++ P AAK  IYRI+ I+L ++ L+GF VPY+  +LMG+G   T ASPYVLA S H
Sbjct: 315 SNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIH 374

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           GV++VPH INAVIL++V+SV+NS+ Y+  R++ SL+QQGYAP++ +Y+DREGRP RA+I+
Sbjct: 375 GVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIV 434

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
             +FG+IAF A SSKEE VFTWL AI+GLS++FTW +I LSH+RFR+AM VQGRS+ ELG
Sbjct: 435 CCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELG 494

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGY 589
           +++  G+WGS+Y      L  +A+FWV++AP+G     DA+SFF+NYLA PI + FYFGY
Sbjct: 495 YKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY 554

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            +YNRD+ L      IDL  HR I+D              L+N    ++  HFWC
Sbjct: 555 MVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFWC 609

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/607 (48%), Positives = 382/607 (62%), Gaps = 39/607 (6%)

Query: 48  STDQSSSNEDLSYA--------GRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXX 99
           ST  S   E+ +YA         +K  Y  G     + RFI+SF+R  E +E+ K +   
Sbjct: 6   STANSKKEEESTYAIIQTSSPCSKKYSYISG----QVNRFINSFRRKGE-SEDVKELKG- 59

Query: 100 XXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHK 159
                       +  +    +K     ++KSI+ RH+LM SL           NG AL K
Sbjct: 60  ------------ENEECGAATK-----MKKSIKSRHLLMISLGTGIGTGLLVGNGKALAK 102

Query: 160 AGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCI 219
           AGPAGLVIGYA+    LYCIIQA GE+ + YS + GN+ AY + LVD   GF+V+WVYC+
Sbjct: 103 AGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCV 162

Query: 220 QWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKV 279
           QW+ V+PL+LVTA+MT+ YWT   N D                GAKGYAEA+F FN CKV
Sbjct: 163 QWMTVLPLQLVTAAMTVRYWT-NANPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKV 221

Query: 280 LMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGA 339
           LMI GF IL          TSGYIGAKYWH PG+F        FK V           G 
Sbjct: 222 LMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG-----FKGVCYVFCYAAFSYGG 276

Query: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGS-GSGGT 398
            E + + ASEQ NPR++IP+A K +IYRIL I++ +  +V FLVPY+SSELMGS G   +
Sbjct: 277 IEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESAS 336

Query: 399 KASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYI 458
            ASP V+A++SHGV++VPH INAVIL++V+SV NS+ YS+ R+L SLS+QGYAP++ NY+
Sbjct: 337 HASPLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYV 396

Query: 459 DREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRA 518
           DR+GRP     I++L  +IAF A S  EE++F WLLAISGLSQIF W +ICLSH+RFR A
Sbjct: 397 DRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDA 456

Query: 519 MHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYL 577
           MH QG S+ ++G++SQ G WGS +A  +  L LIA+FWV+IAPIGE+  L+A++FF+NYL
Sbjct: 457 MHAQGLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYL 516

Query: 578 AMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWK 637
           A PIL+  YFGYK+Y++DW+L I A  +DL +HRNI D              + N   W 
Sbjct: 517 AFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWV 576

Query: 638 RLVHFWC 644
           RL HFWC
Sbjct: 577 RLCHFWC 583

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/590 (47%), Positives = 377/590 (63%), Gaps = 31/590 (5%)

Query: 58  LSYAG-RKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDV 116
           + YAG R  W           RF DSFKRA+  T                +    K+ D 
Sbjct: 25  IEYAGNRNAW----------TRFTDSFKRAQVDTA---------------VDLEGKDADN 59

Query: 117 AITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCL 176
            +   ++   L+ +I+ RH+ M SL           +G ALH  GPAGLVIGY    T L
Sbjct: 60  GLNKTQQT--LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTML 117

Query: 177 YCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTI 236
           YC++QAC E+ V+Y+ LPGN+NAYPTFLVD+GFGFAVA VY +QW  V+PLELVTASMT+
Sbjct: 118 YCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTV 177

Query: 237 DYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXX 296
            YWT+ VN D                G++GYAEA+F FN+ KVL++ GF I+        
Sbjct: 178 KYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGA 237

Query: 297 XXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRA 356
               GYIG +YWHDPGAF GDR+IDRFK +           G SEFIA+ A+EQ+NPR +
Sbjct: 238 S-EQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRES 296

Query: 357 IPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGS-GSGGTKASPYVLAISSHGVRVV 415
           +P A K  +YR++ +FL  + L+GFLVP++S +L+ + G  G++ASP+V+A + HGVRVV
Sbjct: 297 VPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVV 356

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           PH IN +IL +V+SV NSA YS+ RIL SL++ G  P+ F Y+DR+GRP   +I   LFG
Sbjct: 357 PHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFG 416

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
           +IAF A S++EE VFTWL AI+GLSQ+FTW AI +SH+RFRRAM VQGRS+ ELG+R+  
Sbjct: 417 LIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANT 476

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNR 594
           G  GS YA     + LIA+FW++IAPI +   LD + FF+NYLA P+L+VFY GYK++ R
Sbjct: 477 GALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKR 536

Query: 595 DWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           D++L I +  +DL++HR IFD              L+N   +KRL+ FWC
Sbjct: 537 DFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNSTLFKRLLDFWC 586

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/595 (47%), Positives = 363/595 (61%), Gaps = 14/595 (2%)

Query: 53  SSNEDLSYAGRKKWY--ELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAA 110
           S   D   + R+K Y  +    E  + R  +SFKRAE    +T+            ++  
Sbjct: 26  SGGNDFQISSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQ-----------INEN 74

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
             + +  I S   D+ L+KS++ RHV+M SL           N   LH  GPA LVIGY 
Sbjct: 75  TSDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYV 134

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
           ++    Y +IQA GEMAV+Y  LP NFNAY +  + + FGFA  W+YC QWL V+PLEL+
Sbjct: 135 LVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELI 194

Query: 231 TASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
           TASMTI YW  K+N D                G K Y E +F FN CK+LMI GF IL  
Sbjct: 195 TASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSV 254

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                     GYIG  YWH+PGAF GD SI RFK+V           G  E  A+   EQ
Sbjct: 255 VINCGGAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQ 314

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
           SNPR++ P AAK  IYRI+ I+L ++ L+GF VPY+  +LMG+G   T ASPYVLA S H
Sbjct: 315 SNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIH 374

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           GV++VPH INAVIL++V+SV+NS+ Y+  R++ SLSQQGYAP++ +Y+DREGRP RA+I+
Sbjct: 375 GVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIV 434

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
             +FG+IAF A SSKEE VFTWL AI+GLS++FTW +I LSH+RFR+AM VQGRS+ ELG
Sbjct: 435 CCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELG 494

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGY 589
           +++  G+WGSVY      L  IA+FWV++AP+G D     +SFFE+YLA PI + F+FGY
Sbjct: 495 YKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGY 554

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            IYNRD+ L      IDL  HR I+D               KN    ++  HFWC
Sbjct: 555 MIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLMRKAYHFWC 609

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/599 (46%), Positives = 366/599 (61%), Gaps = 18/599 (3%)

Query: 47  KSTDQSSSNEDLSYAGRKKWYELGVKEPHL-KRFIDSFKRAEEGTEETKHMXXXXXXXXS 105
           KS DQ +     SYA      E+G   P + +RF+DSFK AE+     KH         S
Sbjct: 26  KSVDQINEKSVESYASNA---EVGATNPTMFRRFVDSFKPAED----NKH---------S 69

Query: 106 PLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGL 165
            + + ++ +  A  S   D HL+K+++ RHV+M +L           N   LH  GPA L
Sbjct: 70  EVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAAL 129

Query: 166 VIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVM 225
           VIGY ++    Y +IQA GEMAV+Y  LPGNFN Y +  V + FGFA  W++CIQWL V+
Sbjct: 130 VIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVL 189

Query: 226 PLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGF 285
           PLEL+TAS+ I YWT KVN D                G K Y E +F FN CK+LMI GF
Sbjct: 190 PLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGF 249

Query: 286 FILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAI 345
            I             GYIG KYWH PGAF G  + +RFK V           G +E   +
Sbjct: 250 IIFSIVVNCGGAGHDGYIGGKYWHSPGAFAGTNAAERFKGVCYVLVSGYFSYGGTELYVL 309

Query: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVL 405
             +EQ NPR++ P AAK  IYRIL I+L ++ L+GF VP++  +LMG+G   T ASPYVL
Sbjct: 310 SVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVL 369

Query: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465
           A S HGVRVVPH INAVIL+AV+SV+NS+ Y++ R+L SL++QGYAP++  Y+DREGRP 
Sbjct: 370 AASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPL 429

Query: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525
            A++   +FG+IAF ACS +EE+VFTWL AI+GLS++FTW +I LSH+RFR+AM +QGR 
Sbjct: 430 YALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRD 489

Query: 526 ISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585
           ++E+G+ +  G WGSVY      L  IA+FWV++AP  +  + A+SFFE+YLA PI I F
Sbjct: 490 LNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAP-PKSPITAQSFFESYLAFPIWIAF 548

Query: 586 YFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           YFGY I+N+D+        IDL  HR I+D              ++NG  W +L  FWC
Sbjct: 549 YFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLKWFWC 607

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/625 (45%), Positives = 374/625 (59%), Gaps = 31/625 (4%)

Query: 23  KDASK--LRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFI 80
           KD S   +  RSF+D  N            Q SSNE +    + K   L      + RF 
Sbjct: 13  KDPSPDFISTRSFSDENNF-----------QLSSNEKIYSEQKPKRNRL------IHRFT 55

Query: 81  DSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSS 140
           DSFKRAE  T + K           P++    + +  I S   D+ L+KS++ RHV+M S
Sbjct: 56  DSFKRAEGSTTKIK-----------PINENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMS 104

Query: 141 LAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAY 200
           L           N   LH  GPA LVIGY ++    Y +IQA GEMAV+Y  LP NFNAY
Sbjct: 105 LGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAY 164

Query: 201 PTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXX 260
            +  + + FGFA  W+YC QW  V+PLEL+TASMTI +W  K+N D              
Sbjct: 165 SSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVH 224

Query: 261 XXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSI 320
             G K Y E +F FN CK+LMI GF +L            GYIG  YWH PGAF GD SI
Sbjct: 225 FFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAFAGDTSI 284

Query: 321 DRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVG 380
            RFK+V           G  E   +   EQ+NPR++ P AAK  IYRI+ I+L ++ L+G
Sbjct: 285 ARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIG 344

Query: 381 FLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCR 440
           F VPY+  +L+G+G   T ASPYVLA S HGVR+VPH INAVIL++V+SV+NS+ Y+  R
Sbjct: 345 FNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPR 404

Query: 441 ILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLS 500
           ++ SL+QQGYAP++ +Y+DREGRP RA+I+  + G+IAF A SSKEE VFTWL AI+GLS
Sbjct: 405 LICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLS 464

Query: 501 QIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIA 560
           ++FTW +I LSH+RFR+AM VQGRS++ELG+++  G+WGS+Y +    L  IA+FWV++A
Sbjct: 465 ELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALA 524

Query: 561 PIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXX 619
           P+G     +A++FFE+YLA PI ++FY GY IYNRD+ L      IDL  HR ++D    
Sbjct: 525 PLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELM 584

Query: 620 XXXXXXXXXXLKNGPTWKRLVHFWC 644
                     +KN     +  HFWC
Sbjct: 585 RQEDEENKEKIKNMSFLSKAHHFWC 609

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/571 (47%), Positives = 358/571 (62%), Gaps = 20/571 (3%)

Query: 75  HLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPR 134
           H  RF+DSFKRAE       H               I   D    S + D +L+K+++ R
Sbjct: 44  HFNRFVDSFKRAE-----VNH-------------NGIDLED-GTNSIQSDDNLKKAMKSR 84

Query: 135 HVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLP 194
           HV+M SL           N   L+ AGPA LVIGY ++    Y +IQA GEMAV+Y  LP
Sbjct: 85  HVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLP 144

Query: 195 GNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXX 254
           G FN Y +  V + FGFA  W++CIQWL V+PLEL+TASMTI YW  K+N D        
Sbjct: 145 GGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADVFVVILYV 204

Query: 255 XXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF 314
                   G + Y EA+F FN+CK+LMI GF IL            GYIG KYW DPGAF
Sbjct: 205 FLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF 264

Query: 315 RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLS 374
             D +  RFK V           G  E  A+  +EQ NPRR+ P+AAK  IYRIL I+L 
Sbjct: 265 ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLL 324

Query: 375 SIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSA 434
           ++ L+GF VP++S +LMG+G   T ASPYVLA+S HGV+VVPH INAVIL++V SV+NSA
Sbjct: 325 TMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSA 384

Query: 435 FYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLL 494
            Y+S R+L SL++QGYAP++FNY+DREGRP RA+I+  +FG+IAFCACS +EE +FTWL 
Sbjct: 385 LYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLA 444

Query: 495 AISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAE 554
           AI+GLS++FTW +I LSH+RFR AM  QG+S++ELG+ S  G+WGS+Y      L  IA+
Sbjct: 445 AIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQ 504

Query: 555 FWVSIAPIGEDHL-DAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNI 613
           FWV+++P G   +  A++FFE+YLA P+ + FY GY +Y+RD+      K IDL  HR +
Sbjct: 505 FWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRL 564

Query: 614 FDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +D              ++NG   ++L++FWC
Sbjct: 565 YDPELLRQEDEETKERIRNGGWTQKLLNFWC 595

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/537 (49%), Positives = 351/537 (65%), Gaps = 11/537 (2%)

Query: 112 KEHDVAITSKEE---DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIG 168
           K+ D  +   EE    + ++K+I+ RH+LM SL           NG+AL KAGP GL+IG
Sbjct: 46  KQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIG 105

Query: 169 YAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLE 228
           Y +    LYCIIQA GE+ + YS + GN+ AY + LVD   GF+V+WVYCIQW+ V PL+
Sbjct: 106 YGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQ 165

Query: 229 LVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
           LVTA++TI YWT   N D                GAKGYAEA+F FNTCKVLM+ GF IL
Sbjct: 166 LVTAAITIKYWT-DTNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVIL 224

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGAS 348
                       GYIGA+YWH PGAF        FK V           G  E + + AS
Sbjct: 225 GIIINCGGAGNDGYIGARYWHTPGAFS-----TGFKGVCYVFCYAAFAYGGIEVMVLTAS 279

Query: 349 EQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAIS 408
           EQ NPR++IPSA K +IYRIL I++ +  +V FLVPYD+ EL  +GS  ++ASP+V+AI+
Sbjct: 280 EQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSA-SRASPFVIAIA 338

Query: 409 SHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468
           SHG+ VVPH INAVIL+AV+SV NS+ YS+ R+L SLS+QGYAP+ FNY+DR+GRP    
Sbjct: 339 SHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCF 398

Query: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528
           ++++  G++AF A S  EE+VF+WLLAISGLSQ+F W++ICLSH+RFR AM  QGRS+ E
Sbjct: 399 LVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGE 458

Query: 529 LGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYF 587
           +G++SQ G WGS +A  +    L+A+FWV+IAPIG    L AK FF++YLA P+LI  YF
Sbjct: 459 VGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYF 518

Query: 588 GYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           GYKIY +DW+L I A  +DL +HR IFD              ++    W ++ HFWC
Sbjct: 519 GYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/574 (46%), Positives = 360/574 (62%), Gaps = 19/574 (3%)

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSI 131
           +  H  +F+DSF+RAE+     KH             + +++   +ITS  +D H++K++
Sbjct: 41  RRTHFTKFVDSFRRAED-----KHA-----------DSDLEDGSKSITS--DDDHMKKAM 82

Query: 132 QPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYS 191
           + RHV+M +L           NG  L  AGPA LV+GY ++    Y +IQA GEMAV+Y 
Sbjct: 83  KSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYP 142

Query: 192 NLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXX 251
            +P +FN Y +  V + FGFA  W++CIQWL V+PLEL+TASMTI YW   +N D     
Sbjct: 143 TMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVI 202

Query: 252 XXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDP 311
                      G K Y E +F FN+CK+LMI GF IL            GYIG KYW +P
Sbjct: 203 FYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINP 262

Query: 312 GAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFI 371
           GAF  +    RFK V           G +E  ++  +EQ NPR++ P+AAK  IYRIL I
Sbjct: 263 GAFASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILII 322

Query: 372 FLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVS 431
           +L ++ L+GF VP+DS +LMG+G   T ASPYVLA S HGV+VVPHFINAVIL++V+SV+
Sbjct: 323 YLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVA 382

Query: 432 NSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFT 491
           NSA Y+S R++ SL++QGYAP+WFNY+DREGRP RA+ I  LFG+I F ACS +EE+ FT
Sbjct: 383 NSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFT 442

Query: 492 WLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLAL 551
           WL AI+GLS++FTW +I +SHIRFR AM VQG+S+ ELG+R+  G+WGSVY+     L  
Sbjct: 443 WLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVF 502

Query: 552 IAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITH 610
           IA+FWV+++P   +   DA+ FFE+YLA P+ +VFYFGY IY+RD+        IDL  H
Sbjct: 503 IAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFH 562

Query: 611 RNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           R I+D              L+N     RL  FWC
Sbjct: 563 RRIYDPELLRQEDAETKERLRNSGWLARLRSFWC 596

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/623 (45%), Positives = 383/623 (61%), Gaps = 28/623 (4%)

Query: 28  LRRRSFNDLENENIVEYFGKSTD----QSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSF 83
           + ++S  +L NE +      S++    +S S+ DLS   R      G     L  F +SF
Sbjct: 1   MSKKSLENLSNEKLPATECGSSNSNLRESISSNDLSDGDR------GFVNRKLHNFCNSF 54

Query: 84  KRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAX 143
           KRA   T                  A+      +I S   ++  ++S++ RHV+M SL  
Sbjct: 55  KRANSDT----------------FDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGT 98

Query: 144 XXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTF 203
                    NG +LH  GPAGL+IGY+++    Y ++QA GEMAV+Y  LPGNFN Y + 
Sbjct: 99  GIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSI 158

Query: 204 LVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXG 263
            + + FGFA  W+YC+QWL V+PLEL+TAS+TI YW + +N D                G
Sbjct: 159 FISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFG 218

Query: 264 AKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRF 323
           A GY EA+F F+TCKV MI GF IL          T GYIG +YW +PGAF G   I  F
Sbjct: 219 AAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSPIGHF 278

Query: 324 KDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLV 383
           K +           G  E  A+  +EQ+NPR+A+PSA K  IYRIL I++ ++ L+GFLV
Sbjct: 279 KGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLV 338

Query: 384 PYDSSELMGS-GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRIL 442
           PY+S ELMGS G   T ASPYV+A++SHGV+VVPH INAVIL++V+SV NSA YS+ R+L
Sbjct: 339 PYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLL 398

Query: 443 FSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQI 502
            SL++QGYAP+ F+Y+DR GRP  A++   +FG+++F A S KEE+VFTWL AI+GLS++
Sbjct: 399 NSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSEL 458

Query: 503 FTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPI 562
           FTW AICLSH+RFR AM  QG S+SELG++S+ G WGS+YA     +  +A+FWV++API
Sbjct: 459 FTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPI 518

Query: 563 GE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXX 621
           G     DA++FF++YLA PI I  Y GYKIY+++WKL +    IDL +HR+IFD      
Sbjct: 519 GNGGKADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQ 578

Query: 622 XXXXXXXXLKNGPTWKRLVHFWC 644
                   LKN   W ++ +FWC
Sbjct: 579 EDDEHKEKLKNSGWWVKMANFWC 601

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/611 (44%), Positives = 367/611 (60%), Gaps = 25/611 (4%)

Query: 39  ENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPH----LKRFIDSFKRAEEGTEETK 94
            N+++   + T   SS E L        + L   E      + RF+DSFKRA++ TE   
Sbjct: 3   RNVIQPNKEKTVDYSSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTENDL 62

Query: 95  HMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNG 154
                      PL  A              +HL+K+++ RHV+M  +           N 
Sbjct: 63  E------DGTKPLGDA--------------SHLKKAMKSRHVIMMCVGTGIGTGLLVANA 102

Query: 155 SALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVA 214
           S L   GP  LVIGY ++    Y +IQA GEMAV+Y  LPGNFN+Y +  + + FGFA  
Sbjct: 103 SGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATV 162

Query: 215 WVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFF 274
           W++ IQWL V PLEL+TAS+TI YW  K+N D                G K Y EA+F F
Sbjct: 163 WLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIF 222

Query: 275 NTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXX 334
           N+CKVLMI GF IL            GYIGAKYW DPG+F    S+++FK +        
Sbjct: 223 NSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAY 282

Query: 335 XXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG 394
              G +E  ++  +EQ NPR++ P AAK  IYRIL I+L ++ L+GF VP+++ +LMGSG
Sbjct: 283 FSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSG 342

Query: 395 SGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQW 454
              T ASPYVLA S HGV+VVPHFINAVIL++V+SV+NSA Y+S R++ SL++QGYAP++
Sbjct: 343 GSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKF 402

Query: 455 FNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIR 514
            +Y+DREGRP RA+I+  +FG+I F + SSKEEEVFTWL AI+GLS++FTW  I LSH+R
Sbjct: 403 LDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVR 462

Query: 515 FRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIG-EDHLDAKSFF 573
           FR+ M + GRS  E+GFR+  G+WGS+Y  +   L  IA+FWV++AP      +DA+SFF
Sbjct: 463 FRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFF 522

Query: 574 ENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNG 633
           ++YLA PI + FYFGY +Y RD+   +    IDL  HR I+D              +KN 
Sbjct: 523 QSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNS 582

Query: 634 PTWKRLVHFWC 644
             W R+ HFWC
Sbjct: 583 SVWVRMFHFWC 593

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/576 (46%), Positives = 360/576 (62%), Gaps = 23/576 (3%)

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKE--EDAHLRK 129
           K   + RF+DSF+RAE                    S  ++E+D+   ++      HL+K
Sbjct: 16  KSNLVHRFVDSFRRAE--------------------SPELEENDLEDGTRSIVTKTHLKK 55

Query: 130 SIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVS 189
           +++ RHV+M S+           N   L+ +GPA L+IGY ++    Y +IQA GEMAV+
Sbjct: 56  AMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVA 115

Query: 190 YSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXX 249
           Y  LPG+FN+Y +  + + FGFA  W++ IQWL V PLEL+TAS+T+ YW  K+N D   
Sbjct: 116 YPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFI 175

Query: 250 XXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWH 309
                        G K Y E +F FN+CKVLM+ GF IL          T GYIGAKYWH
Sbjct: 176 IIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWH 235

Query: 310 DPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRIL 369
           DPG+F     I RFK V           G +E  ++  +EQ NPR++ P+AAK  IYRIL
Sbjct: 236 DPGSFADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRIL 295

Query: 370 FIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLS 429
            I+L+++ L+GF VP++S ELMG+GS  T ASPYVLA S H V+VVPHFINAVIL++V+S
Sbjct: 296 IIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVIS 355

Query: 430 VSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEV 489
           V+NSA Y++ R++ SL++QGYAP++ NY+DREGRP R +I+  LFG+I F + SSKEEEV
Sbjct: 356 VANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEV 415

Query: 490 FTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFL 549
           FTWL AI+GLS++FTW  I LSHIRFR+AM   G+S  E+GF++  G+WGS Y      L
Sbjct: 416 FTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNIL 475

Query: 550 ALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLI 608
             IA+FWV+++P G     DA++FF++YLA PI +VFYFGY IY RD+ +    + IDL 
Sbjct: 476 VFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLD 535

Query: 609 THRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            HR I+D              LKN   W R+ H+WC
Sbjct: 536 FHRRIYDPDFIKQEDEENKERLKNSSIWARIYHWWC 571

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/607 (44%), Positives = 368/607 (60%), Gaps = 25/607 (4%)

Query: 46  GKSTD------QSSSNEDLSYAGRKKWYELGVKE--PHLKRFIDSFKRAEEGTEETKHMX 97
           GKS++      + SS+   +    K  YE   ++    + RF++SFKRAE+   +     
Sbjct: 3   GKSSNDEFVLTEVSSSPKTTPQHSKSSYEPASRQDSTMIHRFVNSFKRAEQPPLKQD--- 59

Query: 98  XXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSAL 157
                     S   ++ D  +T    D  L+K+++ RHV+M SL           N   L
Sbjct: 60  ----------SDLEEDTDTIVT----DTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGL 105

Query: 158 HKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVY 217
           HKAGPA LVI Y ++    Y +IQA GEMAV Y  LPGNFNAY +  + + FGFA  W++
Sbjct: 106 HKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLF 165

Query: 218 CIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTC 277
            IQWL V+PLEL+TA+MT+ YW   +N D                G K Y E +F FN C
Sbjct: 166 FIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLC 225

Query: 278 KVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXX 337
           K+L + GF I            SGYIGAKYWHDPGAF  D +  RFK V           
Sbjct: 226 KILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNAGRFKGVCYVLVTAYFSY 285

Query: 338 GASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGG 397
           G  E  A+  +EQ NPRR+ P+AAK  IYRI+ I+L ++ LVGF VP +S+ELMGSG   
Sbjct: 286 GGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSV 345

Query: 398 TKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNY 457
           T ASPYVLA S HGV+VVPH +NAVIL++++SV NSA Y++ R++ +L+QQG+AP++ +Y
Sbjct: 346 THASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDY 405

Query: 458 IDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRR 517
           +DREGRP  A+I+  +FG+I F ACSSKEE+VF WL AI+GL+++FTW  I +SHIRFR+
Sbjct: 406 VDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQ 465

Query: 518 AMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYL 577
           AM +Q +S+ E+G++S  GV+GS +      L  +A+FWV++AP     + A +FFE+YL
Sbjct: 466 AMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYL 525

Query: 578 AMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWK 637
           A PI   FYFGY I+ RD+ LF   +++DL  HR I+D              LKN P WK
Sbjct: 526 AFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKKEMLKNSPMWK 585

Query: 638 RLVHFWC 644
           R+ +FWC
Sbjct: 586 RMYYFWC 592

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/595 (46%), Positives = 359/595 (60%), Gaps = 18/595 (3%)

Query: 51  QSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAA 110
           QSSS+E  +Y+G+            + RF+DSFKRAE  T  TK +           + +
Sbjct: 32  QSSSSEK-NYSGQTT-----RNNKLIHRFVDSFKRAEGSTTHTKQINE---------NTS 76

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
             E DV   S   D+ L+KS++ RHV+M +L           N   LH  GPA LVIGY 
Sbjct: 77  DLEGDV--NSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYF 134

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
           ++    Y +IQA GEMAV+Y  LP NFNAY +  + + FGFA  WVYC QWL V+PLEL+
Sbjct: 135 LVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELI 194

Query: 231 TASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
           TA+MTI +W   +N D                G KGY E +F FN CK+LMI GF IL  
Sbjct: 195 TAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSV 254

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                     GYIG KYW +PGAF GD S  RFK+V           G  E  A+   EQ
Sbjct: 255 VINCGGAGNDGYIGGKYWRNPGAFAGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQ 314

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
           +NPR+  P AAK  IYRIL I+L ++ L+GF VPY+  +LMG+G   T ASPYVLA S H
Sbjct: 315 ANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIH 374

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           GV+VVPH INAVIL++V+SV+NS+ Y+  R++ SL+QQGY P++ +Y+DREGRP  A+I+
Sbjct: 375 GVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIV 434

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
             +FG+I F A SSKEE VF WL AI+GLS++FTW +I LSH+RFR+AM VQGRS+ ELG
Sbjct: 435 CSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELG 494

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGY 589
           +++  G+WGS Y      L  IA+FWV++AP+       A+SFF++YLA PI I FY GY
Sbjct: 495 YKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGY 554

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            IYNRD+        IDL  HR+I+D               ++    ++  HFWC
Sbjct: 555 MIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKRDMSLMRKTYHFWC 609

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/609 (44%), Positives = 364/609 (59%), Gaps = 14/609 (2%)

Query: 43  EYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXX 102
           +Y G S D S  + D +    +   +L      + RF+DSFKRA++     +        
Sbjct: 33  KYAGNSNDYSQRDSDNTSIESEPRTKL------VHRFVDSFKRAQD-VPTGRKSKEIGNN 85

Query: 103 XXSPLSAAIKEHDVAITSKEEDA-----HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSAL 157
             S      +E  + +   + D+     HL+K+++ RHV+M SL           N   L
Sbjct: 86  GGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGL 145

Query: 158 HKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVY 217
           H  GPA LVIGY ++    Y +IQA GEMAV+Y  LPGNFNAY +  V   FGFA  W++
Sbjct: 146 HFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIF 205

Query: 218 CIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAK-GYAEADFFFNT 276
           CIQWL V+PLEL+TAS+TI YW  K+N D                G    Y E +F FN 
Sbjct: 206 CIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNL 265

Query: 277 CKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXX 336
           CK+LM+ GF I+             YIG K+WHDPGAF G  +  RFK +          
Sbjct: 266 CKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFS 325

Query: 337 XGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSG 396
            G +E  A+  +EQSNPRR+ P A+K  +YRIL I+L ++ L+GF VPYDS ELMGSG  
Sbjct: 326 YGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGS 385

Query: 397 GTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFN 456
            T ASPYVLA S +GV++ PHFINAVIL++V+SV+NS+ Y++ R++ SL+QQGYAP++ +
Sbjct: 386 ATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLD 445

Query: 457 YIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFR 516
           Y+DR+GRP  A+I  +L G+I F A S KEEEVFTWL AI+GLS++FTW +I LSH+RFR
Sbjct: 446 YVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFR 505

Query: 517 RAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFEN 575
            AM +Q RS+ ELG+++  G++GS+Y      L   A+FW ++ P G D   +A SFF N
Sbjct: 506 MAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFAN 565

Query: 576 YLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPT 635
           YLAMPI +VFYFGY ++ RD++L      IDL  HR I+D              L+NG  
Sbjct: 566 YLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRNGSF 625

Query: 636 WKRLVHFWC 644
             R+ HFWC
Sbjct: 626 MMRMYHFWC 634

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/572 (46%), Positives = 363/572 (63%), Gaps = 37/572 (6%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEED---AHLRKSIQ 132
           ++ FIDSF+R                          ++ D+   +  ED   A ++K+I+
Sbjct: 36  MRGFIDSFRRG-------------------------RDVDLMCKADAEDGTTAKMKKTIK 70

Query: 133 PRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSN 192
            RH+LM +L           NGSAL KAGPAGL++GY +    LY I++A GE+ + YS 
Sbjct: 71  TRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSG 130

Query: 193 LPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXX 252
           + GN+ AY + LVD   GF+V+WVYCIQW+ V PL+LVTA+M I YWT  +N D      
Sbjct: 131 MTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWT-DINPDIFVAII 189

Query: 253 XXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPG 312
                     GAKGYAEA+FFFN CKVLMI GF IL          TSGYIG KYWH+P 
Sbjct: 190 YAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPR 249

Query: 313 AFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIF 372
            F     ++ FK +           G  E + + ASEQ NPR++I SA K +IYRI+ I+
Sbjct: 250 PF-----MNGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIY 304

Query: 373 LSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSN 432
           L +  +V FLVP D   L    S G++ASP V+A+S HGV++VPH INAVIL+AV+SV N
Sbjct: 305 LLTTVIVCFLVPADHPSL---ASEGSRASPLVIAVSFHGVKIVPHIINAVILIAVVSVGN 361

Query: 433 SAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTW 492
           S+ YS+ R+L SL++QGYAP+ F YIDR+GRP  A  ++++FG++AF A S  +++VF W
Sbjct: 362 SSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGW 421

Query: 493 LLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALI 552
           LLAISGLSQ+F WM+IC+SHIRFR AM  QGRS+ E+G++++ G WGS  A    FL LI
Sbjct: 422 LLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILI 481

Query: 553 AEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRN 612
           A+FWV+I+P+    +DA+SFF++YLA PIL++ YFGYKIY++DW++ I A  +DLI+HR 
Sbjct: 482 AQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQ 541

Query: 613 IFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +FD              LK+ P W R+ HFWC
Sbjct: 542 VFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/571 (45%), Positives = 353/571 (61%), Gaps = 21/571 (3%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKE--EDAHLRKSIQP 133
           + RF+DSFKRA+                     A   ++D+   ++    ++HL+KS++ 
Sbjct: 66  VHRFMDSFKRADGQ------------------RAGFDDNDLESGTRSFISESHLKKSMKS 107

Query: 134 RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNL 193
           RHV+M +L           N S LH +GPA LV+ Y ++    Y +IQA GEMAV+Y  L
Sbjct: 108 RHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTL 167

Query: 194 PGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXX 253
           PGNFN+Y +  V + FGFA  W++ +QWL V+PLEL+T+S+TI YW  K+N+D       
Sbjct: 168 PGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDKINSDVFVVIFY 227

Query: 254 XXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGA 313
                    G + Y E +F FN+CK+LMI GF I             GYIG KYWHDPGA
Sbjct: 228 VFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGA 287

Query: 314 FRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFL 373
           F    +I RFK +           G +E   +  +EQ NPR++ P AAK  IYRI+ I+L
Sbjct: 288 FTSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYL 347

Query: 374 SSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNS 433
            ++ L+GF VP+D+ +LMGS    T ASPYVLA S HGVR+VPHFINAVIL++V+SV+NS
Sbjct: 348 LTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVPHFINAVILISVISVANS 407

Query: 434 AFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWL 493
           + Y+S R+L SL+QQGYAP++  YIDR+GRP  A+    LFG+I F A S++EE+VFTWL
Sbjct: 408 SLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWL 467

Query: 494 LAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIA 553
            AI+GLS++FTW  I LSH+RFR+AM VQGR ++ELG+++  GVWGSVY      L   A
Sbjct: 468 AAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFA 527

Query: 554 EFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNI 613
           +FWV++AP G     A SFFE+YLA PI   FYFGY ++N+D+   I  ++IDL  HR +
Sbjct: 528 QFWVALAPPGSKP-TALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRV 586

Query: 614 FDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +D              LKN   W R+ +FWC
Sbjct: 587 YDPEFIRQEREEKKIKLKNSSIWTRMYYFWC 617

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/621 (42%), Positives = 366/621 (58%), Gaps = 25/621 (4%)

Query: 25  ASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFK 84
           +SK+ + +  ++ +  + + F  ST  S S E   ++   +          + RF+DSF+
Sbjct: 8   SSKMEKTAEFEVTDSALRDNFNTSTAASFSPEVKEHSEESR-------SGLVHRFVDSFR 60

Query: 85  RAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXX 144
           RAE    E  +                 + +    S   + HL+KS++ RHV+M SL   
Sbjct: 61  RAESQRLEDDN-----------------DLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTG 103

Query: 145 XXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFL 204
                   N   L  AGP  LVIGY ++    Y ++QA GEM V+Y  LPGNFNAY +  
Sbjct: 104 IGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIF 163

Query: 205 VDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGA 264
           V + FGFA  W++CIQWL V+PLEL+T+SMTI YW   +N D                G 
Sbjct: 164 VSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGV 223

Query: 265 KGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFK 324
           K Y E +F FN+CK+LMI GF IL            GYIG +YW +PG+F    S  RFK
Sbjct: 224 KAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSATRFK 283

Query: 325 DVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVP 384
            +           G  E   +  +EQ+NPR++ P AAK  IYRIL I+L ++ L+GF VP
Sbjct: 284 GICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVP 343

Query: 385 YDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFS 444
           +D+ +LMGSGS  T ASPYVLA S HGV+V+PH INAVIL++V+SV+NSA Y++ R++ S
Sbjct: 344 HDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCS 403

Query: 445 LSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFT 504
           L+QQGYAP++ NYIDREGRP RA+++    G++ F ACSS+EE+ FTWL AI+GLS+IFT
Sbjct: 404 LAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFT 463

Query: 505 WMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE 564
           W  I LSHIRFR+AM VQGRS+ E+G++S  G+WGS Y      L  +A+FWV+++P G 
Sbjct: 464 WSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGS 523

Query: 565 D-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXX 623
           D   D +SFF++YLA P+ I  Y GY IYN+D+ L      IDL  HR ++D        
Sbjct: 524 DGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQED 583

Query: 624 XXXXXXLKNGPTWKRLVHFWC 644
                 L+N   + R+ + WC
Sbjct: 584 EENKERLRNSSVFFRMYNMWC 604

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  527 bits (1357), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 265/594 (44%), Positives = 359/594 (60%), Gaps = 27/594 (4%)

Query: 52  SSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAI 111
           SS N  LS+     +Y         + FIDSFKRAE G    K             SA +
Sbjct: 40  SSQNRSLSHRKNTSYY---------RNFIDSFKRAEHGNLNEK-------------SADL 77

Query: 112 KEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           ++   +I SK   ++++KS++ RHV+M SL           N  +L   GPA L+IGY I
Sbjct: 78  EDGTASIQSK---SYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVI 134

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
           +   +Y +IQA GEMAV+Y  LPGNFN Y +  + + +GFA  W++CIQW+ V+PLEL+T
Sbjct: 135 VSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELIT 194

Query: 232 ASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXX 291
           +S+TI YWT  +N D                G K Y E +F FN CK+LMI+GF I    
Sbjct: 195 SSLTIQYWT-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIV 253

Query: 292 XXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS 351
                    GYIG KYWH PG+F       RFK +           G +E   +  +EQ+
Sbjct: 254 VNCGGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQA 313

Query: 352 NPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHG 411
            PR+A P+AAK  IYRIL I+L ++ L+GF VP++S +LMG+G   T ASPYVLA S HG
Sbjct: 314 EPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHG 373

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           V+VVPH INAVIL++V+SV+NS+ Y+S R+L SL++QGYAP+   YIDREGRP  A+++ 
Sbjct: 374 VKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLC 433

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
            +FG IAF A S KEE+VFTWL AI+GLS++FTW  I  SH+RFR AM VQ + I E+G+
Sbjct: 434 AVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGY 493

Query: 532 RSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYK 590
           ++  G++GS + +    L LIA+FWV+++P G    + A+SFFENYLAMPI + FY  Y 
Sbjct: 494 KATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYS 553

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +YN++W +      IDL  HR I+D              LKN P W R+ +FWC
Sbjct: 554 VYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYNFWC 607

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  526 bits (1355), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 262/621 (42%), Positives = 363/621 (58%), Gaps = 25/621 (4%)

Query: 25  ASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFK 84
           +SK+ + +  ++ +  +   F  ST  S S E   ++   +          + RF+DSF+
Sbjct: 8   SSKMEKNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESR-------NGLVHRFVDSFR 60

Query: 85  RAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXX 144
           RAE    E  +                 + +      + + HL+KS++ RHV+M SL   
Sbjct: 61  RAESQCLEENN-----------------DLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTG 103

Query: 145 XXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFL 204
                   N   L  AGP  LVIGY ++    Y ++QA GEM V+Y+ LPGNFNAY +  
Sbjct: 104 IGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIF 163

Query: 205 VDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGA 264
           + + FGFA  W++CIQWL V+PLEL+T+SMTI YW   +N D                G 
Sbjct: 164 ISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGV 223

Query: 265 KGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFK 324
           K Y E +F FN+CK+LM+ GF IL            GYIG KYW DPG+F    +  RFK
Sbjct: 224 KAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGSNATRFK 283

Query: 325 DVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVP 384
            +           G  E   +  +EQSN R++ P AAK  +YRIL I+L ++ L+GF VP
Sbjct: 284 GICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVP 343

Query: 385 YDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFS 444
           +++ +LMGSGS  T ASPYVLA S H VRV+PH INAVIL++V+SV+NSA Y++ R++ S
Sbjct: 344 HNNDQLMGSGSAATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCS 403

Query: 445 LSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFT 504
           L+QQGYAP++ NYIDREGRP RA+ +  L G++ F ACS +EE+ FTWL AI+GLS+IFT
Sbjct: 404 LAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFT 463

Query: 505 WMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE 564
           W  I LSHIRFR+AM VQGRS+ ELG+++  G+WGS Y      L  +A+FWV+++PIG 
Sbjct: 464 WSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGN 523

Query: 565 -DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXX 623
               D ++FFE YLA P+ I  Y GY +YN+D+ L      IDL  HR ++D        
Sbjct: 524 GGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQED 583

Query: 624 XXXXXXLKNGPTWKRLVHFWC 644
                 L+N   + R+ +FWC
Sbjct: 584 EENKEKLRNSSIFFRMYNFWC 604

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  525 bits (1352), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 260/621 (41%), Positives = 362/621 (58%), Gaps = 25/621 (4%)

Query: 25  ASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFK 84
           +SK+ + +  ++ +  +   F  ST  S + E   ++   +          + RF+DSF+
Sbjct: 8   SSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESR-------NGLVHRFVDSFR 60

Query: 85  RAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXX 144
           RAE    E  +                 + +    S + + HL+KS++ RHV+M SL   
Sbjct: 61  RAESQRLEEDN-----------------DLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTG 103

Query: 145 XXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFL 204
                   N   L  AGP  LVIGY ++    Y ++QA GEM V+Y  LPGNFNAY +  
Sbjct: 104 IGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIF 163

Query: 205 VDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGA 264
           + + FGFA  W++CIQWL V+PLEL+T+SMT+ YW   +N D                G 
Sbjct: 164 ISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGV 223

Query: 265 KGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFK 324
           K Y E +F FN+CK+LM+ GF IL            GYIG KYW DPG+F       RFK
Sbjct: 224 KAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFK 283

Query: 325 DVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVP 384
            +           G  E   +  +EQSNPR++ P AAK  +YRIL I+L ++ L+GF VP
Sbjct: 284 GICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVP 343

Query: 385 YDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFS 444
           +++ +LMGSG   T ASPYVLA S H VRV+PH INAVIL++V+SV+NSA Y++ R++ S
Sbjct: 344 HNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCS 403

Query: 445 LSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFT 504
           L+QQGYAP++ NYIDREGRP RA+++  L G++ F ACS +EE+ FTWL AI+GLS++FT
Sbjct: 404 LAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFT 463

Query: 505 WMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE 564
           W  I LSHIRFR+AM VQGRS+ E+G+++  G+WGS Y      L  +A+FWV+++PIG 
Sbjct: 464 WSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGN 523

Query: 565 -DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXX 623
               DA++FFE+YLA P+ I  Y GY +Y RD+        IDL  HR ++D        
Sbjct: 524 GGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQED 583

Query: 624 XXXXXXLKNGPTWKRLVHFWC 644
                 LKN   + R+  FWC
Sbjct: 584 EENKERLKNSSIFVRVYKFWC 604

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  523 bits (1347), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 262/594 (44%), Positives = 358/594 (60%), Gaps = 23/594 (3%)

Query: 53  SSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIK 112
           S+N   S AG  K         + + FIDS+KRA+                    +A  +
Sbjct: 24  SANSYNSSAGNSK------TRGYFRNFIDSYKRADPSQLH---------------NARSE 62

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           + +  I S   D   +KS+  RHV+M SL           N   L+  GP  L+IGY ++
Sbjct: 63  DVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLV 122

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
               Y +IQA GEMAV+Y  LPGNFNAY +  + + +GFA  W++CIQWL V+PLEL+T+
Sbjct: 123 SFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITS 182

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGA-KGYAEADFFFNTCKVLMITGFFILXXX 291
           S+TI YW  K+N D                G  + Y E +F FN+CK+LM+ GF IL   
Sbjct: 183 SLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIV 242

Query: 292 XXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS 351
                    GYIG KYWH+PG+F    +  RFK +           G +E   +  +EQ+
Sbjct: 243 INAGGAGNDGYIGGKYWHEPGSFAEGDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQA 302

Query: 352 NPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHG 411
            PR+A P+AAK  IYRIL I+L ++ L+GF VP+++ +LMG+G   T ASPYVLA + HG
Sbjct: 303 EPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAATIHG 362

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           V++VPHFINAVIL++V+SV+NS+ ++  R+L SL+ QGYAP+  +Y+DREGRP  A+ IS
Sbjct: 363 VKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGIS 422

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
            L G+IAF +C+S EEEVFTWL AI+GLS+IFTW  I  SH+RFR AM VQG+ I+ELG+
Sbjct: 423 FLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGY 482

Query: 532 RSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYK 590
           ++  GVWGS Y A    L LIA+FWV++APIG     DA++FFE+YLA PI +  YFGY 
Sbjct: 483 KANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYM 542

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           IYN+D+ L      IDL ++R I+D              LK+ P + ++  FWC
Sbjct: 543 IYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSRPLYYKIYRFWC 596

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  523 bits (1346), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 263/621 (42%), Positives = 363/621 (58%), Gaps = 25/621 (4%)

Query: 25  ASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFK 84
           +SK  + +  ++ +  +   F  ST  S S E   ++   +          + RF+DSFK
Sbjct: 8   SSKTEKNAEFEVTDSALYNNFNTSTTASLSQEVKEHSEESR-------NGLVHRFVDSFK 60

Query: 85  RAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXX 144
           RAE    E  +                 + +    S + +  L+KS++ RHV+M SL   
Sbjct: 61  RAESQHLEDDN-----------------DLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTG 103

Query: 145 XXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFL 204
                   N   L  AGP  LVIGY ++    Y ++QA GEM V+Y  LPGNFNAY +  
Sbjct: 104 IGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIF 163

Query: 205 VDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGA 264
           + + FGFA  W++CIQWL V+PLEL+T+SMTI YW  K+N+D                G 
Sbjct: 164 ISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGV 223

Query: 265 KGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFK 324
           K Y E +F F++CK+LMI GF IL            GYIG KYW DPG+F       RFK
Sbjct: 224 KAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGNGATRFK 283

Query: 325 DVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVP 384
            +           G  E   +  +EQSNPR++ P AAK  +YRIL I+L ++ L+GF VP
Sbjct: 284 GICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVP 343

Query: 385 YDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFS 444
           +++ +LMGSGS  T ASPYVLA S H VRVVPH INAVIL++V+SV+NSA Y++ R++ S
Sbjct: 344 HNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCS 403

Query: 445 LSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFT 504
           L+QQGYAP++ +YIDREGRP RA+ +  L G+I F ACS +EE+ FTWL AI+GLS++FT
Sbjct: 404 LAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFT 463

Query: 505 WMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE 564
           W  I LSHIRFR+AM VQGRS+ E+G+++  G+WGS Y      L  +A+FWV+++PIG 
Sbjct: 464 WSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGN 523

Query: 565 -DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXX 623
               +A++FFE+YLA P+ +  Y GY +Y RD+        IDL  HR ++D        
Sbjct: 524 GGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQEN 583

Query: 624 XXXXXXLKNGPTWKRLVHFWC 644
                 LKN   + R+ +FWC
Sbjct: 584 EENKERLKNSSFFFRIYNFWC 604

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  518 bits (1334), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 271/569 (47%), Positives = 355/569 (62%), Gaps = 18/569 (3%)

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVL 137
           RF++SFKRAE+ +  +             L  A   H VA +S      L++SI+PRHV 
Sbjct: 50  RFVNSFKRAEKHSTPSN----------GDLEHA-TTHSVASSSP-----LKRSIKPRHVA 93

Query: 138 MSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNF 197
           M S+           NG +L   GPAGL+IGYA +    Y ++QA GEMAV+Y +LPGNF
Sbjct: 94  MMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNF 153

Query: 198 NAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXX 257
           NAY + L+   FGFA  W+YCIQWL V+PLEL+TAS+TI YW   +N D           
Sbjct: 154 NAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFIL 213

Query: 258 XXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGD 317
                G++GY E++F F  CKVLMI GF IL             YIGAKYW+DPGAF   
Sbjct: 214 FIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG 273

Query: 318 RSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIA 377
               +FK V           G +E  A+  +EQSNPRRAI S  K  IYRIL I++ ++ 
Sbjct: 274 SGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMI 333

Query: 378 LVGFLVPYDSSELMGS-GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
           L+GFLVP+ SSELMGS G   T ASPYVLA+S HGV++VPH INAVIL+AV+SV NSA Y
Sbjct: 334 LIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMY 393

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           S  RIL +L++QGYAP++  Y+DR GRP  A+I   +FG++AF A S  EE+VFTWL AI
Sbjct: 394 SGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAI 453

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
           +GLS++FTW AI LSH+RFR+AM    R +SELG+++  GV GSV   +   L  IA+FW
Sbjct: 454 AGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFW 513

Query: 557 VSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
           VSIAP G+D  LD  SFF++YLA P+ +V +FGY I  R+W++    K+IDL  +R+I+D
Sbjct: 514 VSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYD 573

Query: 616 AXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                         ++N    ++L +FWC
Sbjct: 574 QDRLYQEDLEHKILIQNSSWARKLHNFWC 602

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  518 bits (1334), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 275/613 (44%), Positives = 365/613 (59%), Gaps = 30/613 (4%)

Query: 46  GKSTDQSSSNEDLSYAGRKKWY---ELGVKEPHLK---------RFIDSFKRAEEGTEET 93
           GK  D+SSS + +  + + +     EL    PH +         RF DSFKRA++ +   
Sbjct: 2   GKIGDKSSSPQPVWSSTKSESVTASELYDSRPHAQHEEHEGAWCRFRDSFKRAQKRSVPQ 61

Query: 94  KHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXN 153
                        L  A  + D+       D  LR+SI+PRHV M S+           N
Sbjct: 62  G----------GDLETASVQTDLT------DGRLRRSIRPRHVAMMSVCTGIGTGLLVAN 105

Query: 154 GSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAV 213
           G +L   GP GL+IGYA +    Y ++QA GEMAV+Y ++PGNFNAY +  + + FGFA 
Sbjct: 106 GKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFAS 165

Query: 214 AWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFF 273
            W+YC+QWL V PLEL+TAS+TI YWT  VN D                G++GY E++F 
Sbjct: 166 VWLYCLQWLTVFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFI 225

Query: 274 FNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXX 333
           F  CKVLMI GF IL           SGYIGA+YWHDPGAF       +FK         
Sbjct: 226 FGLCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPASKFKGFCYVLVTG 285

Query: 334 XXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGS 393
               G +E  A+  +EQS+PRRAI SA K  IYRIL I++ ++ L+GFLVP+ S ELMGS
Sbjct: 286 YFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGS 345

Query: 394 GS-GGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAP 452
           G    T ASPYVLA+S HGV+VVPH +NAVIL+AV+SV NSA YS  R+L +L++QGYAP
Sbjct: 346 GGKSATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAP 405

Query: 453 QWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSH 512
           ++  YIDR GRP  A+I   + G++AF A S  EE+VFTWL AI+GLS++FTW AI LSH
Sbjct: 406 KFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSH 465

Query: 513 IRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKS 571
           IRFR+AM   G S+S+LG++S  G+WGS+Y      L  +A+FWV++APIG +   D  S
Sbjct: 466 IRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLS 525

Query: 572 FFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLK 631
           FF++YLA P+  VF+ GY +Y+ +W +    K+ID+   R ++D              L+
Sbjct: 526 FFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQ 585

Query: 632 NGPTWKRLVHFWC 644
           N     RL HFWC
Sbjct: 586 NSNWLGRLKHFWC 598

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  513 bits (1322), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 264/573 (46%), Positives = 350/573 (61%), Gaps = 22/573 (3%)

Query: 76  LKRFIDSFKRAE--EGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQP 133
            +RF DSFKRA+  E   E +                  + + A    +    L+ +I+ 
Sbjct: 35  FQRFKDSFKRADVVEDVHEKE-----------------GQEEYATGLNKTQQKLKHNIKT 77

Query: 134 RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNL 193
           RH+ M SL           +G ALH  GP GL+IGY    T LYC++QAC E+ V+Y+ L
Sbjct: 78  RHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATL 137

Query: 194 PGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXX 253
           PGN+NAYPTFLVD GFGFAVA VY +QW  V+PLELVTASMTI YWT  VN D       
Sbjct: 138 PGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFY 197

Query: 254 XXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGA 313
                    G++GYAE++F FNT KVL++ GF I+            GYIGAKYW +PG 
Sbjct: 198 LFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKL-GYIGAKYWSNPGT 256

Query: 314 FRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFL 373
           F G+RSI+  K +           G SEFIA+ A+EQ+NPR ++PSA K  +YR++ +FL
Sbjct: 257 FAGERSINHLKGICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFL 316

Query: 374 SSIALVGFLVPYDSSELMGSGSGGTKAS-PYVLAISSHGVRVVPHFINAVILLAVLSVSN 432
             IAL+ FLVPY S +L+ S       + P+V+A + HGV++VPH INA+IL +V+SV N
Sbjct: 317 IPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGN 376

Query: 433 SAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTW 492
           S  YS+ RIL SL++ G  P+ F Y+DR GRP   ++   +FG+++F A S  +E VFTW
Sbjct: 377 SGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTW 436

Query: 493 LLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALI 552
           L AI+GLSQ+FTW +I LSHIRFR AM VQGRS+ ELG+ S  G  GS YA     + L+
Sbjct: 437 LTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLV 496

Query: 553 AEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHR 611
           A+FW++IAPI +   LDA+SFF+NYLA  +L++FY GYKI+ R+ +L I    IDL THR
Sbjct: 497 AQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHR 556

Query: 612 NIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            IFD              +K     +R + FWC
Sbjct: 557 QIFDEEVLQQEELERKERMKTASFKQRFIAFWC 589

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  511 bits (1317), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 241/568 (42%), Positives = 349/568 (61%), Gaps = 20/568 (3%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136
           +RF+DSF+R     E+T              S  +++ ++   +  +   L++ ++ RHV
Sbjct: 33  RRFVDSFRR-----EDTSR------------SGDLEDGEI---NSTDTTKLQQRMRTRHV 72

Query: 137 LMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196
           +M SL           N ++LH  GPAGL+IGY ++    Y ++ A GEMAV+Y  LPGN
Sbjct: 73  VMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGN 132

Query: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXX 256
           FNAY +  + + FGFA  W++C+QWL V PLEL+TA++ I YW   VN +          
Sbjct: 133 FNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFI 192

Query: 257 XXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG 316
                 GA+GY E +F FN CKVLMI GF I+           +GYIG +YW +PG+F  
Sbjct: 193 ICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVS 252

Query: 317 DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376
              +D+ K             G  E  A+  +E  NP+ AIPSA K  +YRIL ++L ++
Sbjct: 253 GTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTM 312

Query: 377 ALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
            ++GFLVP+DS  LMGSGS     SPYVLAI  HGV+V+PH +NAVIL++V+SV NSA Y
Sbjct: 313 IMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMY 372

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           S+ R+L +L+QQGYAP+  +YIDREGRP  ++I+  +FG+IAF A S  +E++F WL AI
Sbjct: 373 SAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAI 432

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
           +GLS++FTW +ICLSH RFR+AM +QGRS+  LG+R+  G WGS+YA     L  IA+FW
Sbjct: 433 AGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFW 492

Query: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           V++ PI +  +D  SFF+NY+A P+ ++ + GY +Y+R+W L      +DL THR ++D 
Sbjct: 493 VALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDV 552

Query: 617 XXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                        ++N P + ++++FWC
Sbjct: 553 EVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  513 bits (1320), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 251/580 (43%), Positives = 349/580 (60%), Gaps = 24/580 (4%)

Query: 67  YELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAH 126
           +++ VK  HL+ FIDSFKRA++  +                     + +   T+ +E   
Sbjct: 55  FDVQVKNRHLQGFIDSFKRADDSPDH-------------------NDLEKTTTAHQEQ-- 93

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
            +K+++ RHV+M SL           NG  L  AGPA LVI Y ++    Y +IQA GEM
Sbjct: 94  -KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEM 152

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNND 246
           AV+Y  LPG+FNAY +F + + FGFA  W++CIQWL V+PLEL+TA+MTI YW T ++ D
Sbjct: 153 AVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPD 212

Query: 247 XXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAK 306
                           G + Y E +F FN CK+LMI GF I             GYIG K
Sbjct: 213 VFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGK 272

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YWHDPGAF       RFK +           G +E   +  ++Q NPR++ P+AAK  +Y
Sbjct: 273 YWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVY 332

Query: 367 RILFIFLSSIALVGFLVPYDSSELMG-SGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           RI+ I+L ++ L+GF+VP++SSEL+G SG  G  ASPYVLA S HG++VVPH INAVIL+
Sbjct: 333 RIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILI 392

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           A++SV+NS+ Y+  R+L SL+QQGYAP++ +Y+DR GRP  A+++S L G+I F A S +
Sbjct: 393 ALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPR 452

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
           EEEVFTWL AISGLS++FTW +I  SHIRFRRAM +Q +S+  LG+++  G+WGS +   
Sbjct: 453 EEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVG 512

Query: 546 MLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKN 604
              L   A+FWV+++P       DA SFF +YLAMPI +VFYFGY  + +D+ +      
Sbjct: 513 FNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQ 572

Query: 605 IDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +DL  HR ++D              L+N     ++  FWC
Sbjct: 573 VDLDNHRKVYDPEFLRQEDLENKERLRNSSFLVKIYEFWC 612

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  512 bits (1318), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 265/611 (43%), Positives = 355/611 (58%), Gaps = 22/611 (3%)

Query: 38  NENIVEYFGKSTDQSSSNEDLSYAGRKK---WYELGVKEPHLKRFIDSFKRAEEGTEETK 94
           + N+ E    ST     NE L          + +   K    +R+ DSFKRAE+ TE   
Sbjct: 23  SNNLTERIHTSTTNDYINEKLGSVEEVSSFDYVQEAAKTGRFRRWADSFKRAEKSTE--- 79

Query: 95  HMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNG 154
                          A      +I +  E   L+K+++ RHV+M SL           N 
Sbjct: 80  ---------------AEDGESGSIYNGNESTELKKAMKSRHVVMMSLGTGIGTGLLVANA 124

Query: 155 SALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVA 214
             L  +GPA LVIGY ++    Y +IQA GE+ V+Y++LPGNFN Y   LV   FGFA  
Sbjct: 125 KGLAISGPAPLVIGYGLVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSRPFGFATV 184

Query: 215 WVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFF 274
           W+  +QWL V+PLEL+T ++TI YWT KVN D                G K Y EA+F F
Sbjct: 185 WLASVQWLTVIPLELITCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLF 244

Query: 275 NTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXX 334
           NTCK+LMI GF IL            GYIG  YW++PGAF  D +  RFK +        
Sbjct: 245 NTCKILMIAGFIILSIVINVGGAGNDGYIGGSYWNNPGAFASDNAASRFKSICYILVTGY 304

Query: 335 XXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG 394
              G +E   +  +EQ NPR++ P AAK  IYRIL I+L ++ L+GF VP+DS +LMGS 
Sbjct: 305 FSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSA 364

Query: 395 SGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQW 454
                ASPYVLA S HGV+VVPHFINAVIL+A++SV+NS+ Y++ R++ SL+QQG+AP++
Sbjct: 365 GSSAHASPYVLAASLHGVKVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKF 424

Query: 455 FNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIR 514
             Y+DREGRP   + +  +FG+I F A S KEE+VFTWL AI+GLS++FTW A  LSHIR
Sbjct: 425 LTYVDREGRPLLGIAVCAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIR 484

Query: 515 FRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFF 573
           FR+AM VQG++I E G+ S  G+WGS+       L  IA+FWV+++PIG D   DA++FF
Sbjct: 485 FRQAMKVQGKNIKECGYLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGNDGKCDAQAFF 544

Query: 574 ENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNG 633
           ++YLA PI + FYFG   Y +D+ L    ++IDL  HR I+D              LK  
Sbjct: 545 QSYLAFPIWLAFYFGCMFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDLATKAELKRR 604

Query: 634 PTWKRLVHFWC 644
               +LV F+C
Sbjct: 605 GFHAQLVAFFC 615

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  502 bits (1292), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 246/576 (42%), Positives = 343/576 (59%), Gaps = 19/576 (3%)

Query: 70  GVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRK 129
           G ++   +R +DSFKR E     +  +                  D  +TS      L++
Sbjct: 32  GHRDGLFQRIVDSFKRVEGEVRNSSDL-----------------EDGEVTSAH-STKLKQ 73

Query: 130 SIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVS 189
           +++ RHV++ SL           N S+LH  GP GL+IGY  +    Y ++QA GEMAV+
Sbjct: 74  NMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVA 133

Query: 190 YSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXX 249
           Y  LPGNFNAY +  + + FGFA  W++CIQW  ++PLEL+T+S+ + YWTTK+N D   
Sbjct: 134 YPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTKINADIFV 193

Query: 250 XXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWH 309
                        GA+GY E +F FN+CKVLM+ GF I+            GYIG KYWH
Sbjct: 194 LIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWH 253

Query: 310 DPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRIL 369
           +PGAF     IDRFK +           G  E  A+  +E  NPR+AIPSA    +YRIL
Sbjct: 254 EPGAFAAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRIL 313

Query: 370 FIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLS 429
            I++ ++ ++GFLVP+DS++L+GSGS G   SPYVLA+S HG+++VPH INAVIL++V+S
Sbjct: 314 IIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVILISVIS 373

Query: 430 VSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEV 489
           V NSA YS  R+L SL+QQGYAP+  +Y+DR+GRP  A+II  +FG+IAF A S  EE++
Sbjct: 374 VGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDI 433

Query: 490 FTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFL 549
           F WL AISGLS++FTW AICLSH RFRRAM +QGRS+  LG+RS  G WGS+YA      
Sbjct: 434 FGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVF 493

Query: 550 ALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLI 608
            LIA+ WV++ P+        KS F++ LA+P+ +    GY I  ++W +     +I + 
Sbjct: 494 VLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVD 553

Query: 609 THRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +HR  +D              +K    + R+ + WC
Sbjct: 554 SHRRSYDVEVMKQEDLEYKQKMKRSKWYVRMSYTWC 589

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  496 bits (1277), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 260/623 (41%), Positives = 352/623 (56%), Gaps = 46/623 (7%)

Query: 23  KDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDS 82
           KD+ + +  +FN+  N   V              DL   GR      GV      RFIDS
Sbjct: 5   KDSIRTKDINFNETSNSTAV--------------DLGGEGRAS----GV----FHRFIDS 42

Query: 83  FKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEE-DAHLRKSIQPRHVLMSSL 141
           FK   E                       ++ D+   S E  D HL+K+++ RHV+M +L
Sbjct: 43  FKPPVED----------------------EKSDLEEMSMESTDRHLKKAMKSRHVIMMTL 80

Query: 142 AXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYP 201
                      N   L   GP  LVIGY ++    Y +IQA GEMAV+Y  LPG+FN Y 
Sbjct: 81  GTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYT 140

Query: 202 TFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXX 261
           +  + +  GFA  W++ IQWL V+PLEL+T +MTI YW   +N D               
Sbjct: 141 STFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHV 200

Query: 262 XGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSID 321
            G K Y E +F FNTCK+L I GF I           T GYIGAKYW +PG+F    S  
Sbjct: 201 FGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSFASSTSAG 260

Query: 322 RFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGF 381
           RFKDV           G +E   +  +EQ+NPRR+ P AAK  IYRIL I+L ++ L+GF
Sbjct: 261 RFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGF 320

Query: 382 LVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRI 441
            VP+D+ +LMG+G   T ASPYVLA S HGV+VVPH INAVIL+ V S+ NS+ Y++ R+
Sbjct: 321 NVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRL 380

Query: 442 LFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQ 501
             SL++QGYAP+   YIDREGRP  A+    + G+IAF A SS+EE+VFTWL AI+ LS+
Sbjct: 381 FASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSE 440

Query: 502 IFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAP 561
           +FTW  I LSHIRFR AM VQG+ ++ELG+++  GVWGS++      L  IA+FWV+++P
Sbjct: 441 LFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSP 500

Query: 562 IGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXX 621
            G   + A+ FFE+YLA P+ + FYF Y ++ RD+    + ++IDL  HR I+D      
Sbjct: 501 PG-GTISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQ 559

Query: 622 XXXXXXXXLKNGPTWKRLVHFWC 644
                   ++N   W ++ +FWC
Sbjct: 560 EDEERKEKIRNSSFWIKMKYFWC 582

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  496 bits (1278), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 257/559 (45%), Positives = 345/559 (61%), Gaps = 18/559 (3%)

Query: 67  YELGVKEPHLKRFIDSFKRAEEGTEETK--------HMXXXXXXXXSPLSAAIKEHDVAI 118
           YE    E   + F  + K+ EE  ++ K         +        S     +     + 
Sbjct: 22  YERANAEKQKRDFAITEKQDEESEQQVKPQKTGNKSKLQNECKKILSSFKRQLPPSQNSE 81

Query: 119 TSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
              +E  +L KSI+ RH++M SL           NG  L  AGPAGLV+GY +    LYC
Sbjct: 82  LESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYC 141

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           IIQA GE+ + Y+ L GN+  YP+ LVD   GFAV+ VY IQWL V+PL+LVTA+MT+ Y
Sbjct: 142 IIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKY 201

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           WT+ VN+D                G++GYAEA+F FN CK+LM+ GF IL          
Sbjct: 202 WTS-VNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAG 260

Query: 299 TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
              YIG +YWH+PG F        FK V           G  E + + A+EQ NP ++IP
Sbjct: 261 DRKYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIP 315

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG-SGGTKASPYVLAISSHGVRVVPH 417
           +A K ++YRIL I++ +  LV FLVPY+S EL+GS  S G+ ASP+V+A++SHGV+VVPH
Sbjct: 316 NACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPH 375

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
           FINAVIL++V+SV+NS+ YS  R+L SL++QG  P+   Y+DR GRP    ++S+ FG I
Sbjct: 376 FINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCI 435

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
            F A S  EEEVFTWLLAIS LSQ+F WM++ LSHIRFR AM  QGRS++E+G+++Q G 
Sbjct: 436 GFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGY 495

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDH--LDAKSFFENYLAMPILIVFYFGYKIYNRD 595
           WGS  A  +    L+ +FWV+IAP+  DH  L+ K FF+NYLAMPI++V YFG+KIY + 
Sbjct: 496 WGSWLAVLIAVFFLVCQFWVAIAPV-NDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKS 554

Query: 596 WKLFIRAKNIDLITHRNIF 614
           W  +I A  IDL +HRNIF
Sbjct: 555 WSFWIPADKIDLNSHRNIF 573

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  489 bits (1260), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 253/615 (41%), Positives = 354/615 (57%), Gaps = 42/615 (6%)

Query: 31  RSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGT 90
           +SFND++          S   S  + ++  +GR            ++R+IDS+KRAE   
Sbjct: 40  KSFNDIDT---------SERTSVESSEVYRSGR------------IRRWIDSYKRAEHPR 78

Query: 91  EETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXX 150
           E                              ++  HL+K ++ RHV+M SL         
Sbjct: 79  EHIDGFED--------------------GESKDGIHLKKQMKTRHVVMMSLGTGIGTGLL 118

Query: 151 XXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFG 210
             N   LH AGPA LVIGY ++    Y +IQA GE+AV+Y  LPGNFN+Y   L+ + FG
Sbjct: 119 IANAKGLHFAGPAPLVIGYGMVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFG 178

Query: 211 FAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEA 270
           FA  W+  +QWL V+PLE + AS+TI YW  +++ D                G + Y E 
Sbjct: 179 FATVWLAAVQWLTVLPLEFIAASLTIKYWNDRISGDVFVVIFYVFLLFIHFVGVRAYGET 238

Query: 271 DFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXX 330
           +F FN CKVLMI GF IL            GYIG KYW+DPGAF G+ +  RFK V    
Sbjct: 239 EFIFNLCKVLMIIGFIILSIVINAGGAGNDGYIGGKYWNDPGAFAGETAGSRFKGVCYIL 298

Query: 331 XXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL 390
                  G +E   +  +EQ NPR++ P AAK  IYRI+ I+L ++ L+GF VPY+   L
Sbjct: 299 VTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRL 358

Query: 391 MGSG-SGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQG 449
           MG+  + G+ ASPYVLA S HGV++VPHFINAV+L+A++SV NSA Y++ R++ SL++QG
Sbjct: 359 MGADDASGSHASPYVLAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQG 418

Query: 450 YAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAIC 509
           +AP+   Y+DREGRP  ++ I  LFG+I F A SSKEE+VFTWL AI+GLS++FTW A  
Sbjct: 419 FAPKIMAYVDREGRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFF 478

Query: 510 LSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDA 569
           +SHIRFR AM +QG+ I E+GF +  G++GS Y      L   A+FWV+++PIG   + A
Sbjct: 479 ISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILVFAAQFWVALSPIGSKKVGA 538

Query: 570 KSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXX 629
           +SFFE+YLA PI + FYFGY ++ +D+      ++IDL  HR I+D              
Sbjct: 539 ESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDLDFHRRIYDPEEMAEINRQEKEE 598

Query: 630 LKNGPTWKRLVHFWC 644
            KN     +++++ C
Sbjct: 599 YKNSSIVGKIIYWLC 613

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  488 bits (1256), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/604 (43%), Positives = 356/604 (58%), Gaps = 55/604 (9%)

Query: 14  DNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKE 73
           D+ N  +E+KD S       N +   +     G +T Q                +LGV  
Sbjct: 18  DSKNDGFEVKDISATVSPETNVITASSSASNEGPATPQP---------------QLGV-- 60

Query: 74  PHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQP 133
             +  F+DSFKR                          KEHD +    E D  L K+I+ 
Sbjct: 61  --VASFLDSFKR--------------------------KEHDDSTAGDEND--LNKAIRS 90

Query: 134 RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNL 193
           RH++M SL            GS L ++GP GL+IGY +    ++ IIQA GE+ + YSN+
Sbjct: 91  RHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGELGIVYSNV 150

Query: 194 PGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXX 253
            GNF  YPT LVD  FGFA++++Y IQW+ V+PL+LVTA+MTI +W   VN D       
Sbjct: 151 VGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNLDVFVLASF 210

Query: 254 XXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS--GYIGAKYWHDP 311
                    GA+GY EA+FF N CK++M+TGF IL              GYIG KYW +P
Sbjct: 211 VVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGYIGGKYWRNP 270

Query: 312 GAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFI 371
           G F      + FK V           G  E + + A+EQ NP ++IPSA K ++YRILFI
Sbjct: 271 GLFA-----NGFKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKSIPSATKKVMYRILFI 325

Query: 372 FLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVS 431
           +L S+ +V FLVPY S +LMGS   G+ +SP+V+AI+SHGV VVPH INAVIL++VLSV+
Sbjct: 326 YLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVPHLINAVILISVLSVA 385

Query: 432 NSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFT 491
           NSA Y + R+L SL+Q G AP++ NYID+ GRP    ++ +LFG+I F A S K E VFT
Sbjct: 386 NSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFT 445

Query: 492 WLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLAL 551
           WLL+ISGL QIF W++IC+SHIRFR AM VQG  ++E+ +++Q G WGS  A  +    L
Sbjct: 446 WLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFVL 505

Query: 552 IAEFWVSIAPIG-EDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITH 610
           + +FWV+IAP+G    LDA +FF+NYLA P+++  Y G+K+Y + W+L I A  I+L  +
Sbjct: 506 VCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQWQLLIPADKIELDNN 565

Query: 611 RNIF 614
           RN++
Sbjct: 566 RNVY 569

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  489 bits (1258), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 264/615 (42%), Positives = 362/615 (58%), Gaps = 52/615 (8%)

Query: 8   DKDDFIDN----SNVEYELKDA--SKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYA 61
           D D F  N    +   + L D   ++ ++R F   E +N      +  +Q  S +     
Sbjct: 3   DSDSFTPNEASLAPYPHSLHDRGNAEKKKRDFTITEKQN------EEPEQQGSPQKTDRK 56

Query: 62  GRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSK 121
            + +           ++F DSFKR     + ++                           
Sbjct: 57  PKLR--------NEFRKFFDSFKRQLPSDQNSE------------------------LES 84

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
           +E  +LRKSI+ RH++M SL           NG  L  AGPAGLV+GY I    LYCIIQ
Sbjct: 85  QEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           A GE+ + Y+ L GN+  Y + LVD   GFAV+ VY IQWL V+PL+LVTA+MT+ YWT 
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT- 203

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            VN D                G++GYAEA+F FN CK+LM+ GF IL             
Sbjct: 204 NVNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRR 263

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIG +YWH+PG F        FK V           G  E + + A+EQ NP  +IP+A 
Sbjct: 264 YIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNAC 318

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGT-KASPYVLAISSHGVRVVPHFIN 420
           K ++YRIL I++ +  L+GFLVPY+S EL+GSGS     ASP+V+A+SSHGV+VVPHFIN
Sbjct: 319 KKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFIN 378

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           AVIL++V+SV+NS+ YS  R+L SL++QG  P+   Y+DR GRP    ++S+ FG I F 
Sbjct: 379 AVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFV 438

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
           A S+ EE+VFTWLLAIS LSQ+F WM++CLSHIRFR AM  QGRS+ E+G+++Q G WGS
Sbjct: 439 ATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGS 498

Query: 541 VYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLF 599
             A  +    L+ +FWV+IAP+ E   LD K FF+NYLAMPI+++ YFG+K+Y + W+ +
Sbjct: 499 WIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFW 558

Query: 600 IRAKNIDLITHRNIF 614
           I A+ IDL +HRN++
Sbjct: 559 IPAEKIDLDSHRNVY 573

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  487 bits (1254), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 261/585 (44%), Positives = 348/585 (59%), Gaps = 47/585 (8%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136
           K+F DSFKR     + ++                           +E  +L +SI+ RH+
Sbjct: 64  KKFFDSFKRQLPADQNSE------------------------LESQERNNLTRSIKSRHL 99

Query: 137 LMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196
           +M SL           NG  L  AGPAGLV+GY I    LYCIIQA GE+ + Y+ L GN
Sbjct: 100 IMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGN 159

Query: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXX 256
           +  Y + LVD   GFAV+ VY IQWL V+PL+LVTA+MTI YWT  VN D          
Sbjct: 160 YTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWT-NVNADIFVAAVFIFV 218

Query: 257 XXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG 316
                 G+KGYAEA+F FN CK+LM+ GF IL             +IG KYWH+PG F  
Sbjct: 219 IIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKFIGTKYWHNPGPFA- 277

Query: 317 DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376
                 FK V           G  E + + A+EQ NP ++IP+A K ++YRILFI++ + 
Sbjct: 278 ----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILFIYMLTT 333

Query: 377 ALVGFLVPYDSSELMGSGSGGT-KASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAF 435
            L+ FLVPY+S EL+GSGS     ASP+V+A++SHGV+VVPHFINAVIL++V+SV+NS+ 
Sbjct: 334 ILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSL 393

Query: 436 YSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLA 495
           YS+ R+L SL++QG+ P+   Y+DR GRP    ++SI+FG I F A S  EE+VFTWLLA
Sbjct: 394 YSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLA 453

Query: 496 ISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEF 555
           IS LSQ+F WM++ LSHIRFR AM  QGRS+ E+G+++Q G WGS  A  +    L+ +F
Sbjct: 454 ISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQF 513

Query: 556 WVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIF 614
           WV+IAP+ +   LDA  FF+NYLAMPI++  YFG+KIY + WK +I A+ IDL +HR I+
Sbjct: 514 WVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHKIYTKSWKFWIPAEKIDLDSHRTIY 573

Query: 615 DAXXXXXXXXXXXXXLKNGPT---------------WKRLVHFWC 644
                          LK   T               +KR+ +FWC
Sbjct: 574 VPPILMGTNKIDDDDLKEYETSESSENPNGSGSRKFFKRMANFWC 618

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  486 bits (1250), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 252/586 (43%), Positives = 339/586 (57%), Gaps = 19/586 (3%)

Query: 63  RKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKE 122
            K+ + + +K   +K +IDSFK  EE  E    +             +I E+      ++
Sbjct: 94  HKRKFNIEIKNKRIKNWIDSFKPPEECMESELELN------------SIDENG---HREK 138

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
             A L+K+++ RHV+M SL           N S L  +GPA LVIGY ++    Y +IQA
Sbjct: 139 PRAQLKKTMKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQA 198

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEM V+Y  LPGNFN Y +  +    GFA  W+  IQWL V+PLEL+ ASMTI YWTT 
Sbjct: 199 AGEMGVAYPTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTS 258

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++ D                G   Y E +F FN CK+LMI GF IL            GY
Sbjct: 259 ISPDVFVVIFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGY 318

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYWH PGAF G  S  RFKDV           G +E   +  +EQ NPR++ P+AAK
Sbjct: 319 IGGKYWHTPGAFVGKNSASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAK 378

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA---SPYVLAISSHGVRVVPHFI 419
             IYRIL ++L ++ L+GF VPYD+  L  + S    +   SPYVLA S HGV+VVPHFI
Sbjct: 379 TTIYRILIVYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFI 438

Query: 420 NAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAF 479
           NAV+L+A++SV+NSA Y++ R++ SL+QQG AP++  YIDREGRP   ++I  L G+I F
Sbjct: 439 NAVVLIALISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGF 498

Query: 480 CACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWG 539
            A S KE+EVF WL AI+GL+ +F W    LSHIRFR AM VQG+ I+E+G+++  G+WG
Sbjct: 499 AAASDKEQEVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWG 558

Query: 540 SVYAATMLFLALIAEFWVSIAPIGE-DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKL 598
           S+  A    L LIA FWVS+ P G+  ++ AK+FFE  LA+PI I F  GY +  +DW +
Sbjct: 559 SIIGACFNVLVLIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVI 618

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +   ++IDL   R I+D              ++N   W R   FWC
Sbjct: 619 WNPIESIDLDYCRKIYDPEQLKREDEENRERIRNAGFWARCRAFWC 664

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  484 bits (1245), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 243/495 (49%), Positives = 324/495 (65%), Gaps = 8/495 (1%)

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
           +E  +L KSI+ RH++M SL           NG  L  AGPAGLV+GY I    LYCIIQ
Sbjct: 85  QEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           A GE+ + Y+ L GN+  YP+ LVD   GFAV+ VY IQWL V+PL+LVTA+MT+ YWT+
Sbjct: 145 AAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS 204

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            VN D                G++GYAEA+F FN+CK+LM+ GF IL             
Sbjct: 205 -VNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRR 263

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIGA+YWH+PG F        FK V           G  E + + A+EQ NP ++IP+A 
Sbjct: 264 YIGAEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNAC 318

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS-PYVLAISSHGVRVVPHFIN 420
           K ++YRIL I++ +  LV FLVPY+S EL+GS       + P+V+A++SHGV+VVPHFIN
Sbjct: 319 KKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFIN 378

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           AVIL++V+SV+NS+ YS  R+L SL++QG  P+   Y+DR GRP     +S++FG I F 
Sbjct: 379 AVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFV 438

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
           A S  EE+VFTWLLAIS LSQ+F WM++ LSHIRFR AM  QGRS++E+G+++Q G WGS
Sbjct: 439 ATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGS 498

Query: 541 VYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLF 599
             A  +    L+ +FWV+IAP+ E   L+ K FF+NYLAMPI++  YFG+KIY + W  +
Sbjct: 499 WLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFW 558

Query: 600 IRAKNIDLITHRNIF 614
           I A+ IDL +HRNIF
Sbjct: 559 IPAEKIDLDSHRNIF 573

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  484 bits (1247), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 232/505 (45%), Positives = 320/505 (63%), Gaps = 2/505 (0%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E      +  ED   +  ++ RHV+M +LA          N  +LH +GPAGLV+GY ++
Sbjct: 140 EDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMV 199

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
               Y ++QA GEMA++Y  LPG FN Y +  + + FGFA  W++ + WL ++PLEL+T+
Sbjct: 200 SFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITS 259

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
           S+T+ YWTT +N D                G + YAEA+FFFN+CK+LMITGF I     
Sbjct: 260 SITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVV 319

Query: 293 XXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSN 352
                   GYIG KYWHDPG F  D    RFK+V           G +E   +  +EQ N
Sbjct: 320 NCGGAGHDGYIGGKYWHDPGPFASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQEN 379

Query: 353 PRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGV 412
           PR+A+P AAK  +YR+  I+L ++ L+GF VPY+S +LMG+ +    ASPYVLA   HGV
Sbjct: 380 PRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANS-KDASPYVLAAQIHGV 438

Query: 413 RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISI 472
           ++VPHFINAVILL+V+SV+NSA ++  R+L +L++QG+AP++  Y+DR GRP  A+ +  
Sbjct: 439 KIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCS 498

Query: 473 LFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFR 532
           LFG+IAF A S KE+EVFTWL AI+GLS++F W  I LSHIRFR AM   G+S+ E+G++
Sbjct: 499 LFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYK 558

Query: 533 SQLGVWGSVYAATMLFLALIAEFWVSI-APIGEDHLDAKSFFENYLAMPILIVFYFGYKI 591
           +  G+WGS Y      L LIA+FWV++ AP     + A SFFE+YLA  I + FY  Y I
Sbjct: 559 AITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMI 618

Query: 592 YNRDWKLFIRAKNIDLITHRNIFDA 616
           YN+DW + I  K+ID+   R I+DA
Sbjct: 619 YNKDWTILIPLKDIDVDYQRRIYDA 643

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  481 bits (1239), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 238/494 (48%), Positives = 320/494 (64%), Gaps = 15/494 (3%)

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
           E +  L K+++PRH++M SL           NG  L K+GPAGLVIGY +    +YC++Q
Sbjct: 101 ETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQ 160

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           A GE+ + YS L GN+  YPT+L+D   GFAV+ +Y +QWL V+PL+LVTA+MTI YWTT
Sbjct: 161 AAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTT 220

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            VN D                GAKGYAEA+FF N CK+LM+ GF IL             
Sbjct: 221 NVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKE 280

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIG KYW  PGAF      + FK V           G  E + + A+EQ+NPR+AIP A 
Sbjct: 281 YIGVKYWQTPGAFA-----NGFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIPDAC 335

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGS--GGTKASPYVLAISSHGVRVVPHFI 419
           + ++YR+LF+++ +  +V FLVPY+S  L+GS +   G+ ASP+V+A++SHGV+VVPH I
Sbjct: 336 RKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVPHII 395

Query: 420 NAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAF 479
           NA IL++V+SV+NS+ YS  R+L SLSQQGYAP+ FNYIDR GRP   +++S+  G+IAF
Sbjct: 396 NAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGLIAF 455

Query: 480 CACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQ-----GRSISELGFRSQ 534
            A     EEVFTWLLA+SGLSQIF WM+I +SH+RFR A+  Q      R + E  + +Q
Sbjct: 456 LAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVE--YTAQ 513

Query: 535 LGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYN 593
            G  GS+ A  +    L+ +FWV+IAP+G +  LD + FFENYLA P+L+  Y  YKI++
Sbjct: 514 TGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIWH 573

Query: 594 RDWKLFIRAKNIDL 607
           RDW+L I A  IDL
Sbjct: 574 RDWRLCIPANEIDL 587

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  473 bits (1218), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 254/510 (49%), Positives = 339/510 (66%), Gaps = 9/510 (1%)

Query: 108 SAAIKEHDVAITSKEE-DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLV 166
           S ++++    + ++E+ +  L +SI+ RH+LM SL           NG  L K+GPAGLV
Sbjct: 72  SESLRDDSKPLENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLV 131

Query: 167 IGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMP 226
           IGY +    +Y I+QA GE+ + YS L GN+  YP+ LVD   GFA++ +Y +QWL VMP
Sbjct: 132 IGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMP 191

Query: 227 LELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFF 286
           L+LVTA+MTI YWT  +N +                GAKGY EA+F  N  KVLM+ GF 
Sbjct: 192 LQLVTAAMTIGYWT-NINPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFV 250

Query: 287 ILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIG 346
           +L          T GYIG  YW +PGAF      + FK V           G  E +A+ 
Sbjct: 251 LLAILINTGAIGTDGYIGTIYWKNPGAFA-----NGFKGVCSVFCYAAFSYGGIEVLALT 305

Query: 347 ASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS-PYVL 405
           A+EQ NP +AIPSA K  +YRILF+++ +  L+GFLVPYDS +LMGS SGG   S P+V+
Sbjct: 306 AAEQENPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSSPFVI 365

Query: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465
           AI+SHGV+VVPH INAVIL++++SV+NSAFYSS R+L SLS+QG  P+ FNY+D+EGRP 
Sbjct: 366 AIASHGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPW 425

Query: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525
             ++ + LFG I F A S  +EEVFTWLLAISGLSQIF WM+ICLSHIRFRRAM  QG+S
Sbjct: 426 YCILFASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKS 485

Query: 526 ISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIV 584
           + E+G+++  G WGS  A ++   +LI++FWV+IAPIG+D  LD   FF+NYLA PI+++
Sbjct: 486 LDEIGYKAPTGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLI 545

Query: 585 FYFGYKIYNRDWKLFIRAKNIDLITHRNIF 614
            Y GYK Y +DW+L+I +  IDL   R I+
Sbjct: 546 AYLGYKTYYKDWRLYIPSDKIDLSYGREIY 575

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  468 bits (1205), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 241/620 (38%), Positives = 347/620 (55%), Gaps = 39/620 (6%)

Query: 37  ENENIVEYFGKSTDQSSS--------NEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEE 88
           E   I +Y G   + S S         E +    ++ +++ G+    L R +DS++RA+ 
Sbjct: 28  EETQINDYKGTVENLSDSPVEVSNIQTEGIDGPPKQGFFQRGI----LGRVVDSYRRAD- 82

Query: 89  GTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXX 148
                                 I   D        +A L+++++ RHV M SL       
Sbjct: 83  ----------------------IPGQDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTG 120

Query: 149 XXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEG 208
               NG  L  AGPA L+IGY ++    Y ++QA GE+AV++  +PG+FNAY + LV   
Sbjct: 121 LLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRP 180

Query: 209 FGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYA 268
           FGFA  W++ +QWL + P+EL+  +  + +WTT+V+ D                G + Y 
Sbjct: 181 FGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYG 240

Query: 269 EADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMX 328
           E +FF N  KVLM+ GF I            SGYIGAKYWHDPGAF    +  RFK V  
Sbjct: 241 ETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAKYWHDPGAFVSHTAEGRFKGVCY 300

Query: 329 XXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSS 388
                    G +E   +  +EQ NPR+ IP+A K  IYRI+FI+L ++ LVGF VP +  
Sbjct: 301 VLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHP 360

Query: 389 ELMGS---GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSL 445
            LMGS     G    SPYVLA S H VRV+PHFINAV++LA++S+SNSA Y++ R++ SL
Sbjct: 361 RLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSL 420

Query: 446 SQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTW 505
           +QQGY P++F+YIDR GRP RA+++  + G+IAF + S K E +F+WL AI+GLS++FTW
Sbjct: 421 AQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTW 480

Query: 506 MAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSI-APIGE 564
            +I LSH+RFR A+ VQG+ I+ELG++S  GVWGS Y      L   A+FWV++ AP   
Sbjct: 481 SSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSG 540

Query: 565 DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXX 624
               A  FF++YLA+PI + FY G+ ++ RD+   I    +DL ++R  +D         
Sbjct: 541 GKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQEDE 600

Query: 625 XXXXXLKNGPTWKRLVHFWC 644
                +K+   W +L  F+C
Sbjct: 601 EHKQAMKSASIWIKLHSFFC 620

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  464 bits (1194), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 254/507 (50%), Positives = 330/507 (65%), Gaps = 9/507 (1%)

Query: 112 KEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           K+ D+    + +D  L K+I+ RH+LM SL           NG  L KAGPAGL+IGY +
Sbjct: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
               +YCII A GE+ + Y  L GNF  YP+ L+D   GFA++ +Y +QWL V+PL+LVT
Sbjct: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205

Query: 232 ASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXX 291
           A++TI +WT  VN D                GA+GYAE +FF N CK+LMITGF IL   
Sbjct: 206 AAITISFWT-DVNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIILSIV 264

Query: 292 XXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS 351
                    GYIGAKYW  PG F        FK V           G  E + +   EQ 
Sbjct: 265 IITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQE 319

Query: 352 NPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHG 411
           +P  A+P+A K ++YRIL I+L +  LV FLVPYDS  L+GS   G+ ASP+V+AI SHG
Sbjct: 320 DPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHG 379

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           V+VVPHFINAVIL++V+SV+NS+ YSS R+L SLS+QG  PQW N+ID  GRP R  IIS
Sbjct: 380 VKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIIS 439

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
           ILFG+I F A S K E+VFTWLLAISGLSQ+F WM++ LSHIR R AM  QG+S+ E+G+
Sbjct: 440 ILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGY 499

Query: 532 RSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDH--LDAKSFFENYLAMPILIVFYFGY 589
           ++Q G WGS  A  + F +L+ +FWV+IAP+ E H  LD  +FF+NYLA PI++V Y G+
Sbjct: 500 KAQTGYWGSWLAVFIGFFSLVTQFWVAIAPV-EKHGELDVVNFFQNYLAFPIVLVAYLGH 558

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIFDA 616
           KIY ++W+L+I A  IDL +HR I+ A
Sbjct: 559 KIYYKNWRLWIPADKIDLDSHRRIYSA 585

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  464 bits (1194), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 258/595 (43%), Positives = 352/595 (59%), Gaps = 37/595 (6%)

Query: 26  SKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKE-PHLKRFIDSFK 84
           + L+    +D   EN  E     + + +SNE L+        +       H K F++ FK
Sbjct: 13  TTLQENQEDDSFKENAEETVKHISIEEASNETLNEKPEAHTQKCEYNPITHFKNFLNGFK 72

Query: 85  RAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXX 144
           R                          K+++     + +D  L K+I+ RH+LM SL   
Sbjct: 73  RQ-------------------------KQNEEGADLEMQDTQLSKTIKARHLLMISLGTG 107

Query: 145 XXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFL 204
                   NG  L KAGP GLVIGY I    +YC+IQ+ GE+ + Y  L GNF  Y + L
Sbjct: 108 IATGLLVGNGQVLSKAGPGGLVIGYFISSVMIYCMIQSAGELGICYRGLVGNFTRYSSLL 167

Query: 205 VDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGA 264
           +D   GFA++ +Y  QWL V+PL+LVTA++TI++WT  +N D                GA
Sbjct: 168 IDPSLGFALSILYTFQWLTVLPLQLVTAAITIEFWT-DLNPDIFVAIIFIVVIVVNLFGA 226

Query: 265 KGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFK 324
           +GYAEA+FF N CK+LMI GF IL            GYIGAKYW +PGAF      + FK
Sbjct: 227 RGYAEAEFFCNLCKILMIIGFIILSIIIISGGAGNDGYIGAKYWKNPGAFA-----NGFK 281

Query: 325 DVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVP 384
            V           G  E + +   EQ NP + +P+  K + YRILFI+L +  LV FLVP
Sbjct: 282 GVCTVFTYAAFSYGGIEVLVLSIDEQENPIKVVPNCCKKVAYRILFIYLLTTILVCFLVP 341

Query: 385 YDSSELMGS----GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCR 440
           Y S +L+GS     + G+ ASP+V+A+ SHGV+VVPHFINAVIL++V+SV+NS+ YSS R
Sbjct: 342 YTSPQLLGSLNKGENSGSHASPFVIAVESHGVKVVPHFINAVILISVISVANSSVYSSGR 401

Query: 441 ILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLS 500
           +L SLS+QG  PQ+ NYID+ GRP R  +IS+ FG+I F A S K ++VFTWLLAISGLS
Sbjct: 402 LLLSLSEQGTFPQFLNYIDQRGRPIRCFVISLTFGLIGFVASSEKRQDVFTWLLAISGLS 461

Query: 501 QIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIA 560
           Q+F W+AICLSHIRFR AM  Q +S+ E+G+++Q G WGS  A  +   +L+ +FWV+IA
Sbjct: 462 QLFIWLAICLSHIRFRDAMKTQKKSMDEVGYKAQTGYWGSWVAVLIGLFSLVTQFWVAIA 521

Query: 561 PIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIF 614
           P+ ++  LD  SFF+NYLA PI++V YFG+K+Y  +W   I    IDL +HR I+
Sbjct: 522 PVDKNGKLDVMSFFQNYLAFPIVLVAYFGHKLYYGNWCPLIPLSKIDLDSHRKIY 576

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  442 bits (1136), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 222/498 (44%), Positives = 314/498 (63%), Gaps = 6/498 (1%)

Query: 120 SKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCI 179
           +  E+  L++SI+P HV M ++A          NG ++  AG  G ++GY I+G+ L C 
Sbjct: 63  TGSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCC 122

Query: 180 IQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYW 239
           +Q+ GE+ V++ +L G FN+Y    VD  FGF VAW++C+QW  V+PLELVTASMTI YW
Sbjct: 123 MQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYW 182

Query: 240 TTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXT 299
              +N                  GA+GYA+A+F FN  KVLMITGF IL          T
Sbjct: 183 NNSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGT 242

Query: 300 SGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS--NPRRAI 357
           SGYIG KY   PGAF    + + FK +           G  EF+A+ A+EQ+  N  ++I
Sbjct: 243 SGYIGIKYLKTPGAFN---TRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSI 299

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
             A   ++ R+   ++ SI ++G LVPY+S ELMGS S    +SPYV+A++SHGV+VVPH
Sbjct: 300 KRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPH 359

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
            INAVIL+AV+SV+NSA YSS R L +L++QG+AP +F  +D +GRP R +++S +FG++
Sbjct: 360 LINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLL 419

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           +F A    +E VF WLL+ISGLS IFTW  IC++H+RFR AM  Q  S+ ELG R+  G+
Sbjct: 420 SFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGI 479

Query: 538 WGSVYAATMLFLALIAEFWVSIAPI-GEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596
           +GS Y   +  L L+ +FWVS+ P+ G+   D  +FF+NY+A+P  +  Y G+KIY R W
Sbjct: 480 YGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSW 539

Query: 597 KLFIRAKNIDLITHRNIF 614
           +  I A  ID+ T R+I+
Sbjct: 540 QFIIPADKIDVDTSRDIY 557

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  439 bits (1129), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 236/606 (38%), Positives = 344/606 (56%), Gaps = 42/606 (6%)

Query: 46  GKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXS 105
           G S+ ++ S+   + A + +W +          F D FKR E                  
Sbjct: 23  GHSSYETGSSPGQTQASKSRWQD----------FKDGFKRVE------------------ 54

Query: 106 PLSAAIKEHDVAITSKEEDA------HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHK 159
                ++E D  +T  E+ A       L++ ++ RH+ M ++           +G AL  
Sbjct: 55  -----LEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRT 109

Query: 160 AGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCI 219
            GPAG++IG+ ++G  +YC++ + GE+AV++  + G F  Y T  VDE FGFA+ + Y +
Sbjct: 110 GGPAGVLIGWGLIGLMIYCVVMSMGELAVTFP-VSGGFTTYATRFVDESFGFAINYNYML 168

Query: 220 QWLCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCK 278
           QWL V+PLE+V AS+T+++W T     D                G +GY EA+F F+  K
Sbjct: 169 QWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIK 228

Query: 279 VLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXG 338
           V+ + GF IL            GYIG KYWH+PGAF GD +  RFK V            
Sbjct: 229 VITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFA 288

Query: 339 ASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGT 398
            +E + + ++E +NPR+A+P AAK + +RIL  ++ S+ L+G LVP+ S  L+G+ S   
Sbjct: 289 GTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDA 348

Query: 399 KASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYI 458
            ASP+VLAI +HG++ +P  IN VIL++VLSV NSA Y+  R + +L++QG  P  F YI
Sbjct: 349 AASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYI 408

Query: 459 DREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRA 518
           DR+GRP  A+I + +FG+++F A S KE +VF WLLA+SGLS +F+W AIC+ HIRFRRA
Sbjct: 409 DRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRA 468

Query: 519 MHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLA 578
           +  QGRS  EL F S  G+ GS +   ++ L LIA+FWV++ PIG    +A+ FF  YL+
Sbjct: 469 LSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSP-NAEDFFSAYLS 527

Query: 579 MPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKR 638
            P+L+ FY  +KI+ R+WKLF RAK+ID+ T R   D              L   P W R
Sbjct: 528 FPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPWWYR 587

Query: 639 LVHFWC 644
           L  FWC
Sbjct: 588 LYFFWC 593

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  435 bits (1118), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 230/568 (40%), Positives = 332/568 (58%), Gaps = 20/568 (3%)

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVL 137
           R  DSFKRAE+  EE                   +   +AI + +  A L+ +++ RH+ 
Sbjct: 63  RIKDSFKRAEK--EEVDPNLT-------------EAERIAINTAK--APLKHTLKGRHMQ 105

Query: 138 MSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNF 197
           M ++           + +AL  AGPAG+VIG+ +  T +YC++ A GE+AV +  + G F
Sbjct: 106 MVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFP-VSGGF 164

Query: 198 NAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXX 256
             Y T  +DE FGFA  + Y +QWL  +PLE+V+AS+T++YW T     D          
Sbjct: 165 TTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVI 224

Query: 257 XXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG 316
                 G +G+ EA+F F+T KVL + GF IL            G++G +YWH+PGAF G
Sbjct: 225 VIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAFVG 284

Query: 317 DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376
           D +  +FK V             SE + I A+E +NPR+++P AAK +++RI+  ++ S+
Sbjct: 285 DNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSL 344

Query: 377 ALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
            ++G LVPY    L+G+ S    ASP+V+AI +HG+R +P  IN VIL+AVLSV NSA +
Sbjct: 345 IMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIF 404

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           +  R + +LS+QG+ P+ F YIDR+GRP   +I+   FG+IAF A S K+ EVF WL+A+
Sbjct: 405 AGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMAL 464

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
           SGLS +FTW  ICL HIRFR A+  QGRS +EL F S  G+ GS +   ML L  IA+F+
Sbjct: 465 SGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFY 524

Query: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           V++ P G     A+ FFE+YL+ PI++ FYFG+KIY ++WKLFI+A+++D+ T R   D 
Sbjct: 525 VALFPPGSKP-SAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDL 583

Query: 617 XXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                        L     W R   FWC
Sbjct: 584 ELLKQEIEEEKAILATKGWWYRQYQFWC 611

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  429 bits (1103), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/496 (42%), Positives = 310/496 (62%), Gaps = 5/496 (1%)

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
            E A LR+SI+PRHV M S+A          NG ++  AG  G +IGY I+G  + C +Q
Sbjct: 20  SEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQ 79

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           + GE+ V++ +L G FN+Y    +D   GF V+W++C+QW+ V+PLELVTASMTI YW +
Sbjct: 80  SVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNS 139

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            ++                  G+ GYAEA+F FN  KV+++  F +L           SG
Sbjct: 140 NLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSG 199

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS--NPRRAIPS 359
            IG +Y   PGAF  + ++  FK             G  EF+A+ A+EQ+  N  ++I  
Sbjct: 200 PIGFQYLKTPGAFNTNYNV--FKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIRR 257

Query: 360 AAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFI 419
           A + +  R+   +L SI++VG LVPYDS  LMGSGS  T  SPYV AI+ HGVR+VPH I
Sbjct: 258 ACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHII 317

Query: 420 NAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAF 479
           NAVIL+AV+SV+NSA YSS R L SL++Q +AP++F  +++ G+P R +++S + G+I+F
Sbjct: 318 NAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISF 377

Query: 480 CACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWG 539
            A    +E VF WLL+ISGLS IFTW  IC++HIRFR A+ +QG+S+  LG+RS  GV G
Sbjct: 378 IAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIG 437

Query: 540 SVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKIYNRDWKL 598
           S  A  +  + +I +FWVS+ P+  +   DA  FF+NY+A+P+ ++ Y G+K+Y  DW  
Sbjct: 438 SYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTP 497

Query: 599 FIRAKNIDLITHRNIF 614
           +IR   +D+ T R+++
Sbjct: 498 WIRTHCVDINTDRDVY 513

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  428 bits (1100), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 256/654 (39%), Positives = 353/654 (53%), Gaps = 59/654 (9%)

Query: 1   MSSSN--NADKDDFID-NSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNED 57
           MSSS        D+ D  +N+  E  D          DLE+E+I        D      +
Sbjct: 1   MSSSEGFQMSNQDYKDAKTNINTEFIDP---------DLESESI--------DIKKETFN 43

Query: 58  LSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVA 117
            +  G +K    G K    ++FIDSFKR E                       + E D  
Sbjct: 44  YNQTGEEK----GSK---WRQFIDSFKRVE-----------------------VPELDPN 73

Query: 118 ITSKEE----DAH--LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           +T +E      AH  L+  ++ RH+ M ++           +G+AL  AGPA L+IG++I
Sbjct: 74  LTEQERIAIITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSI 133

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
            G+ +Y ++ A  EMAV Y  + G F  Y T  +DE FGFA  + Y +QWL V+PLE+V+
Sbjct: 134 TGSMIYSMVMAVAEMAVLYP-ISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVS 192

Query: 232 ASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
           AS+T++YW T     D                G KGY EA+F F+T KV+ + GF IL  
Sbjct: 193 ASITVNYWGTPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGL 252

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                   T GY+GAKYWHDPGAF G  +  +F+               SE I I  SE 
Sbjct: 253 VLVCGGGPTGGYVGAKYWHDPGAFVGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEA 312

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
            NPR+A+P AAK + +RIL  ++ S+  +G LVP + S L+GS +    ASP+V+AI+ H
Sbjct: 313 ENPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVH 372

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           G+R +P  IN VIL+AVLSV NSA Y+  R L +L++QG+ P+  +YIDR GRP   + I
Sbjct: 373 GIRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAI 432

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
           S  FG++AF A S KE +VF WLLAISGLS  FTW AICL HIRFR A+  Q RS  EL 
Sbjct: 433 SSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELP 492

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
           F S LGV+GS +   ++ L L A+F+V+I P+G D   A +FF  YL++P+++V Y  +K
Sbjct: 493 FVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVG-DTPSATNFFSAYLSLPVVLVMYIAHK 551

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           ++ ++WK+FI    +DL T R   D              L   P W R+  FWC
Sbjct: 552 LWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERATLAARPRWFRIYTFWC 605

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  427 bits (1099), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 221/569 (38%), Positives = 323/569 (56%), Gaps = 20/569 (3%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136
           + F+D FKR E G  +                   +   VAI +    + L++ ++ RH+
Sbjct: 47  QDFVDGFKRVELGDLDPN---------------LTQAEKVAIATAR--SPLQRHLKNRHL 89

Query: 137 LMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196
            M ++           +GSAL   GPA ++IG+ ++G  +Y ++ A GE+AV++  + G 
Sbjct: 90  QMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGELAVTFP-VAGG 148

Query: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXX 255
           F  Y    VD+ FGFA+ ++Y +QWL V+PLE+V AS+T++YW T     D         
Sbjct: 149 FTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDGFVALFYVV 208

Query: 256 XXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR 315
                  G KGY EA+F F+  KV  + GF IL            GY+G KYWH+PGAF 
Sbjct: 209 IVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGKYWHNPGAFN 268

Query: 316 GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSS 375
           GD +  RFK V             +E + + A+E  NPR+A+P AAK + +RI   ++ S
Sbjct: 269 GDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQVFWRITLFYIIS 328

Query: 376 IALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAF 435
           + L+G LVPY S  L+GS S    ASP+VLAI +HG+  +P  IN VIL++VLSV NS+ 
Sbjct: 329 LCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSVINVVILISVLSVGNSSV 388

Query: 436 YSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLA 495
           Y+  R L +L+ QG+ PQ F+YIDR+GRP   ++ +  FG++ F A S KE +VF WL+A
Sbjct: 389 YACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQSKKEGDVFNWLMA 448

Query: 496 ISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEF 555
           +SGLS +FTW  IC+ H+RFRRA+  QGRS  EL F S +GVWGS +   ++ L  IA+F
Sbjct: 449 LSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGVILICLVFIAQF 508

Query: 556 WVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
           W+++ P+G    +A  FF+ YL++ +++ FY  +K+Y R+W    RAK+ID+ T R   D
Sbjct: 509 WIAVWPMGGTP-NASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKDIDIDTGRRELD 567

Query: 616 AXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                         L   P W R+ H WC
Sbjct: 568 LDALKQEIAEEKLRLSTKPWWYRVYHLWC 596

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  424 bits (1090), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/505 (42%), Positives = 314/505 (62%), Gaps = 7/505 (1%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E    +  K+E   LR+SI+PRHV M S+A          NG ++  AG  G +IGY I+
Sbjct: 29  EAGAGVQGKKEV--LRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGII 86

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           G  L C +Q+ GE+ V++ +L G FN+Y    +D   GF+V+W++C+QW+ V+PLELVT 
Sbjct: 87  GVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTG 146

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
           SMTI YW   ++                  G+ GYAEA+F FN+ KV++I GF IL    
Sbjct: 147 SMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLI 206

Query: 293 XXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS- 351
                 TSG IG +Y  DPG F  + +I   K             G  EF+A+ A+EQ+ 
Sbjct: 207 DTGCVGTSGTIGFRYLIDPGMFNKNYNI--IKATAGTLVNAAFSCGGVEFLALSAAEQNR 264

Query: 352 -NPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
            N  ++I  A   +  RI   +L SI++VG LVP++S  LMGSGS    +SPYV A++ +
Sbjct: 265 DNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMN 324

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           G+ VVPH INAVIL+AV+SV+NSA YSS R L SL++Q +AP++F  +++ G+P R + I
Sbjct: 325 GITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFI 384

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
           S LFG+I+F A    +E +F WLL+ISGLS IFTW  IC++HIRFR A+  +G+S+  LG
Sbjct: 385 SALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLG 444

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGY 589
           ++S  GV GS  A  +  + L+ +FWVS+ P+  +   +   FF+NY+A+P+ ++FY G+
Sbjct: 445 YKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGH 504

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIF 614
           K+Y ++W L IRA N+D+ T R+I+
Sbjct: 505 KVYTKNWSLLIRASNVDITTDRDIY 529

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  423 bits (1087), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/606 (39%), Positives = 348/606 (57%), Gaps = 45/606 (7%)

Query: 46  GKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXS 105
           G+ T+  +SNE+ S     KW +          F +SFKR E                  
Sbjct: 26  GEFTNHEASNEESS---GSKWQD----------FKNSFKRME------------------ 54

Query: 106 PLSAAIKEHDVAITSKEE------DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHK 159
                + E D  +T  E+      ++ L++ ++ RH+ M ++           +G AL  
Sbjct: 55  -----VVELDPNLTEAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRT 109

Query: 160 AGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCI 219
           AGPAG++IG+A+ GT +YC++ A GE+AV++  + G F  Y T  +DE FG+A  + Y +
Sbjct: 110 AGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VSGGFTTYATRFIDESFGYANNFNYML 168

Query: 220 QWLCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCK 278
           QWL V+PLE+V AS+T++YW T     D                G KGY EA+F F+  K
Sbjct: 169 QWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIK 228

Query: 279 VLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXG 338
           V+ + GF IL            GYIG   WH+PGAF G+ +  RFK V            
Sbjct: 229 VITVIGFIILGIILVCGGGPVGGYIGGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFA 288

Query: 339 ASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGT 398
            SE + + ++E +NPR+++P AAK + +RI   ++ S+ L+G LVPY+ + L+G+ S   
Sbjct: 289 GSELVGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDA 348

Query: 399 KASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYI 458
            ASP+VLAI +HG++ +P  +N VIL+AVLSV NSA +   R L +L++QG+ P+ F YI
Sbjct: 349 AASPFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYI 408

Query: 459 DREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRA 518
           DR+GRP   +  +  FG+++F A S KE EVF WLLA+SGLS +FTWMAIC+ H+RFRRA
Sbjct: 409 DRKGRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRA 468

Query: 519 MHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLA 578
           +  QGRS  EL F S  GVWGS+Y   ++ L L A+FW+++ PIG    DAK FFE+YL+
Sbjct: 469 LSAQGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPP-DAKDFFESYLS 527

Query: 579 MPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKR 638
           +P+++V Y G+K Y R+WKLFIRA+NID+ T R   D              L +   W R
Sbjct: 528 LPVVLVMYIGHKCYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIR 587

Query: 639 LVHFWC 644
             +FWC
Sbjct: 588 SYYFWC 593

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  423 bits (1087), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 236/639 (36%), Positives = 348/639 (54%), Gaps = 50/639 (7%)

Query: 16  SNVEYELKD--ASKLR-RRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVK 72
           S+ EY  KD  A  ++ + +  D+E     E++    D+                E G  
Sbjct: 2   SDKEYTTKDVEAGNVQVKETLPDVETGASYEHYDNYIDEE---------------EQGPP 46

Query: 73  EPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDA------H 126
           +   K+  DSFKRAE                       + E D  +T  E+ A       
Sbjct: 47  DSRWKKIKDSFKRAE-----------------------VPELDPNLTEAEKIAIATARSP 83

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
           L+  ++ RH+ M S+           +G+AL  AGPAG++IG+ I G+ +YC++ +  E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYW-TTKVNN 245
           A+++  + G F  Y T  +DE +GFA  + Y +QW+  +PLE+V AS+T++YW T K   
Sbjct: 144 AIAFP-VAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYR 202

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
           D                G +GY EA+F F+ CK+LMI GF IL           +GYIGA
Sbjct: 203 DGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGA 262

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           +YW+ PGAF GD S  +FK               SE + + A+E SNPR+ +P AAK + 
Sbjct: 263 RYWYHPGAFAGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVF 322

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           +RI   ++  + L+G LVPY    L+G  S    ASP+V+AI + G+  +P  +N VIL+
Sbjct: 323 WRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNVVILI 382

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           AVLSV NSA Y+  R L +L+ QG+ P+ F+YIDR GRP   + ++  FG+IAF A S K
Sbjct: 383 AVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDK 442

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
           E EVF WL+A+SGLS +FTW  ICL HIRFRRA+  QGRS +EL F S  GVWG+ +   
Sbjct: 443 EGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLF 502

Query: 546 MLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNI 605
           +  + L A+F+V++ P+G     A  FF+ YL++PI++  + G+KI+ ++WKLFI+A+++
Sbjct: 503 LCIIMLAAQFYVALFPLGAPP-SANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDM 561

Query: 606 DLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           D+ T R   D              L   P W R+  F+C
Sbjct: 562 DIDTGRRELDLDLLRQQVEEERAALAAKPMWYRIYKFFC 600

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  416 bits (1068), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 206/535 (38%), Positives = 310/535 (57%), Gaps = 2/535 (0%)

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
           + + +  +     D+ L K +  RH+L  ++           +G++L+  GPA L++ + 
Sbjct: 72  VSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWV 131

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
           I+ TCL+ I+ A GE+A  +  + G FN Y T  V+  FGFAV   Y  QW  ++PLELV
Sbjct: 132 IVSTCLFTIVNALGELAAVFP-VVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELV 190

Query: 231 TASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
            AS+TI YW   +N+D                  K + E +F  +  K+L I GF IL  
Sbjct: 191 AASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGI 250

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                   +  YIG +YW+DPGAF GD    RFK V             +E +A+ A+E 
Sbjct: 251 VLACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAES 310

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISS 409
            NPR  +P A+K   + I   +++ + ++G LVPY+   L+ G+ S    ASP V+AI +
Sbjct: 311 HNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIEN 370

Query: 410 HGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMI 469
            G++ +P  +NA+IL+A+LSV+NSA Y+  R + ++++ G  P+  NYID+ GRP  A+ 
Sbjct: 371 GGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIF 430

Query: 470 ISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISEL 529
            +++FG+++F A S K+EEVFTWL A+SGLS +F W +I LSHIRFR+AM  Q RS++EL
Sbjct: 431 ATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNEL 490

Query: 530 GFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGY 589
            F S  GV+GS Y   ++FL LIA FW S+ P+G D  DA+SFFE YL++PI IV Y G+
Sbjct: 491 PFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGH 550

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           K+Y +DW+L+++ K++DL T R   D              +   P + R ++ WC
Sbjct: 551 KVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQMAQKPFYIRFLNVWC 605

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  412 bits (1059), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 207/503 (41%), Positives = 307/503 (61%), Gaps = 9/503 (1%)

Query: 115 DVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGT 174
           DV +   E    L++SI+P HV M S A          NG ++  AG  G ++GY I+G 
Sbjct: 29  DVTLPKNE----LKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGI 84

Query: 175 CLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASM 234
            L C +Q  GE+ V++ ++PG F +Y    +D   GF ++W++ + W  V+PLE+  ASM
Sbjct: 85  MLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASM 144

Query: 235 TIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXX 294
           TI++W   +N                  GA+ YA+AD  FN  KVLMI GF IL      
Sbjct: 145 TINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIFVNT 204

Query: 295 XXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPR 354
               TSGY+G KY+H PG FR D  +  FK +           G +EF+A+  +EQ+   
Sbjct: 205 GVVGTSGYLGFKYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQNTED 262

Query: 355 --RAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGV 412
             R+I  A+  ++ RI  IF  S+ ++G LVP++S  LMGSGS  T ASPYV+A++++GV
Sbjct: 263 MPRSIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGV 322

Query: 413 RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISI 472
           R++PH +NA+ILL+++SV+N+A YSS R L SL++QG+A ++F  +D  G+P R + +S 
Sbjct: 323 RIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSA 382

Query: 473 LFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFR 532
             G+ +F A    +E VF WLL+ISGLS IFTW   C+SH+RFR+AM  Q +++ +LG++
Sbjct: 383 FTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQ 442

Query: 533 SQLGVWGSVYAATMLFLALIAEFWVSIAPIGED-HLDAKSFFENYLAMPILIVFYFGYKI 591
           S  GV+GS  +  +  + LI +FWVS+ P+  +  L+  SF +NY+A+PI IV Y G+K 
Sbjct: 443 SPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKA 502

Query: 592 YNRDWKLFIRAKNIDLITHRNIF 614
           Y  +WK FIRA  ID+ T R+I+
Sbjct: 503 YTGNWKPFIRAPEIDIQTDRDIY 525

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  412 bits (1060), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/597 (39%), Positives = 336/597 (56%), Gaps = 25/597 (4%)

Query: 50  DQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSA 109
            Q   + DLS  G     E   K     RF+DSF R  E  E   +M             
Sbjct: 25  SQEPLSHDLSSTGS----EEHKKGKVWTRFVDSF-RERERLEVDPNM------------- 66

Query: 110 AIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGY 169
              E D  I  +  ++ L+  ++ RH+ M ++           +G+AL  AGPAG++IG+
Sbjct: 67  --SELD-QIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 123

Query: 170 AIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLEL 229
            + GT +Y ++ A GE+AV +  + G F  Y T  +DE +GFA    Y +QWL V+PLE+
Sbjct: 124 GLTGTMIYSMVMALGELAVLFP-VSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEI 182

Query: 230 VTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
           V AS+T++YW T     D                G KGY EA+F F+  KV+ + GF IL
Sbjct: 183 VAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIIL 242

Query: 289 XXXXXXXXXXTSGYIGAKYWHDP-GAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGA 347
                       GYIG +YWH P GAF GD +  RFK V             SE + + +
Sbjct: 243 GIILNCGGGPVKGYIGGRYWHHPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLAS 302

Query: 348 SEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAI 407
           +E +NPR+++P AAK + +RI   +L ++ +VG LVPY    L+G+ S    ASP+V+AI
Sbjct: 303 AETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAI 362

Query: 408 SSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARA 467
           ++HG+R +P  +N VIL+AVLSV NSA Y+  R L +L++Q + P++F YIDR GRP  +
Sbjct: 363 TTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYS 422

Query: 468 MIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSIS 527
           ++++  FG++AF A S KE EVF WLLA+SGLS +FTW  ICL HIRFR+A+  QGR   
Sbjct: 423 ILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTD 482

Query: 528 ELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYF 587
           EL F S  GV+GS +   M+ L  IA+F+V++ P G    +AK+FFE YL+ PI+I  Y 
Sbjct: 483 ELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKP-NAKAFFEAYLSFPIVIACYL 541

Query: 588 GYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           G+KIY ++WK+FI+A+++D+ T R   D              L   P W R   FWC
Sbjct: 542 GHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLATKPWWYRWWVFWC 598

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  412 bits (1058), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 237/620 (38%), Positives = 347/620 (55%), Gaps = 44/620 (7%)

Query: 36  LENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEP----HLKRFIDSFKRAEEGTE 91
           +  E  ++Y   S DQ +  E   +  +  +       P      +RF DSFKRA+    
Sbjct: 1   MSQEKKLDY---SIDQETQLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADT--- 54

Query: 92  ETKHMXXXXXXXXSPLSAAIKEHDVAITSKEE------DAHLRKSIQPRHVLMSSLAXXX 145
                               ++ D  +T  E+      +A L+++++ RH+ M ++    
Sbjct: 55  --------------------QDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAI 94

Query: 146 XXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLV 205
                  +G AL  AGPAG++IG+A+ GT +YC++ A GE+AV++  + G F  Y +  V
Sbjct: 95  GTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFTTYASRFV 153

Query: 206 DEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGA 264
           DE FGFA   +Y +QWL V+PLE+V AS+T++YW T     D                G 
Sbjct: 154 DESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGV 213

Query: 265 KGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFK 324
           KGY EA+F F+  KV+ + G+ IL            GYIG + WH+PGAF      + FK
Sbjct: 214 KGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFA-----NGFK 268

Query: 325 DVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVP 384
            V             SE + + A+E +NPR+++PSAAK + +RI   ++ ++ +VG LVP
Sbjct: 269 GVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVP 328

Query: 385 YDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFS 444
           Y S  L+G  S    ASP+V++I + G++ +P  IN VIL+AVLSV NSA ++  R + +
Sbjct: 329 YTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAA 388

Query: 445 LSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFT 504
           L+ QG  P+ F YIDR GRP   +I++ +FG+++F A S KE EVF WLLA+SGLS +FT
Sbjct: 389 LANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFT 448

Query: 505 WMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGE 564
           W  I L HIR RRA+  Q R+ +EL F +  GVWGSVY   ++ L L+A+FW+++ PIG 
Sbjct: 449 WGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIG- 507

Query: 565 DHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXX 624
           D   A +FFE YL+ PILI FY G+KI+ ++WKLFIRAKNID+ T R   D         
Sbjct: 508 DKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIA 567

Query: 625 XXXXXLKNGPTWKRLVHFWC 644
                + + P + R+  FWC
Sbjct: 568 EEKAFIASKPFYYRMYKFWC 587

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  409 bits (1051), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 212/527 (40%), Positives = 308/527 (58%), Gaps = 5/527 (0%)

Query: 122 EEDAH---LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
           +ED H   + + +  RH++  ++           +G++L+  GPA LVIG+ I+ T L+ 
Sbjct: 78  KEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFT 137

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           +I + GE+A +Y  + G FN Y T  VD  F F+V   Y +QWL ++PLELV AS+TI Y
Sbjct: 138 VINSLGELAAAYP-VVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRY 196

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           W   +N+D                  K + E +F  +  K+L I GFFIL          
Sbjct: 197 WDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGP 256

Query: 299 TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
             GYIG KYWHDPGAF GD +  +FK +              E IA+ A+E  NPR+ IP
Sbjct: 257 KGGYIGGKYWHDPGAFVGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIP 316

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPH 417
           +AAK   + I F +++ + LVG LV Y+ + L+ GS S    ASP V+AI + G++ +P 
Sbjct: 317 TAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLPS 376

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
            +NA+IL+A+LSV+NSA Y+  R + S++  G  P+  + +D+ GRP RA+  ++ FG++
Sbjct: 377 LMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLL 436

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           +F A S K+EEVFTWL A+SGLS IF WM I ++HIRFR+AM VQ RS+ E+ + SQ G+
Sbjct: 437 SFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGI 496

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           +GS Y   +LFL LIA FW S+ P+G D  DA++FFE YL+ PILI  Y G+K+Y ++W+
Sbjct: 497 YGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWR 556

Query: 598 LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +    + IDL+T R   D              L+     KR +  WC
Sbjct: 557 IMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQSSFMKRFLLIWC 603

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  409 bits (1050), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 242/639 (37%), Positives = 343/639 (53%), Gaps = 45/639 (7%)

Query: 15  NSNVEYELKDASKLRRRSF--NDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVK 72
           +S  EY L+D SK +  +   +D   ++IV    +S D    + + + + R  W      
Sbjct: 2   SSPEEYNLEDRSKEKNITIIRDDFSGQDIVSESLESFDNQIDSSNYA-SHRSAW------ 54

Query: 73  EPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDA------H 126
                 F+DSFKR E                       ++E D  +T  E+ A       
Sbjct: 55  ----GNFLDSFKRVE-----------------------VEEVDPNLTDLEKIAIKTARSP 87

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
           L+  ++ RH+ M ++           +G AL  AGPAG++IG++I GT ++ ++ A GE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-N 245
           AV +  + G F  Y T  +DE FGFA  + Y +QWL V+PLE+V AS+T+ YW T V   
Sbjct: 148 AVMFP-VSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYT 206

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
           D                G +GY EA+F F+  KV  + GF IL            GY+GA
Sbjct: 207 DGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGA 266

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           +YWH+PGAF G  S  +F                SE I +  SE  NPR+A+PSAAK + 
Sbjct: 267 RYWHNPGAFVGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVF 326

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           +RIL  ++  + L+GFLVPY+   L+ S S    ASP+V+AI +HG+  +P  IN VIL+
Sbjct: 327 WRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILI 386

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           +VLSV NSA YS  R L +LS+QG+ P+  +YIDR+GRP   + IS  FG+IAF A S+K
Sbjct: 387 SVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNK 446

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
           + E+F WLLAISGLS  FTW AIC+ HIRFR A+  QGR   EL F S  GV GS +   
Sbjct: 447 QNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLF 506

Query: 546 MLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNI 605
           +  L LIA+F++++ PIG     A  FF  YLA P+++ FY  +K++ ++WK  I  +++
Sbjct: 507 LNILMLIAQFYIALFPIGGSP-SAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDV 565

Query: 606 DLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           D+ T R   D              L   P W R+  FWC
Sbjct: 566 DIDTGRRDTDVNLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  408 bits (1048), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/568 (39%), Positives = 312/568 (54%), Gaps = 20/568 (3%)

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVL 137
           RF +SFKRAEE                  L   + E +  I  K   + L+  ++ RH+ 
Sbjct: 47  RFKESFKRAEE----------------MELDPNLTEAE-RIAIKTAQSPLKHHLKNRHLQ 89

Query: 138 MSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNF 197
           M ++           +G+AL  AGPAG++IG+ + GT +Y ++ A GE+AV +  + G F
Sbjct: 90  MIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFP-VAGGF 148

Query: 198 NAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXX 256
             Y T  VDE FGFA  ++Y +QWL V+PLE+V AS+T++YW T     D          
Sbjct: 149 TTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVI 208

Query: 257 XXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG 316
                 G KGY EA+F F+  KV+ + GF I+             YIGA+YW++PGAF G
Sbjct: 209 VIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAFVG 268

Query: 317 DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376
           D +  +F+               SE + +  SE   PR+++P AAK + +RI   ++  +
Sbjct: 269 DTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCL 328

Query: 377 ALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
            L+G LVP DS  L+G+ S    ASP+V+AI +HG++ +P  +N VIL+AVLSV NSA Y
Sbjct: 329 LLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIY 388

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           S  R L +L+ QG+ P    YIDR GRP   + IS  FG+IAF A S KE +VF WL+A+
Sbjct: 389 SCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMAL 448

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
           SGLS +FTW  ICL HIR+R A+  QGRS  EL F++  GVWGS +   M  L  IA+F+
Sbjct: 449 SGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFY 508

Query: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           V + P G    +A  FF  YL+  I I  Y  +KI+ R+WKLFI  K++D+ T R   D 
Sbjct: 509 VGLFPPGTKP-NAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVDL 567

Query: 617 XXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                        L   P W R   FWC
Sbjct: 568 DVLREELAEERAALAARPFWYRSWKFWC 595

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  408 bits (1048), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/534 (40%), Positives = 317/534 (59%), Gaps = 5/534 (0%)

Query: 112 KEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           +   VAI + +    L+  ++ RH+ M ++           +G+AL   GPA L+IG+  
Sbjct: 73  EAEKVAIITAQTP--LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGS 130

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
            GT +Y ++ A GE+AV +  + G F  Y T  +DE FG+A  + Y +QWL V+PLE+V+
Sbjct: 131 TGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 232 ASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
           AS+T+++W T     D                G KGY EA+F F+  KV+ + GF IL  
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                   T GYIG KYWHDPGAF GD    +FK V             SE + + ASE 
Sbjct: 250 ILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASES 309

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
             PR+++P AAK + +RI   ++ S+ ++G LVPY+   L+G+ S    ASP+V+AI +H
Sbjct: 310 VEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTH 369

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           G++ +P  +N VIL+AVLSV NSA Y+  R + +L++Q + P+ F+Y+DR+GRP   + +
Sbjct: 370 GIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAV 429

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
           +  FG+IAF A S KE EVF WLLA+SGLS +FTW  IC+ HIRFR+A+  QGR + EL 
Sbjct: 430 TSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELS 489

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
           F+S  GVWGS +   M+ +  IA+F+V++ P+G D   A+ FFE YL+ P+++V Y G+K
Sbjct: 490 FKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVG-DSPSAEGFFEAYLSFPLVMVMYIGHK 548

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           IY R+WKLFI A+ +D+ T R   D              +   P W R+ +FWC
Sbjct: 549 IYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNFWC 602

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  407 bits (1046), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 222/544 (40%), Positives = 316/544 (58%), Gaps = 7/544 (1%)

Query: 106 PLSAAIKEHDVA----ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAG 161
           PL  A+   D++    I  +   A L+  ++ RH+ M ++           +G+AL  AG
Sbjct: 56  PLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAG 115

Query: 162 PAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQW 221
           PAG++IG+ + GT +YC++ A GE++V +  + G F  Y T  +DE FGFA  + Y +QW
Sbjct: 116 PAGILIGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGFANNFNYMLQW 174

Query: 222 LCVMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVL 280
           LCV+PLE+V AS+T++YW T     D                G KGY EA+F F+  KVL
Sbjct: 175 LCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVL 234

Query: 281 MITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGAS 340
            + GF I+            GYIG KY+HDPGAF GD +  RF+ V             S
Sbjct: 235 TVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFVTAAFSFAGS 294

Query: 341 EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA 400
           E I I A+E + PR+++P AAK + +RI   ++ S+ +VG LVPY    L+G+ S    A
Sbjct: 295 ELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAA 354

Query: 401 SPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDR 460
           SP+V+AI+SHG+R +P  +N VIL+AVLSV NSA Y   R L +L+QQ + P+ F YIDR
Sbjct: 355 SPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDR 414

Query: 461 EGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMH 520
            GRP   +  +  FG++AF A S KE EVF WLLA+SGLS +FTW  IC  HIRFR A+ 
Sbjct: 415 SGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALT 474

Query: 521 VQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMP 580
            QGRS  EL F++  G++GS++   M+ L  +A+F+V++ P G     A+ FF++YL+ P
Sbjct: 475 AQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKP-SAEVFFQSYLSFP 533

Query: 581 ILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLV 640
           +++ FYFG+K+Y R+WKL I    +D+ T R   D              +   P W R  
Sbjct: 534 VVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRWY 593

Query: 641 HFWC 644
            FWC
Sbjct: 594 SFWC 597

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  405 bits (1041), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/538 (40%), Positives = 305/538 (56%), Gaps = 8/538 (1%)

Query: 108 SAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVI 167
           S  I++ D+       + +L K +  RH+L  ++            G+AL   GPA LVI
Sbjct: 73  SEGIEQEDI------NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVI 126

Query: 168 GYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPL 227
            + I+ TCL+ +I + GE++ ++  + G FN Y    V+  F FAV   Y  QWL ++PL
Sbjct: 127 DWVIISTCLFTVINSLGELSAAFP-VVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPL 185

Query: 228 ELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFI 287
           ELV AS+TI YW  K+N+D                  K + E +F  +  K+L I GF I
Sbjct: 186 ELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTI 245

Query: 288 LXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGA 347
           L            GYIG KYWHDPGAF G  S  +FK +              E  A+ A
Sbjct: 246 LGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSA 305

Query: 348 SEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLA 406
           +E  NPR  IP AAK   + I   +++ + L+G LVP +   L+ GS S    +SP V+A
Sbjct: 306 AESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIA 365

Query: 407 ISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPAR 466
           I + G++ +P  +NA+IL+AV+SV+NSA Y+  R + +++  G  P++ N +D+ GRP  
Sbjct: 366 IENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMN 425

Query: 467 AMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSI 526
           A+++++ FG+++F A S K+ EVFTWL A+SGLS IF WMAI LSHIRFR+AM VQ RS+
Sbjct: 426 AILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSL 485

Query: 527 SELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFY 586
            EL F SQ GV GS Y   +LFL LIA FW S+ P+G    +A+SFFE YL+ PILIV Y
Sbjct: 486 DELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCY 545

Query: 587 FGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           FG+KIY R+W L ++ ++IDL T R   D              L       R +HFWC
Sbjct: 546 FGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFWC 603

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  404 bits (1039), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 216/539 (40%), Positives = 316/539 (58%), Gaps = 9/539 (1%)

Query: 113 EHDVAITSKEEDAH------LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLV 166
           E D  +T  E+ A       L+  ++ RH+ M ++           +G+AL   GPA L+
Sbjct: 66  EVDPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLL 125

Query: 167 IGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMP 226
           IG+   GT +Y ++ A GE+AV +  + G F  Y T  +DE FG+A  + Y +QWL V+P
Sbjct: 126 IGWGSTGTMIYSMVMALGELAVIFP-ISGGFTTYATRFIDESFGYANNFNYMLQWLVVLP 184

Query: 227 LELVTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGF 285
           LE+V+AS+T+++W T     D                G KGY EA+F F+  KV+ + GF
Sbjct: 185 LEIVSASITVNFWGTDPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGF 244

Query: 286 FILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAI 345
            IL            GYIG KYWHDPGAF GD    +FK +             SE + +
Sbjct: 245 IILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPGAKFKGLCSVFVTSAFSFAGSELVGL 304

Query: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVL 405
            ASE  +PR+++P AAK + +RI   ++ S+ +VG LVPY+   L+G+ S    ASP+V+
Sbjct: 305 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVI 364

Query: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465
           AI +HG++ +P  +N VIL+AVLSV NSA Y+  R + +L++Q + PQ F Y+DR+GRP 
Sbjct: 365 AIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPL 424

Query: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525
             + ++  FG+IAF A S KE +VF WLLA+SGLS +FTW  IC+ HIRFR+A+  QGR 
Sbjct: 425 VGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRD 484

Query: 526 ISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585
           + EL F+S  GVWGS +   M+ +  IA+F+V++ P+G     A+ FFE YL+ P+++  
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASP-SAEGFFEAYLSFPLVVAM 543

Query: 586 YFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           Y G+KIY R+WKLFI A+++D+ T R   D              +   P W R+ +FWC
Sbjct: 544 YLGHKIYKRNWKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWNFWC 602

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  404 bits (1039), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/575 (39%), Positives = 324/575 (56%), Gaps = 32/575 (5%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAH------LRKS 130
           K F DSFKR E                  P+     E D  +T  E+ A       L+  
Sbjct: 52  KDFRDSFKRVE------------------PV-----EVDPNLTEAEKVAFITAQTPLKHQ 88

Query: 131 IQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSY 190
           ++ RH+ M ++           +G AL   GPA L+IG+  MGT +Y ++ A GE+AV +
Sbjct: 89  LKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGELAVVF 148

Query: 191 SNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-NDXXX 249
             + G F  Y T  +DE FGFA  + Y +QWL  +PLE+V+AS+T++YW T     D   
Sbjct: 149 P-ISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRDGFV 207

Query: 250 XXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWH 309
                        G KGY EA+F F+  KV+ I GF IL            GYIG KY+H
Sbjct: 208 ALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGKYFH 267

Query: 310 DPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRIL 369
           DPGAF GD    +FK V             SE + + ASE  +PR+++P AAK + +RI 
Sbjct: 268 DPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRIT 327

Query: 370 FIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLS 429
             ++ S+ ++G LVPY+ S L+G+ S    ASP+V+AI +HG++ +P  +N VIL+AVLS
Sbjct: 328 LFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLS 387

Query: 430 VSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEV 489
           V NSA ++  R   +L++QG+ PQ F Y+DR+GRP   +II+   G+IAF A S+KEE+V
Sbjct: 388 VGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDV 447

Query: 490 FTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFL 549
           F WLLA+SGLS +FTW  IC+ HIRFR+A+  QGRS+ EL F+S  GVWGS +   M+ +
Sbjct: 448 FNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVI 507

Query: 550 ALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLIT 609
             IA+F+V++ P+      A+ FFE YL+ P+++  Y G+KIY R+WKL I A  +D+ +
Sbjct: 508 MFIAQFYVALFPV-NGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDS 566

Query: 610 HRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            R   D              L   P W R+  FWC
Sbjct: 567 GRREVDLELLKQEIAEEKAILATKPAWFRVYSFWC 601

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  403 bits (1036), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 238/637 (37%), Positives = 346/637 (54%), Gaps = 44/637 (6%)

Query: 24  DASKLRRRSFNDLENENIVEYFGKSTDQSSS----NEDLSYAGRKKWYELGVKEPHL--- 76
           + +KL   SFN+++ +         TDQ  +    + DL+    +      +  P     
Sbjct: 11  NITKLTMSSFNNMQEK---------TDQKETYIVGSSDLTQENIQSSITHTISNPSFTST 61

Query: 77  --------KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLR 128
                   ++F DSFK+AE+                  L   + E +  I      A L+
Sbjct: 62  TQPSTTRWQKFKDSFKKAED----------------VELDPNLTEAE-RIAQATAKAPLQ 104

Query: 129 KSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAV 188
            +++ R   M ++           + +AL   GPAGL+IG+ +  T +Y ++ A GE+AV
Sbjct: 105 HTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAV 164

Query: 189 SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-NDX 247
            +  + G F  Y T  VDE FG+A  + Y +QWL V+PLE+V+AS+T++YW T     D 
Sbjct: 165 VFP-VAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDG 223

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKY 307
                          G KG+ EA+F F+  KV  + GF IL            G++GAKY
Sbjct: 224 FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKY 283

Query: 308 WHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYR 367
           WHDPGAF G  S  +FK V             SE I I A+E +NPR++IP AAK +++R
Sbjct: 284 WHDPGAFVGHGSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWR 343

Query: 368 ILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAV 427
           I+  ++ ++ ++G LVPY+   L+G+ S    ASP+V+AI +HG++ +P  IN VIL+AV
Sbjct: 344 IVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAV 403

Query: 428 LSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEE 487
           LSV NSA ++  R + +LS QG+ P+ F YIDR GRP   + I+  FG++AF A S KE 
Sbjct: 404 LSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEG 463

Query: 488 EVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATML 547
           EVF WLLA+SGLS +FTW  ICL HIRFR A+  QGR  +EL F S  GV GS +   M+
Sbjct: 464 EVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMI 523

Query: 548 FLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDL 607
            L  IA+F+V++ P G    DA+ FF++YL+ PI++  YFG+KIY R+WKLFI  +++D+
Sbjct: 524 VLMFIAQFYVALFPPGGKP-DAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDI 582

Query: 608 ITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            T R   D              L + P + R   FWC
Sbjct: 583 DTGRRETDMELLKQEIMEEKAILASKPWYIRAYAFWC 619

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  402 bits (1034), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 207/523 (39%), Positives = 300/523 (57%), Gaps = 2/523 (0%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            + +L K +  RH+L  ++           +G++L   GPA LVIG+ I+ TCL+ +I +
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+A ++  + G FN Y T  ++  F FA+   Y  QWL ++PLELV AS+TI YW  K
Sbjct: 144 LGELAAAFP-VVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK 202

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           +N+D                  K + E +F  +  K+L I GF IL            GY
Sbjct: 203 INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGY 262

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYWH+PGAF G  +  +FK +              E  A+ A+E  NP+  IP AAK
Sbjct: 263 IGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAK 322

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINA 421
              + I   ++  + L+G LVPY+   L+ GS S    ASP V+AI + G++ +P  +NA
Sbjct: 323 RTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNA 382

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           +IL+A++SV+NSA Y+  R + S++  G  P++ + +D+ GRP  A+++++ FG+++F A
Sbjct: 383 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIA 442

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            S K+EEVFTWL A+SGLS IF WMAI LS IRFR AM  QGRS+ E+ F SQ G WG+ 
Sbjct: 443 ASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAW 502

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIR 601
           Y   +LFL L+A FW S+ P+G     AKSFFE YL++PILI  Y G+K++ RDW+L + 
Sbjct: 503 YGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVP 562

Query: 602 AKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
              +DL + R + DA             L N   + R +H WC
Sbjct: 563 LMEMDLDSGRRVLDAETREEELRVEREYLANASFFTRFLHIWC 605

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  401 bits (1031), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/600 (38%), Positives = 321/600 (53%), Gaps = 28/600 (4%)

Query: 71  VKEPHLKRFIDSFKRAEE------------GTEETKHMXXXXXXXXSPLSAAIKEHDVAI 118
           +K+ +    +D FK A              GTE+ K          +  S  +K+    I
Sbjct: 6   LKKEYWADVVDGFKPAPSPGFENEKDCSAFGTEQ-KSQTDSTFPLSTKGSPGMKQTTNDI 64

Query: 119 TSKEE-------------DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGL 165
           TS E              + +L K +  RH+L  ++            G+AL   GPA L
Sbjct: 65  TSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASL 124

Query: 166 VIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVM 225
           VI + I+GTCL+ +I + GE++ ++  + G FN Y    V+  F FAV   Y  QWL ++
Sbjct: 125 VIDWVIIGTCLFTVINSLGELSAAFP-VVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLL 183

Query: 226 PLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGF 285
           PLELV AS+TI YW  K+N+D                  K + E +F  +  K+L I GF
Sbjct: 184 PLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGF 243

Query: 286 FILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAI 345
            IL            GYIG KYW +PGAF G  S  +FK +              E  A+
Sbjct: 244 SILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAV 303

Query: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYV 404
            A+E  NPR  IP AAK   + I   +++ + L+G LVP +   L+ GS S    +SP V
Sbjct: 304 SAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLV 363

Query: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464
           +AI +  ++ +P  +NA+IL+AV+SV+NSA Y+  R + +++  G  P++ N +D+ GRP
Sbjct: 364 IAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRP 423

Query: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524
             A+++++ FG+++F A S+KE EVFTWL A+SGLS IF WMAI LSHIRFR+AM VQ R
Sbjct: 424 MNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQER 483

Query: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIV 584
           S+ EL F SQ GV GS Y   +LFL LIA FW S+ PIG     A+SFFE YL+ PILIV
Sbjct: 484 SLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIV 543

Query: 585 FYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            YFG+KIY R+W L ++ ++IDL T R   D              L       R +HFWC
Sbjct: 544 CYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKKSFITRFLHFWC 603

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  400 bits (1027), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/528 (40%), Positives = 300/528 (56%), Gaps = 5/528 (0%)

Query: 121 KEED---AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
           ++ED    +L K +  RH+L  ++            G+AL   GPA LVI + I+ TCL+
Sbjct: 77  QQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLF 136

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
            +I + GE++ ++  + G FN Y    V+  F FAV   Y  QWL ++PLELV AS+TI 
Sbjct: 137 TVINSLGELSAAFP-VVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 238 YWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX 297
           YW  K+N+D                  K + E +F  +  K+L I GF IL         
Sbjct: 196 YWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGG 255

Query: 298 XTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
              GYIG KYW+DPGAF G  S  +FK +              E  A+ A+E  NPR  I
Sbjct: 256 PHGGYIGGKYWNDPGAFVGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVP 416
           P AAK   + I   +++ + L+G LVP +   L+ GS S    +SP V+AI +  ++ +P
Sbjct: 316 PKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLP 375

Query: 417 HFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGI 476
             +NA+IL+AV+SV+NSA Y+  R + +++  G  P++   +D+ GRP  A+++++ FG+
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGL 435

Query: 477 IAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLG 536
           ++F A S K+ EVFTWL A+SGLS IF WMAI LSHIRFR+AM  Q RS+ EL F SQ G
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTG 495

Query: 537 VWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596
           VWGS+Y   +LFL LIA FW S+ PIG    +A+SFFE YL+ PILIV YFG+KIY RDW
Sbjct: 496 VWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDW 555

Query: 597 KLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +L ++ +++DL T R   D              L       R +  WC
Sbjct: 556 RLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRFLRVWC 603

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  397 bits (1019), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 202/495 (40%), Positives = 303/495 (61%), Gaps = 3/495 (0%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            + +L K++  RH++  ++           +G+AL   GPA LV+G+ I+ TCL+ +I +
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+A ++  + G FN Y T  VD   GFAV   Y  QWL ++PLELV AS+TI YW  K
Sbjct: 99  LGELAAAFP-IVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           +N+D                  K + E +F  +  K+L I GF IL          + GY
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           +G KYW++PGAF G  +  +FK +              E IA+ A+E  NPR+ IP AAK
Sbjct: 218 LGFKYWNNPGAFVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAK 277

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSG-GTKASPYVLAISSHGVRVVPHFINA 421
              + +   ++  + LVG LVPY+ S L+ + +     ASP V+AI + G++ +P  +NA
Sbjct: 278 RTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNA 337

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           +IL+A++SV+NSA Y+  R + S++  G  P+  + +D++GRP  A+I++++FG+++F A
Sbjct: 338 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIA 397

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            S K+ EVFTWL A+SGLS IF WMAI  S IRFRRAM VQ RS+ EL + SQ G+WG+ 
Sbjct: 398 ASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAW 457

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIY-NRDWKLFI 600
           Y   +LFL ++A FW S+ P+G  H DA+SFFE++L++PIL+V YFG+K+Y  R+W+L I
Sbjct: 458 YGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQI 517

Query: 601 RAKNIDLITHRNIFD 615
            A+ +D+ + R I D
Sbjct: 518 GAEEMDIDSGRKIID 532

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  397 bits (1019), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/529 (40%), Positives = 301/529 (56%), Gaps = 5/529 (0%)

Query: 120 SKEED---AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCL 176
           +++ED    +L K +  RH+L  ++            G+AL   GPA LVI + I+ TCL
Sbjct: 76  TEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCL 135

Query: 177 YCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTI 236
           + +I + GE++ ++  + G FN Y    ++  F FAV   Y  QWL ++PLELV AS+TI
Sbjct: 136 FTVINSLGELSAAFP-VVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITI 194

Query: 237 DYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXX 296
            YW  K+N+D                  K + E +F  +  K+L I GF IL        
Sbjct: 195 KYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGG 254

Query: 297 XXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRA 356
               GYIG KYWHDPGAF G  S  +FK +              E  A+ A+E  NPR  
Sbjct: 255 GPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 357 IPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVV 415
           IP AAK   + I   +++ + L+G LVP +   L+ GS S    +SP V+AI + G++ +
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGL 374

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           P  +NA+IL+AV+SV+NSA Y+  R + +++  G  P++ N +D+ GRP  A+++++ FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
           +++F A S K+ EVFTWL A+SGLS IF WMAI LSHIRFR+AM VQ RS+ EL F SQ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
           GV GS Y   +LFL LIA FW S+ P+G     A+SFFE YL+ PILIV Y G+K+Y R+
Sbjct: 495 GVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRN 554

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           W L ++ +++DL T R   D              L       R +HFWC
Sbjct: 555 WTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFVTRFLHFWC 603

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  396 bits (1017), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/584 (37%), Positives = 316/584 (54%), Gaps = 19/584 (3%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSK--------------- 121
           +R IDSFK AE  T+ ++          +   A  K+ D+   S+               
Sbjct: 9   QRMIDSFKPAE--TQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVE 66

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
           ++DA   K +  RH+L  ++           +G+AL   GP  LVI + I+ TCL+ I+ 
Sbjct: 67  DQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVN 126

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           A GE++ ++  + G FN Y +  V+  FGFAV   Y  QW  ++PLELV AS+TI YW  
Sbjct: 127 ALGELSSTFP-VVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNH 185

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            +N+D                  K + E +F  +  K+L I GF IL            G
Sbjct: 186 TINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGG 245

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIG KYW +PGAF G  + DRF  +             +E IA+ A+E  NPR  +P A 
Sbjct: 246 YIGGKYWSNPGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKAC 305

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFIN 420
           K   + I   ++  + LVG LV  D   L+ GS S    ASP V+AI + G++ +P  +N
Sbjct: 306 KRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMN 365

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           A+IL+AVLSV+NSA Y+  R + S++Q G  P+ F Y+DR+GRP  A++ +++FG+++F 
Sbjct: 366 AIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFI 425

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
           A S K+EEVFTWL A+SGLS +F W AI +SHIRFRR M  +GR++ EL F S  GVWGS
Sbjct: 426 AASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGS 485

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600
            Y   ++F+ L+  FW S+ P G +  +A+SFFE YL+ PIL+  YFG+K+Y R W+L  
Sbjct: 486 YYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLT 545

Query: 601 RAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
             K IDL + R   D              ++    + R +H WC
Sbjct: 546 PTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  394 bits (1013), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/623 (36%), Positives = 338/623 (54%), Gaps = 26/623 (4%)

Query: 23  KDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDS 82
           +D SK    S  D +N+N +       +  +S ED S +   K           K F DS
Sbjct: 3   QDISKEGGPSVIDEKNKNYISNQENVVESGASQEDYSNSSYPK------SGSKWKDFKDS 56

Query: 83  FKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLA 142
           FKR +    +              L+ A K   +AI + +  + L++ ++ RH+ M ++ 
Sbjct: 57  FKRMDSVDLDPN------------LTDAQK---IAILTSQ--SPLQRKLKNRHLQMIAIG 99

Query: 143 XXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPT 202
                     +  AL  AGPAG++IG+ +M T + C+  + GEMAV++  + G +  Y T
Sbjct: 100 GAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFP-VSGGYTTYAT 158

Query: 203 FLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXX-XXXXXXXX 261
             +DE +GFA    Y +Q L V+PLE+V AS+T+DYW  K                    
Sbjct: 159 RFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRAAFVALFWLCIVSINM 218

Query: 262 XGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSID 321
            G KGY EA+F F+  KV+ + GF IL          T  YIG+K+W +PGAF GD +  
Sbjct: 219 FGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQ 278

Query: 322 RFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGF 381
           +FK +             +E + + A+E  +PR+++P AAK + +RI   ++ S+ +VG 
Sbjct: 279 KFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGL 338

Query: 382 LVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRI 441
           LVPY    L+GS      ASP+VLA+ +HG++ +P  IN VIL AVLSV NS+ +S  R 
Sbjct: 339 LVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRC 398

Query: 442 LFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQ 501
           L +LS+QG+ P  F YIDR+GRP  ++I S  FG++ F A S + +E+F W+L++SGLS 
Sbjct: 399 LTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSS 458

Query: 502 IFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAP 561
           +F W+ I L HIRFR+A+  Q RSI EL F S +G+WGS Y+  ++ + LI +FW+++ P
Sbjct: 459 LFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFP 518

Query: 562 IGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXX 621
            G     A +FF+ YL+MPI +  Y G+KIY ++WKL I  K +D+ T R   D      
Sbjct: 519 -GHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQ 577

Query: 622 XXXXXXXXLKNGPTWKRLVHFWC 644
                   +   P   R+ +FWC
Sbjct: 578 ELLEQNAIMAKKPFIYRVYNFWC 600

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  392 bits (1006), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/581 (37%), Positives = 317/581 (54%), Gaps = 16/581 (2%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAI------TSKEEDA---- 125
           L + ++ FK AE+   E   +        S L   +K+ D  I      TS   +A    
Sbjct: 11  LNKIVNGFKSAED---EKSILEGKSSTQSSLLDLTLKKCDNGIEVVNDATSTVSNASVTN 67

Query: 126 -HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACG 184
            +L K++  RH+L  ++           +G+AL   GPA LVI + I+ TCL+ +I A G
Sbjct: 68  VNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALG 127

Query: 185 EMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN 244
           EMA ++  + G FN Y T  VD   GFAV   Y  QWL ++PLELV ASMTI YW   +N
Sbjct: 128 EMAAAFP-VVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTIN 186

Query: 245 NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIG 304
           +D                  K + E +F  +  K+L I GF IL            GY+G
Sbjct: 187 SDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLG 246

Query: 305 AKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIM 364
            KYWH+PG+F G  S  +FK +              E  A+ A+E  +PRR IP AAK  
Sbjct: 247 GKYWHNPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRT 306

Query: 365 IYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINAVI 423
            + I   +++ + L+G LVPYD   L+ GS S    +SP V+AI + G++ +P  +NA+I
Sbjct: 307 FWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAII 366

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           L++++SV+NSA Y+  R + +++  G  PQ   +ID++GRP  A++ ++ FG+++F A S
Sbjct: 367 LISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAAS 426

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
            K+ EVFTWL A+SGLS IF WMAI +SHIRFR+AM  Q +S+ EL + SQ GVWGS Y 
Sbjct: 427 DKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYG 486

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAK 603
             +LFL LI  FW S+ P+G    DA+SFF+ YL+ PILI  Y G+K+  R  ++ +  +
Sbjct: 487 VIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALE 546

Query: 604 NIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           ++D+ T R   D              L     + R +H WC
Sbjct: 547 DMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  392 bits (1007), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/614 (36%), Positives = 325/614 (52%), Gaps = 14/614 (2%)

Query: 37  ENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKEPH----LKRFIDSFKRAEEGTEE 92
           E  N   Y   +  QS S+E LS         L  + P       R ++ FKRA+EG E 
Sbjct: 21  EMSNSRSYLTTTAHQSLSSEALSMG------SLDARSPQKDVWYTRLLNDFKRADEG-ET 73

Query: 93  TKHMXXXXXXXXSPLSAAIKEHDVAIT-SKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXX 151
           T+ +              + + + A+  +    + L K++  RH+L  ++          
Sbjct: 74  TRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFV 133

Query: 152 XNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGF 211
            +G++L+  GP  ++I + ++ TCL+ I+ + GE+A ++  + G FN Y T  V+  FGF
Sbjct: 134 NSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFP-VVGGFNVYITRFVEPSFGF 192

Query: 212 AVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEAD 271
           AV   Y  QW  ++PLEL  AS+TI YW  K+N+D                  K + E +
Sbjct: 193 AVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETE 252

Query: 272 FFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXX 331
           F  +  K+L I GF IL            G+IGAKYWHDPGAF GD    +FK +     
Sbjct: 253 FVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPGAQFKGLCSVFV 312

Query: 332 XXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM 391
                   +E + + A+E  NPR  IP A+K   + I   +L  + + G LVP +   L+
Sbjct: 313 TAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLL 372

Query: 392 -GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGY 450
            G  S    ASP V+AI + G+R VP  +NA+IL+A++SV+NS+ Y+  R + S++Q G 
Sbjct: 373 NGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGN 432

Query: 451 APQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICL 510
            P+ FNYIDR+GRP  A++ +++FG+++F A S K+E +FTWL A+SGLS +F W AI +
Sbjct: 433 LPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINI 492

Query: 511 SHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAK 570
           SHIRFRRAM  Q RS+ EL + S  GV GS Y A +L   L+  FW S+ P G     A+
Sbjct: 493 SHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAE 552

Query: 571 SFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXL 630
           SFFE YL+ PI ++ Y  +K+Y RDW+LFI A  ID+ + R   D               
Sbjct: 553 SFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAET 612

Query: 631 KNGPTWKRLVHFWC 644
              P + R   FWC
Sbjct: 613 AKKPFYVRWWIFWC 626

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  391 bits (1004), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/535 (38%), Positives = 308/535 (57%), Gaps = 4/535 (0%)

Query: 84  KRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEE--DAHLRKSIQPRHVLMSSL 141
           KR+    E+   +          ++     +D  + SKE+   ++L K +  RH+L  ++
Sbjct: 44  KRSNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAV 103

Query: 142 AXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYP 201
                      +G++L+  GPA LVIG+ I+ T L+ +I + GE+A +Y  + G F+ Y 
Sbjct: 104 GGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYP-VVGGFSVYM 162

Query: 202 TFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXX 261
           T  +D    F++   Y +QWL ++PLELV AS+TI YW  K+N+D               
Sbjct: 163 TRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNM 222

Query: 262 XGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSID 321
              K + E +F  +  K+L I GF IL            GYIG KYWHDPGAF G  +  
Sbjct: 223 LDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAFVGHTAGS 282

Query: 322 RFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGF 381
           +FK +              E IA+ A+E  +PR+ IP AAK   + I   +++ + L+G 
Sbjct: 283 QFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGC 342

Query: 382 LVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCR 440
           LVPYD   L+ GS S    +SP V+AI + G++ +P  +NA+IL+AVLSV+NSA Y+  R
Sbjct: 343 LVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSR 402

Query: 441 ILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLS 500
            + S++  G  P+    ID++GRP  A ++++ FG+I+F A S K+ EVFTWL A+SGLS
Sbjct: 403 YMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLS 462

Query: 501 QIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIA 560
            IF WM I +SHIRFRRAM +QGRS+ E+ + SQ+GV+GS Y   +LFL LIA FW S+ 
Sbjct: 463 TIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLF 522

Query: 561 PIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
           P+G    +A +FFE YL++PIL+  Y G+K Y ++W+LF     IDL + +   D
Sbjct: 523 PVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDID 577

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  391 bits (1004), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 243/643 (37%), Positives = 347/643 (53%), Gaps = 50/643 (7%)

Query: 10  DDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAG-RKKWYE 68
           D F + SN    +KD         +D+ +E        ST  S++N++ S    R KW  
Sbjct: 3   DSFPEKSNGNVNVKDIES-TTFGMDDIVHEPC------STLSSNNNDNESRGSIRCKW-- 53

Query: 69  LGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDA--- 125
                    RF+DSFKR E                       ++E D  +T  E+ A   
Sbjct: 54  --------TRFVDSFKRIE-----------------------LEELDPNLTDAEKIAIAT 82

Query: 126 ---HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
               L+ +++ RH+ M ++           +G AL  AGPAG++IG+ + GT +Y ++ A
Sbjct: 83  ARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMA 142

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+AV +  + G F  Y T  +DE FGFA+ + Y +QWL  +PLE+V+AS+T++YW   
Sbjct: 143 VGELAVVFP-VSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVD 201

Query: 243 VN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
               D                G KGY EA+F F   KV+ I GF I+            G
Sbjct: 202 AKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGG 261

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIGAKYWH PGAF GD +  +FK             G SE + +  SE  NPR+++P AA
Sbjct: 262 YIGAKYWHHPGAFVGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAA 321

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINA 421
           K + +RI   ++  + L+G LVPY+   L+G+ S    ASP+V+A+ + G+R +P  IN 
Sbjct: 322 KQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINV 381

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           VIL++VLSV NS+ Y   R L +L++QG+ P+   YIDR GRP  A+ I+  FG+IAF A
Sbjct: 382 VILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVA 441

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            SS E EVF WLLA+SGLS +F+W AIC+ HIRFRRA+  QGRS  EL F S +G+ GS 
Sbjct: 442 ESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSY 501

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIR 601
           +   +  L LIA+F+V + P G    +AK FF  YL+ PI++ FY  +KI+ ++WKL+I+
Sbjct: 502 WGIFICVLMLIAQFYVGLFPAGASP-NAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIK 560

Query: 602 AKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           A+++D+ T R   D              L   P W R   FWC
Sbjct: 561 AEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCWKFWC 603

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  389 bits (1000), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 217/587 (36%), Positives = 316/587 (53%), Gaps = 27/587 (4%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAA---IKEHDVAI--------------- 118
           +R +DSFK AE   + +++         SPL++     K+ D A                
Sbjct: 9   QRMLDSFKPAETYKQSSRN-------DMSPLTSEAPDFKKADAASGNESWALENVESTSG 61

Query: 119 TSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
           TS  ED+   K +  RH+L  ++           +GSAL   GP  LVI + I+ TCL+ 
Sbjct: 62  TSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFT 121

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           I+ A GE++ ++  + G FN Y +  V+  FGFAV   Y  QW  ++PLELV AS+TI Y
Sbjct: 122 IVNALGELSSTFP-VVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRY 180

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           W + +N+D                  K + E +F  +  K+L I GF IL          
Sbjct: 181 WNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGP 240

Query: 299 TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
             GYIG KYW +PGAF G+ S  RF  +             +E IA+ A+E  NPR  +P
Sbjct: 241 EGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 300

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPH 417
            A K   + I   ++  + LVG LVP D   L+ GS S    ASP V+AI + G++ +P 
Sbjct: 301 KACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPS 360

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
            +NA+IL+AVLSV+NSA Y+  R + S+++ G  P+ F+Y+DR+GRP  A++ +++FG++
Sbjct: 361 LMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLL 420

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           +F A S+K+E VFTWL A+SGLS +F W AI +SHIRFR  M  +GRS+ EL F S  GV
Sbjct: 421 SFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGV 480

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           WGS Y   ++F+ L+  FW ++ P  E    A+SFFE YL+ PIL+V Y G+K+Y + W+
Sbjct: 481 WGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWR 540

Query: 598 LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           L      ID+ + R   D              ++      R +H WC
Sbjct: 541 LLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  389 bits (1000), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/590 (37%), Positives = 323/590 (54%), Gaps = 17/590 (2%)

Query: 71  VKEPHLKRFIDSFKRAEEGTEE-----TKHMXXXXXXXXSPLSAAIK----EHDVAITSK 121
           +K+ +    ID F+  +E  EE     +  +        SP +   K    E ++ ITS+
Sbjct: 7   LKKEYWADVIDGFRAPDEEGEEGIGRSSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQ 66

Query: 122 ----EEDAH--LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTC 175
               +ED +  L K +  RH+L  ++           +G+AL   GPA LVI + I+ TC
Sbjct: 67  SSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTC 126

Query: 176 LYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMT 235
           L+ +I + GE+A ++  + G FN Y T  VD  F FAV   Y  QWL ++PLELV AS+T
Sbjct: 127 LFTVINSLGELAAAFP-VVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASIT 185

Query: 236 IDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXX 295
           I YW + +N+D                  K + E +F  +  K+L I GF IL       
Sbjct: 186 IKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCG 245

Query: 296 XXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRR 355
                GY+G KYWH+PGAF G  S  +FK +              E  A+ A+E  +PR+
Sbjct: 246 GGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRK 305

Query: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRV 414
            IP AAK   + I   +++ + LVG LVPYD   LM G+ S    ASP V+AI + G++ 
Sbjct: 306 TIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKG 365

Query: 415 VPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILF 474
           +   +NA+IL++++SV+NSA Y+  R + S++  G  P+    +D+ GRP  A ++++ F
Sbjct: 366 LDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFF 425

Query: 475 GIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQ 534
           G+++F A S K+ EVFTWL A+SGLS IF WMAI +SHIRFR+AM  Q RS+ E+ + SQ
Sbjct: 426 GLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQ 485

Query: 535 LGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR 594
            GVWGS+Y   +LFL L+A FW S+ P+G D  D +SFFE YL++PILIV Y G+K+Y +
Sbjct: 486 TGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFK 545

Query: 595 DWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +W   +  + +DL T R   D              +      KR  H WC
Sbjct: 546 NWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHVWC 595

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  389 bits (998), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 201/520 (38%), Positives = 299/520 (57%), Gaps = 9/520 (1%)

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
           L++ ++ RH+ M ++           +G AL   GPA +++ + + G+ +Y ++QA GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-N 245
            V+   + G++ +Y +  +D  FGFA+A+ Y +  L  MPLE+V AS+T+DYW       
Sbjct: 144 CVALP-VSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYA 202

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXX-XXXXXTSGYIG 304
           D                G KGY EA+F F+  KVL I GF IL            +GYIG
Sbjct: 203 DGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 305 AKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIM 364
            KYWH+PG F        FK               SE  A+GA+E  NPRR +P AAK +
Sbjct: 263 TKYWHNPGGFA-----HGFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQV 317

Query: 365 IYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVIL 424
            +RI   +L S+ L+G LVPY +  L  S S    ASP+V+AI   G+  +P  IN VIL
Sbjct: 318 FWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVIL 377

Query: 425 LAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSS 484
           +AVLSV N+  ++S R   SL+  GY P+ F Y+DR+GRP   +I+S++FG+++F + S 
Sbjct: 378 VAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSK 437

Query: 485 KEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAA 544
            +  VF W+LA+SGL   FTW +IC+ H+RFR+ +  QGRS  EL F++Q G+WGS+Y  
Sbjct: 438 HKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGI 497

Query: 545 TMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKN 604
           T++ + L  +FWV++ P+ +    A  FFE YL++P++IVFY G+K+Y+R+W+L I AK 
Sbjct: 498 TLISVVLCFQFWVALFPLSKSP-SAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKE 556

Query: 605 IDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +DL T R   D              +++ P W R+  FWC
Sbjct: 557 LDLDTGRREVDLELLKQEIKEENESIRSRPIWYRIYRFWC 596

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  387 bits (994), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/638 (36%), Positives = 344/638 (53%), Gaps = 60/638 (9%)

Query: 14  DNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELGVKE 73
           +   ++Y +   ++L    F++L             +   S  D S  G  +W       
Sbjct: 3   EEKKLDYSIVQETQLEPGEFDEL-------------NSYVSQSDTSRVGGTRW------- 42

Query: 74  PHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEE------DAHL 127
              +RF DSF+ AE                         + D ++T  E+      +A L
Sbjct: 43  ---ERFKDSFREAET-----------------------VDLDPSLTPAEKMAILTANAPL 76

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +++++ RH+ M  +           +G +L  AGPAG++IG+A+ GT +YC++ A GE+A
Sbjct: 77  KRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELA 136

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-ND 246
           V++  + G +  Y +  VDE FGFA   VY + WL  +PLE+V AS+T++YW T     D
Sbjct: 137 VTFP-VAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 247 XXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAK 306
                           G KGY EA+F F+  KV+ + GF IL            GYIG +
Sbjct: 196 AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGR 255

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
            WH+PGAF      + FK V             SE + + A+E +NPR++IPSAAK + +
Sbjct: 256 LWHNPGAFA-----NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFW 310

Query: 367 RILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLA 426
           RI   ++ ++ +VG LVPY S  L+G  S    ASP+V++I + G++ +P  IN VIL+A
Sbjct: 311 RITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIA 370

Query: 427 VLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKE 486
           VLSV N A +   R + +L+ QG  P+ F YIDR GRP   ++++ +FG+++F A S KE
Sbjct: 371 VLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKE 430

Query: 487 EEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATM 546
            EVF WLLA+SGLS +FTW  I L HIR RRA+  Q R+ +EL F +   VWGSVY+  +
Sbjct: 431 GEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLIL 490

Query: 547 LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNID 606
           + L LIA+FW+++ PIG     A +FFE YL+ PI IVFY G+KI+ ++WKLFI+A +ID
Sbjct: 491 IILILIAQFWIALFPIGGKP-SAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDID 549

Query: 607 LITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           + + R   D              + + P + R+  FWC
Sbjct: 550 IDSGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  386 bits (991), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/535 (39%), Positives = 305/535 (57%), Gaps = 4/535 (0%)

Query: 113 EHDVAITSKEEDAH--LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
           E    +  ++ D H  + K +  RH+L  ++           +G+AL   GPA LVI + 
Sbjct: 80  EAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWV 139

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
           I+ TCL+ ++ + GE+A ++  + G FN Y T  +D  FGFAV   Y  QWL ++PLELV
Sbjct: 140 IISTCLFTVVNSLGELAAAFP-VVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELV 198

Query: 231 TASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
            AS+TI YW  K+N+D                  K + E +F  +  K+L I GF IL  
Sbjct: 199 AASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGI 258

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                     GYIG KYWHDPGAF G+ S  +FK +              E  A+ A+E 
Sbjct: 259 VLSCGGGPKGGYIGGKYWHDPGAFVGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAES 318

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISS 409
            NPR  IP AAK   + I   +++ + L+G LVPY++ +L+ GS S    +SP V+AI +
Sbjct: 319 LNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIEN 378

Query: 410 HGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMI 469
            G+R +P  +NA+IL+A++SV+NSA Y+  R + S+++    P++   +DR+GRP  A +
Sbjct: 379 GGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATL 438

Query: 470 ISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISEL 529
           +++ FG+++F A S K+EEVFTWL A+SGLS IF WMAI LSHIRFR+AM  QG S+ EL
Sbjct: 439 LTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDEL 498

Query: 530 GFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGY 589
            + S  GV GS Y   +LFL L+A FW S+ P+G    DA SFFE YL+ PILIV Y G+
Sbjct: 499 PYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGH 558

Query: 590 KIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           K+Y R  +L I   ++DL++ R + D              L     + R +H WC
Sbjct: 559 KLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLHLWC 613

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  384 bits (986), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/588 (36%), Positives = 316/588 (53%), Gaps = 15/588 (2%)

Query: 71  VKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKE--HD--------VAITS 120
           +K  +    I   K +E G  +            SPL++   +  H+         ++ S
Sbjct: 6   LKREYWNEMITGSKSSEAGNIDANFALEEKDSTLSPLASLDSKVPHEKIQTTTDFASVIS 65

Query: 121 KEED---AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
            E+D    +L K++  RH+L  ++           +G+AL   GPA LVI + I+ TCL+
Sbjct: 66  HEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLF 125

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
            +I A GEMA ++  + G FN Y T  +D   GFAV   Y  QWL ++PLELV ASMTI 
Sbjct: 126 TVINALGEMAAAFP-VVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIK 184

Query: 238 YWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX 297
           YW   +N+D                  K + E +F  +  K+L I GF IL         
Sbjct: 185 YWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGG 244

Query: 298 XTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
              G+IG KYW+ PG+F G  S  +FK +              E  A+ A+E  +PR  I
Sbjct: 245 PHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTI 304

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVP 416
           P AAK   + I   +++ + L+G LVPYD   L+ G+ S    +SP V+AI + G++ +P
Sbjct: 305 PKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLP 364

Query: 417 HFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGI 476
             +NA+IL++++SV+NSA Y+  R + +++  G  P+  N +D +GRP  A+I ++ FG+
Sbjct: 365 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGL 424

Query: 477 IAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLG 536
           ++F A S ++ +VFTWL A+SGLS IF WMAI LSHIRFR++M  Q RS+ EL F SQ G
Sbjct: 425 LSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTG 484

Query: 537 VWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596
           VWGS Y   +LFL L+A FW S+ P+G    DA+SFFE YL+ PIL+  YFG+K+Y R  
Sbjct: 485 VWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKR 544

Query: 597 KLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +  +   ++DL T R   D              L     +K  +H WC
Sbjct: 545 EFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  383 bits (983), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 288/487 (59%), Gaps = 2/487 (0%)

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
           E   +L K +  RH+L  ++           +G++L+  GPA L+IG+ I+ + L+ +I 
Sbjct: 73  EYGENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVIN 132

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           A GE+A ++  + G FN Y T  VD  F FAV   Y I W+  +PLELV AS+TI YW  
Sbjct: 133 ALGELAATFP-IVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNR 191

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
           ++N+D                  K ++EA+F  +  K+L I GFFIL          T G
Sbjct: 192 EINSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGG 251

Query: 302 YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 361
           YIG KYW+DPGAF GD +  RFK +              E  A+ A+E  NPR+ IP A 
Sbjct: 252 YIGGKYWNDPGAFHGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 362 KIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFIN 420
           K   + I F ++S + L+G LVPY+   L+ GS S    ASP V+AI + G++ +P  +N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           A+IL+A+LSV+NS  Y   R++ S++     P+ F+ +D+ GRP  ++  ++  G+++F 
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
           A S K+EEVFTWL AI GLS IF W+ I L+HIRFR A+  Q RS+ EL + SQ G+WGS
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600
            Y   +L L LIA FWVS+ P+GE   DA++FFE YL+ PILI  Y G+K+Y ++WK  I
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVI 551

Query: 601 RAKNIDL 607
             + ID+
Sbjct: 552 PLEEIDI 558

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  380 bits (975), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/572 (35%), Positives = 308/572 (53%), Gaps = 8/572 (1%)

Query: 78  RFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHD----VAITSKEEDAHLRKSIQP 133
           +   SFKR EE   E              +    ++ D        + +   +L + +  
Sbjct: 20  KLFSSFKRMEE--VEVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDLSI 77

Query: 134 RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNL 193
           RH+L  ++           +GSAL+  GPA LVI + I+ TCL+ I+ A GE+A  +  +
Sbjct: 78  RHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFP-V 136

Query: 194 PGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXX 253
            G FN Y T LVD   GFAV   Y  QW  ++PLELV AS+TI YW   VN+D       
Sbjct: 137 VGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSDAWVAVFY 196

Query: 254 XXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGA 313
                      K + E +F  +  K+L I GF IL           +GYIGAKYW+DPG+
Sbjct: 197 VCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGS 256

Query: 314 FRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFL 373
           F G     +FK +             +E + + A+E +NPR  +P A+K   + I   +L
Sbjct: 257 FVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYL 316

Query: 374 SSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSN 432
             + ++G LV +D  +L+  S S    ASP V+AI + G++ +P  +NA+IL+A++SV+N
Sbjct: 317 LVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVAN 376

Query: 433 SAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTW 492
           S+ Y+  R + S+++ G  P+ F YID  GRP  A+I +++FG+++F A S+K+EE+F W
Sbjct: 377 SSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVW 436

Query: 493 LLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALI 552
           L A+SGLS +F W+AI +SHIRFRRA++ QG S+ EL + S  GV GS Y   ++ L LI
Sbjct: 437 LSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILVLI 496

Query: 553 AEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRN 612
           A FW S+ P G    D +SFF+ YL++PI +  + G+K+Y R+W   IR+  ID+ T R 
Sbjct: 497 ASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKIDVNTGRR 556

Query: 613 IFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           + D              +       +L + WC
Sbjct: 557 MIDKEELEKEKQEFNEYMARKSFIAKLWNLWC 588

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 207/622 (33%), Positives = 327/622 (52%), Gaps = 21/622 (3%)

Query: 29  RRRSFNDLENENIVEYFGKSTDQSSSNED--LSYAGRKKWYELGVKEP---HLKRFIDSF 83
           ++   N     ++++ F  + D + S ++   S++  + +    + E    ++  ++   
Sbjct: 3   KKSPLNKAYWSDMIDGFKSTPDDAHSEQEGETSFSNIRSFTSSPIPEKSSDNMTTYVTDS 62

Query: 84  KRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAX 143
           K  E G+E+                        +I  ++ + +L K +  RH++  ++  
Sbjct: 63  KTKEGGSEKNIETT--------------PSEQFSIAKEDINENLNKDLSIRHLITLAVGG 108

Query: 144 XXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTF 203
                    +G+AL   GPA LVI + I+ TCL+ +I A GE+A +Y  + G FN Y T 
Sbjct: 109 SIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYP-VVGGFNVYITR 167

Query: 204 LVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXG 263
            VD    FA+   Y  QWL ++PLELV AS+TI YW   +N+D                 
Sbjct: 168 FVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLD 227

Query: 264 AKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRF 323
            K + E +F  +  K+L I GF IL            G++G  YWHDPG+F GD+   +F
Sbjct: 228 VKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQF 287

Query: 324 KDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLV 383
           K +              E  A+ A+E  +PR+ IP A K   + +   +++ + ++G LV
Sbjct: 288 KGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLV 347

Query: 384 PYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRIL 442
           P+D   L+ GS S    ASP V++I + G++ +   +NA+IL++++SV+NSA Y+  R +
Sbjct: 348 PFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCM 407

Query: 443 FSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQI 502
            S++  G  P+  + +D+ GRP  A++ ++ FG+++F A S K+ EVFTWL A+SGLS I
Sbjct: 408 VSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTI 467

Query: 503 FTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPI 562
           F WMAI  SHIRFR AM VQ +++ EL + SQ GV GS Y   +LFL L+A FW S+ P+
Sbjct: 468 FCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPL 527

Query: 563 GEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXX 622
           G    D  SFFE YL++PILI  Y G+K+Y R+ ++ ++ +++DL T R   DA      
Sbjct: 528 GSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAE 587

Query: 623 XXXXXXXLKNGPTWKRLVHFWC 644
                  L      KR  H WC
Sbjct: 588 ILAEKAALSQKSFIKRFWHVWC 609

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  379 bits (972), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 230/596 (38%), Positives = 324/596 (54%), Gaps = 21/596 (3%)

Query: 51  QSSSNEDLSYAGRKKWY-ELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSA 109
           Q   +E LSY        E  + +   + F+DSFKR E   EE             P   
Sbjct: 28  QDVISETLSYKDLSNTTPESTIDKSRWRNFLDSFKRIE--VEEV-----------DPNLT 74

Query: 110 AIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGY 169
            I++    I  K   + L+  ++ RH+ M ++           +G AL  AGPAG++IG+
Sbjct: 75  DIEK----IAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGW 130

Query: 170 AIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLEL 229
            I GT ++ ++ A GE+AV +  + G F  Y T  +DE FGFA  + Y  QWL  +PLE+
Sbjct: 131 GITGTMIFTMVMALGELAVVFP-VSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEI 189

Query: 230 VTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
           V AS+T+DYW T V   D                G +GY EA+F F+  KV+ + GF IL
Sbjct: 190 VAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIIL 249

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGAS 348
                       GY+G +YWHDPGAF G     RFK               SE + I ++
Sbjct: 250 GIILVCGGGPVGGYVGGRYWHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASA 309

Query: 349 EQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAIS 408
           E  NPR+++P AAK + +RIL  ++  + LVG LVPY    L+GS      ASP+V+AI 
Sbjct: 310 ESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIV 369

Query: 409 SHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468
           +HG+  +P  +N VIL++VLSV NS+ Y+  R L +LS+QG+ P+   YIDR+GRP   +
Sbjct: 370 THGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGI 429

Query: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528
            I   FG+IAF A S+K+E++F WLLAISG+S   TW +IC  HIRFR A+ V GRS  E
Sbjct: 430 AICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDE 489

Query: 529 LGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFG 588
           L F+S +G+ GS +   +  L L+A+F+ ++ PIG    +A  FF  YLA PI++ FY  
Sbjct: 490 LPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSP-NAYDFFSAYLAAPIVLAFYIA 548

Query: 589 YKIYNRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +K++ R+WKL I  K+ID+ T R   D              L   P W R+  FWC
Sbjct: 549 HKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  378 bits (970), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/523 (38%), Positives = 296/523 (56%), Gaps = 2/523 (0%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +D+ L K +  RH+L  ++           +G +L   GPA LVI + I+ TCL+ I+ +
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE++ ++  + G FN Y T  V+  FGFAV + Y  QW  ++PLEL  AS+TI YW   
Sbjct: 120 LGELSATFP-VVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKS 178

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           +N D                  K + E +F  +  K+L I GF IL          + G+
Sbjct: 179 INPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGF 238

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYW+DPGAF GD    RFK +              E + + A+E  NPR  +P AAK
Sbjct: 239 IGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAK 298

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINA 421
              + I   +L  + L+G LVP +   L+ G+ S    ASP V+AI + G++ +P  +NA
Sbjct: 299 RTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNA 358

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
           +IL+A+LSV+NSA Y+  R + S+++ G  P+   ++D++GRP  A+ I++L G+++F A
Sbjct: 359 IILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIA 418

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            S+K +EVFTWL A+SGLS +F W AI L+H+RFR AM  Q RS+ EL + S  G WGS 
Sbjct: 419 ASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSW 478

Query: 542 YAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIR 601
           Y   ++ L LIA FW S+ P G +  DA SFFE+YL++PI I  Y G+KI+ R+ +L+I+
Sbjct: 479 YGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIK 538

Query: 602 AKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
              +D+ + R   DA             +K  P + RL +FWC
Sbjct: 539 LSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNFWC 581

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  376 bits (966), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 223/636 (35%), Positives = 330/636 (51%), Gaps = 56/636 (8%)

Query: 19  EYELKDASKLRRRSFNDLENE--NIVEYFGKSTDQSSSNED-LSYAGRKKWYELGVKEPH 75
           E+ L          +   +NE   I+E   K+ D +    D LS   RK+      K P 
Sbjct: 3   EFSLSTQDVSSDIKYKSSKNEFITIIESDNKNIDDNFIPHDTLSTISRKE-----KKPPI 57

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRH 135
            +R IDSFK  E+G+  T                                +L+KS++ RH
Sbjct: 58  YRRIIDSFKPPEDGSFHT-------------------------------GNLKKSLKSRH 86

Query: 136 VLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPG 195
           ++M ++           +G AL   GP  ++IG+A+ G+ +   I   GE+ V +  + G
Sbjct: 87  LIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIHGLGEITVRFP-VVG 145

Query: 196 NFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXX 255
            F +Y T  +D    F V+ +Y +QW  V+PLE++ +++T+ YW   ++           
Sbjct: 146 AFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWNDSIDPVVFVAIFYCV 205

Query: 256 XXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR 315
                  GA+G+ EA+F F+T K++ I GF IL             YIGAKYWH+PG+  
Sbjct: 206 IVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEYIGAKYWHNPGSLA 265

Query: 316 GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSS 375
                  FK V+          G +E   + AS +++P+  +PSA K + +RILF FL S
Sbjct: 266 -----HGFKGVLSVLVVASYSLGGTEMTCL-ASGETDPKE-LPSAIKQVFWRILFFFLVS 318

Query: 376 IALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAF 435
           + LVGFLVPY +  L+G  S     SP+V+AI  H ++V+P  +NAVIL+++LSV NS  
Sbjct: 319 LTLVGFLVPYTNPNLLGGSS--VDNSPFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCI 376

Query: 436 YSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLA 495
           ++S R L S++ Q   P WF YIDR GRP   +II+ LFG++AF   SS   EVF WL+A
Sbjct: 377 FASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMA 436

Query: 496 ISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEF 555
           I+GL+    W++I + H+RFR AM  Q R++ EL F S +G+WGSVY+  +  L L+A+F
Sbjct: 437 IAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQF 496

Query: 556 WVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----DWKLFIRAKNIDLI 608
           ++++ PIG   +    AK FF+NYL   ILIV + G+KIY R     W  +I  K+IDL 
Sbjct: 497 YIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYYRVTTGHWWEYIALKDIDLD 556

Query: 609 THRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           T R   D              L + P + R  H WC
Sbjct: 557 TDRKNVDIEIIKQEIHEKKMYLASKPWYVRQFHVWC 592

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  372 bits (955), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/553 (38%), Positives = 314/553 (56%), Gaps = 9/553 (1%)

Query: 48  STDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETK-HMXXXXXXXXSP 106
           S+ + ++ E+L Y G     E   +EP       S   AEE    +K            P
Sbjct: 5   SSYEKNNPENLKYNGITIDSEFLTQEPITIPSNGSAASAEEAGSGSKWQDFKDSFKRVEP 64

Query: 107 LSA---AIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPA 163
           ++      +   VAI + +    L+  ++ RH+ M ++           +G+AL   GPA
Sbjct: 65  IAVDPNLTEAEKVAIVTAQTP--LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPA 122

Query: 164 GLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLC 223
            L+IG+   GT +Y ++ A GE+AV +  + G F  Y T  +DE FG+A  + Y +QWL 
Sbjct: 123 SLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDESFGYANNFNYMLQWLV 181

Query: 224 VMPLELVTASMTIDYWTTKVN-NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMI 282
           V+PLE+V+AS+T+++W T     D                G KGY EA+F F+  KV+ +
Sbjct: 182 VLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITV 241

Query: 283 TGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEF 342
            GF IL            GYIG KYWHDPGAF GD    +FK V             SE 
Sbjct: 242 VGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTSAFSFAGSEL 301

Query: 343 IAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASP 402
           + + ASE   PR+++P AAK + +RI   ++ S+ ++G LVPY+   L+G+ S    ASP
Sbjct: 302 VGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASP 361

Query: 403 YVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREG 462
           +V+AI +HG++ +P  +N VIL+AVLSV NSA Y+  R + +L++Q + PQ F Y+DR+G
Sbjct: 362 FVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKG 421

Query: 463 RPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQ 522
           RP   + ++  FG+IAF A S KE +VF WLLA+SGLS +FTW  IC+ HIRFR+A+  Q
Sbjct: 422 RPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQ 481

Query: 523 GRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPIL 582
           GR + EL F+S  GVWGS +   M+ +  IA+F+V++ P+G     A+ FFE YL+ P++
Sbjct: 482 GRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSP-SAEGFFEAYLSFPLV 540

Query: 583 IVFYFGYKIYNRD 595
           +  Y G+KIY R+
Sbjct: 541 MAMYIGHKIYKRN 553

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  374 bits (961), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/519 (39%), Positives = 290/519 (55%), Gaps = 2/519 (0%)

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
           + K +  RH+L  ++           +GS+L+  GPA LVIG+ I+ T L+ +I + GE+
Sbjct: 141 MNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGEL 200

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNND 246
           A ++  + G F+ Y    VD  F FAV   Y +QWL ++PLELV AS+TI YW + +N+D
Sbjct: 201 AAAFP-VVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSD 259

Query: 247 XXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAK 306
                             K + E +F  +  K+L I GFFIL          +  YIG K
Sbjct: 260 AWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGK 319

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YWHDPGAF G  S  +FK +              E  A+ A+E  NPR  IP AAK   +
Sbjct: 320 YWHDPGAFVGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFW 379

Query: 367 RILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
            I   ++S + LVG LVPY+   LM GS S    +SP V+AI +  +  +P  +NA+IL+
Sbjct: 380 LITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILI 439

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           A+LSV+NS+ Y+  R + S+S+    P+ F  +DR GRP  A+   + FG+++F A S K
Sbjct: 440 AILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDK 499

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
           + EVFTWL A+SGLS IF WM I L HIRFR+ MHVQ  S+ EL F SQ G+WGS+Y   
Sbjct: 500 QAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIV 559

Query: 546 MLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNI 605
           +LFL L+A FW S+ P+G    +A SFFE YL+ PIL+  Y  +K+Y ++W+ +I A  +
Sbjct: 560 ILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKM 619

Query: 606 DLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           DL + R   D              L     + R +H WC
Sbjct: 620 DLHSGRKQVDLEVVREELRLEKEHLAQRSFFYRFLHVWC 658

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  372 bits (956), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 193/520 (37%), Positives = 296/520 (56%), Gaps = 9/520 (1%)

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
           L++ ++ RH+ M ++           +G AL   GPA +VI + + G+ +Y ++QA GE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN-N 245
           AV+   + G++ +Y +  ++  FGFA+A+ Y I  L  MPLEL+ AS+T++YW       
Sbjct: 149 AVALP-VSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYA 207

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXT-SGYIG 304
           D                G KGY EA+F F+  KV  I GF IL          +  GYIG
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 305 AKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIM 364
           A+YW++PG F        FK               SE  A+ A+E  NPR+ +P AAK +
Sbjct: 268 ARYWYNPGGFA-----HGFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQV 322

Query: 365 IYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVIL 424
            +RI   ++ S+ L+G LVPY    L  + S    ASP+V+AI+  G++ +P  +N VIL
Sbjct: 323 FWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVNVVIL 382

Query: 425 LAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSS 484
           +AVLSV N   Y++ R + SL+  G+ P+ F Y+DR+GRP   +++  +FG+++F + SS
Sbjct: 383 IAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSASS 442

Query: 485 KEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAA 544
              EVF W+LAISGL+  F W +IC+ H+RFRRA+ VQGRS  EL +++Q G+WGS+Y  
Sbjct: 443 NYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGSLYGI 502

Query: 545 TMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKN 604
            ++F+ L  +FWV++ PIG    +A  FF  YL++P++I FY  +K+Y R W   I++ +
Sbjct: 503 GLIFIVLCFQFWVALFPIGGSP-NANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIKSSD 561

Query: 605 IDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           ID+ T R   D              +++ P W R+  FWC
Sbjct: 562 IDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  372 bits (955), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/571 (36%), Positives = 307/571 (53%), Gaps = 23/571 (4%)

Query: 79  FIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLM 138
           F+D+F+RAE    +              LS A K     +  +   A L + ++ RH+ M
Sbjct: 52  FVDTFRRAEMPVIDPN------------LSEAEK-----LAIRTAAAPLSRRLKNRHLQM 94

Query: 139 SSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFN 198
            ++           +G AL  AGPAG++IG+ +  T +  +  + GE+AV++  + G + 
Sbjct: 95  IAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYI 153

Query: 199 AYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXX-XXXX 257
            Y    +DE +GFA  + Y +Q + VMPLE+V AS+T+ YW T                 
Sbjct: 154 TYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIV 213

Query: 258 XXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGD 317
                G +G+ EA+  F+  KV+ I GF I+              IG KYW+DPG F G+
Sbjct: 214 SINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGN 273

Query: 318 RSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIA 377
              D+FK V             SE I + A+E   PR++IP AAK + +RI   ++ S+ 
Sbjct: 274 APSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLL 333

Query: 378 LVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYS 437
           +VG LVP ++  L+         SP+V+A+  H +RV+P  IN VIL AV+SV NS+ YS
Sbjct: 334 IVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYS 393

Query: 438 SCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAIS 497
           S R + +L++ G+ P+ F YIDR+GRP  A+  + LFG++ F A + +E E+F WLLAIS
Sbjct: 394 SSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAIS 453

Query: 498 GLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWV 557
           GLS  FTW+ I L+H+RFR A+  QGR+ +EL F S  G  GS YA  ++ + L+A+FWV
Sbjct: 454 GLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWV 513

Query: 558 SIAPIGEDHLDAKS----FFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNI 613
           ++ P   D   AK     FF+ YL+  + IV Y  +KI++R+WK FI+AK +D+ T R  
Sbjct: 514 ALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRE 573

Query: 614 FDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            D              L   P   R+ +FWC
Sbjct: 574 LDLELFKEELAQERALLAQKPFIIRVFNFWC 604

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  363 bits (933), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/529 (37%), Positives = 295/529 (55%), Gaps = 17/529 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +  +L++S++ RH++M ++           +G A+   GP  +VIG+AI G+ +   I  
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+ V +  + G F  Y T  +D    F ++ +Y IQW  V+PLE+++++MT+ YW   
Sbjct: 141 LGEITVRFP-VVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQS 199

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++                  GA+G+ EA+F F++ KVL I GF IL             +
Sbjct: 200 IDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDF 259

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           +GAKYWHDPG          F  V+          G +E + + AS +++P+  +PSA K
Sbjct: 260 VGAKYWHDPGCLA-----HGFPGVLSVLVVASYSLGGTEMVCL-ASGETDPKE-LPSAIK 312

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
              +RILF FL S+ L+GFLVPY +  L+G  S     SP+V+AI  H ++V+P  +NAV
Sbjct: 313 QTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS--VNNSPFVIAIKLHQIKVLPSIVNAV 370

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL+++LSV NS  ++S R L S++ QG  P++F YIDR GRP   +I + LFG++AF   
Sbjct: 371 ILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVK 430

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           SS   EVF WL+AI+GL+    W++I +SHIRFR AM  QGRS+ EL F S +G+WGS Y
Sbjct: 431 SSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAY 490

Query: 543 AATMLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----D 595
           +A +  L L+A+F+ ++ PIG      + AK FF++YL   I+IV + G+KI+ R     
Sbjct: 491 SAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGK 550

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           W   +    IDL T R   D              L+  P + R  HFWC
Sbjct: 551 WWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVRWYHFWC 599

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  361 bits (927), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/575 (35%), Positives = 309/575 (53%), Gaps = 23/575 (4%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136
           K   D ++ AE  T+ TK          +     I             ++L++S++ RH+
Sbjct: 32  KNIDDKYEHAESLTDYTK------TENRNIFQRVIDSFKPPANGSFHTSNLKRSLKSRHL 85

Query: 137 LMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196
           +M ++           +G AL   GP  LV+G++I G+ +   I   GE+ V +  + G 
Sbjct: 86  IMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFP-VVGA 144

Query: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXX 256
           F  Y T  +D    F ++ +Y +QW  V+PLE++++++T+ YW   ++            
Sbjct: 145 FANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAI 204

Query: 257 XXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG 316
                 G +G+ EA+F F+T KV+ +TGF IL          T  +IGAKYWHDPG    
Sbjct: 205 VSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGCLA- 263

Query: 317 DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376
               + F+  +          G +E   + AS +++P+  +PSA K + +RILF FL S+
Sbjct: 264 ----NGFRGFLSVLITASYSLGGTEMTCL-ASGETDPKE-LPSAIKQVFWRILFFFLVSL 317

Query: 377 ALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
            LVGFLVPY +  L+G  S     SP+V+AI  H ++V+P  +NAVIL+++LSV NS  +
Sbjct: 318 TLVGFLVPYTNENLLGGSS--VDNSPFVIAIKLHNIKVLPSIVNAVILISILSVGNSCIF 375

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           +S R L S++ QG  P WF YIDR GRP   ++I+ LFG++AF   SS   EVF WL+AI
Sbjct: 376 ASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVFDWLMAI 435

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
           +GL+    W++I + HIRFR AM  Q ++I EL F S +GVWGSVY+A +  L LI +F+
Sbjct: 436 AGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIVQFY 495

Query: 557 VSIAPIG--EDHLD-AKSFFENYLAMPILIVFYFGYKIY----NRDWKLFIRAKNIDLIT 609
           VS+ PIG   D  D A  FF+NYL   + ++F+  +K+Y     + W   I  K+IDL T
Sbjct: 496 VSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKLYFRYKTKKWWEIIPLKDIDLDT 555

Query: 610 HRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            R   D              L   P + RL+H WC
Sbjct: 556 GRKNIDIDIVKEEIKERKQYLATKPWYIRLMHHWC 590

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  358 bits (920), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/529 (37%), Positives = 293/529 (55%), Gaps = 17/529 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           + ++L+++++PRH++M ++           +G A+ + GP G+V+G+ I G+ +   +  
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHG 133

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+ V +  + G F  Y T  +D    F V+ +Y +QW  V+PLE++ A+MT+ YW + 
Sbjct: 134 LGEITVRFP-VVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSS 192

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++                  GA+G+ EA+F F+T K + + GF IL             +
Sbjct: 193 IDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEF 252

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IGAKYWHDPG          F  V+          G  E   + AS +++P+  +PSA K
Sbjct: 253 IGAKYWHDPGCLA-----HGFPGVLSVLVVASYSLGGIEMTCL-ASGETDPK-GLPSAIK 305

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            + +RI+F FL S+ LVGFLVPY +  L+G  S     SP+V+AI  H ++V+P  +NAV
Sbjct: 306 QVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS--VDNSPFVIAIKLHHIKVLPSIVNAV 363

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL++VLSV NS  ++S R L S++ QG  P WF YIDR GRP   ++ + LFG++AF   
Sbjct: 364 ILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVK 423

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S    EVF WL+AI+GL+    W++I LSH+RFR AM  QG+S+ EL F S +G+WGSVY
Sbjct: 424 SGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVY 483

Query: 543 AATMLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----D 595
           +A +  L LIA+F+ S+ PIG        AK FF+NYL   I++  +  +KIY R     
Sbjct: 484 SALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYRCQMGK 543

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           W      K+IDL T R   D              L + P + R  HFWC
Sbjct: 544 WWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLDSRPWYVRQFHFWC 592

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  359 bits (921), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/587 (35%), Positives = 312/587 (53%), Gaps = 56/587 (9%)

Query: 70  GVKEPH--LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHL 127
           G K P    +R IDSFK  E+G+ +T                               ++L
Sbjct: 58  GTKPPRNIFQRAIDSFKPPEDGSFDT-------------------------------SNL 86

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K+++ RH++M ++           +G AL   GP  ++IG+AI G+ +   I   GE+ 
Sbjct: 87  KKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHGLGEIT 146

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
           V +  + G F  Y T  +D    F V+ +Y IQW  V+PLE+++++MT+ YW   ++   
Sbjct: 147 VRFPVV-GAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESIDPVV 205

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKY 307
                          G +G+ EA+F F+T KV+ I+GF +L             Y+G++Y
Sbjct: 206 WVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYVGSRY 265

Query: 308 WHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYR 367
           WH+PG        + F  V+          G +E   + AS +++P+  +PSA K + +R
Sbjct: 266 WHNPGCLA-----NGFPGVLSVMVVASYSLGGTEMTCL-ASGETDPKE-LPSAIKQVFWR 318

Query: 368 ILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAV 427
           ILF FL S+ LVGFLVPY +  L+G  S     SP+V+AI  H ++V+P  +NAVIL+++
Sbjct: 319 ILFFFLVSLTLVGFLVPYTNENLLGGSS--VDNSPFVIAIKIHHIKVLPSIVNAVILISI 376

Query: 428 LSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEE 487
           LSV NS  ++S R L S++ Q   P WF YIDR GRP   +I + LFG++AF   S    
Sbjct: 377 LSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMS 436

Query: 488 EVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATML 547
           EVF WL+AI+GL+    W++I +SHIRFR AM  QGRS++EL F S +G+WGSVY+A + 
Sbjct: 437 EVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIIN 496

Query: 548 FLALIAEFWVSIAPIG-----EDHLDAKSFFENYLAMPILIVFYFGYKIY-----NRDWK 597
            L L+A+F++S+ PIG     ED   AK FF++YL   I++  + G+KIY      + W 
Sbjct: 497 CLILVAQFYISLWPIGGWKNSEDR--AKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWA 554

Query: 598 LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            F     IDL   R   D              LK+ P + R  H+WC
Sbjct: 555 -FTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLKSRPWYIRFYHYWC 600

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  357 bits (916), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/529 (37%), Positives = 292/529 (55%), Gaps = 17/529 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           + ++L+++++PRH++M ++           +G A+ + GP G+VIG+AI G+ +   I  
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+ V +  + G F  Y T  +D    F V+ +Y +QW  V+PLE++ A+MT+ YW + 
Sbjct: 134 LGEITVRFP-VVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSS 192

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++                  G +G+ EA+F F+T K + + GF IL             +
Sbjct: 193 IDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEF 252

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IGAKYWHDPG        + F  V+          G  E   + AS +++P+  +PSA K
Sbjct: 253 IGAKYWHDPGCLA-----NGFPGVLSVLVVASYSLGGIEMTCL-ASGETDPK-GLPSAIK 305

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            + +RILF FL S+ LVGFLVPY +  L+G  S     SP+V+AI  H ++ +P  +NAV
Sbjct: 306 QVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS--VDNSPFVIAIKLHHIKALPSIVNAV 363

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL++VLSV NS  ++S R L S++ QG  P WF YIDR GRP   ++ + LFG++AF   
Sbjct: 364 ILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVK 423

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S    EVF WL+AI+GL+    W++I LSHIRFR AM  QG+S+ EL F S +G+WGS Y
Sbjct: 424 SGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAY 483

Query: 543 AATMLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----D 595
           +A +  L LIA+F+ S+ PIG        AK FF+NYL   I++  +  +KIY +     
Sbjct: 484 SALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGK 543

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           W      K+IDL T R   D              L + P + R  HFWC
Sbjct: 544 WWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLDSRPWYVRQFHFWC 592

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  355 bits (912), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/612 (34%), Positives = 318/612 (51%), Gaps = 55/612 (8%)

Query: 47  KSTDQSSSNEDLSYAGRKKWYELG-------VKEPHLKRFIDSFKRAEEGTEETKHMXXX 99
           K    +S++E   Y  +K +Y  G        K    +R +DSFK   +G+ +T      
Sbjct: 7   KEEIHTSTSEFTKYDSQKPYYSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFDT------ 60

Query: 100 XXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHK 159
                                    ++L+++++ RH++M ++           +G AL  
Sbjct: 61  -------------------------SNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALAT 95

Query: 160 AGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCI 219
            GP  ++IG+ I G+ +   I   GE+ V +  + G F  Y T  +D    F V+ +Y I
Sbjct: 96  GGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVV-GAFADYSTRFLDPSISFVVSTIYVI 154

Query: 220 QWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKV 279
           QW  V+PLE++ +++TI YW + ++                  GA+G+ EA+F F+T K 
Sbjct: 155 QWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKA 214

Query: 280 LMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGA 339
           + I GF IL             +IGAKYWHDPGA         F  V+          G 
Sbjct: 215 ITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALA-----HGFPGVLSVLVVASYSLGG 269

Query: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTK 399
           +E   + AS +++P+  +PSA K + +RILF FL+S+ LVGFLVPY +  L+G  S    
Sbjct: 270 TEMTCL-ASGETDPKE-LPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS--VD 325

Query: 400 ASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYID 459
            SP+V+AI  H ++ +P  +NAVIL+++LSV NS  ++S R L S++ QG  P++F YID
Sbjct: 326 NSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYID 385

Query: 460 REGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAM 519
           R GRP   ++ + LFG++AF   SS   EVF WL+AI+GL+    W++I LSHIRFR AM
Sbjct: 386 RAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAM 445

Query: 520 HVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIG---EDHLDAKSFFENY 576
             Q +++ EL F S +G+WGS Y+A +  L LIA+F++S+ PIG   +    AK FF++Y
Sbjct: 446 KAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSY 505

Query: 577 LAMPILIVFYFGYKIYNR----DWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKN 632
           L   I+++ +  +K+Y R     W      K+IDL T R   D              LK 
Sbjct: 506 LCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

Query: 633 GPTWKRLVHFWC 644
            P   R  HFWC
Sbjct: 566 KPWIVRWYHFWC 577

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  355 bits (910), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/529 (36%), Positives = 293/529 (55%), Gaps = 17/529 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           + ++L+++++PRH++M ++           +G A+ + GP G+V+G+ I G+ +   I  
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+ V +  + G F  Y T  +D    F V+ +Y +QW  V+PLE++ A+MT+ YW + 
Sbjct: 135 LGEITVRFP-VVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSS 193

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++                  GA+G+ EA+F F+T K + + GF IL             +
Sbjct: 194 IDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEF 253

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IGAKYWHDPG        + F  V+          G  E   + AS +++P+  +P A K
Sbjct: 254 IGAKYWHDPGCLA-----NGFPGVLAVLVVASYSLGGIEMTCL-ASGETDPK-GLPGAIK 306

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            + +RILF FL+S+ LVGFLVPY +  L+G  S     SP+V+A+  H ++V+P  +NAV
Sbjct: 307 QVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS--VDNSPFVIAMKLHHIKVLPTIVNAV 364

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL++VLSV NS  ++S R L S++ QG  P WF YIDR GRP   ++ + LFG++AF   
Sbjct: 365 ILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVK 424

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S    +VF WL+AI+GL+    W++I LSHIRFR AM  QG+S+ EL F S +G+WGS Y
Sbjct: 425 SGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAY 484

Query: 543 AATMLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----D 595
           +A +  L LIA+F+ S+ PIG        AK FF+NYL   I++  +  +KIY +     
Sbjct: 485 SALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGK 544

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           W      K+IDL T R   D              L + P + R  HFWC
Sbjct: 545 WWGVKSLKDIDLETDRKDIDIEIIKQEIMERKMHLDSRPWYVRQFHFWC 593

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  350 bits (899), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 290/526 (55%), Gaps = 17/526 (3%)

Query: 126 HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGE 185
           +L+++++ RH++M ++           +G AL   GP  L+IG++I GT +   I   GE
Sbjct: 84  NLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGE 143

Query: 186 MAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNN 245
           + V +  + G F  Y T  +D    F ++ +Y IQW  V+PLE++ ++MTI YW   ++ 
Sbjct: 144 ITVRFP-VVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDP 202

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
                            GA+G+ EA+F F++ KV+ I GF IL             ++GA
Sbjct: 203 VVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGA 262

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           +YWHDPG          F  V+          G +E + + AS ++NPR  +PSA K   
Sbjct: 263 RYWHDPGCLS-----HGFPGVLSVLVVASYSLGGTEMVCL-ASGETNPRE-LPSAIKQTF 315

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           +RILF FL S+ L+GFLVPY +  L+G  S     SP+V+AI  H ++ +P  +NAVIL+
Sbjct: 316 WRILFFFLISLTLIGFLVPYTNPNLLGGSS--VNNSPFVIAIKLHHIKALPSIVNAVILI 373

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           +++SV NS  ++S R L S++ QG  P++F YIDR GRP   ++ + LFG++AF   SS 
Sbjct: 374 SIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSS 433

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
             EVF WL+AI+GL+    W++I +SHIRFR AM  QG+S+ EL F S +G+WGS Y+A 
Sbjct: 434 MGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSAL 493

Query: 546 MLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----DWKL 598
           +  L LIA+F+ ++ PIG   +    AK+FF++YL   I+   +  +K++ R     W  
Sbjct: 494 INSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWWA 553

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            +    IDL T R   D              L+  P + R  HFWC
Sbjct: 554 IMDLDKIDLETDRKNIDIDVLKQEIAERNRHLQASPWYVRWYHFWC 599

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  348 bits (894), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/526 (37%), Positives = 294/526 (55%), Gaps = 17/526 (3%)

Query: 126 HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGE 185
           +L+KS++ RH++M ++           +G AL   GP  L+IG+ + GT +   I   GE
Sbjct: 72  NLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHGLGE 131

Query: 186 MAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNN 245
           + V +  + G F  Y T  ++    F V  +Y +QW  V+PLE++ A+MT++YW + V  
Sbjct: 132 ITVRFPVV-GAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPP 190

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
                            G +G+ EA+F F+  KVL I GF IL             ++GA
Sbjct: 191 VAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGA 250

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           KYW DPG        + FK V           G +E +A  AS +++P+  +PSA K + 
Sbjct: 251 KYWSDPGPLA-----NGFKGVAAVFVIASYSLGGTE-MACLASGETDPKE-LPSAIKQVF 303

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           +RI+F FL S+ LVGFLVPY +  LMG  S     SP+V+AI  HG++ +P  +NAVIL+
Sbjct: 304 WRIVFFFLVSLTLVGFLVPYTNENLMGGSS--VDNSPFVIAIRLHGIKALPSVVNAVILV 361

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           ++LSV NS  ++S R L S++ QG  P+ F YIDR GRP   ++ ++ FG++AF   SS 
Sbjct: 362 SLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSS 421

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
            ++VFTWL+AI+GL+    W++I +SHIRFR AM  QG S+ EL F S +GV+GSVY+AT
Sbjct: 422 SDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSAT 481

Query: 546 MLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----DWKL 598
           +  L L+A+F+VS+ P+G         ++FF+NYL   IL++ + G+KIY R     W  
Sbjct: 482 INVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYYRISTGKWWG 541

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           F   ++IDL+T   + D              L   P   RL H WC
Sbjct: 542 FKALRDIDLLTDMRVTDTELSKHELHEKRVKLAQKPLIVRLYHQWC 587

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/529 (35%), Positives = 293/529 (55%), Gaps = 17/529 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           + ++L+++++PRH++M ++           +G A+ + GP G+V+G+ I G+ +   I  
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 133

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+ V +  + G F  Y T  +D    F V+ +Y +QW  V+PLE++ A+MT+ YW + 
Sbjct: 134 LGEITVRFP-VVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSS 192

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++                  G +G+ EA+F F+T K + + GF IL             Y
Sbjct: 193 IDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEY 252

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           +GAKYW+DPG        + F  ++          G  E   + AS +++P+  +PSA K
Sbjct: 253 VGAKYWYDPGCLA-----NGFPGILSVLVVASYSLGGIEMTCL-ASGETDPK-GLPSAIK 305

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            + +RILF FL S+ LVGFLVPY +  L+G  S     SP+V+AI  H ++V+P  +N V
Sbjct: 306 QVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS--VDNSPFVIAIKLHHIKVLPSIVNVV 363

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL++VLSV NS  ++S R L S++ QG  P WF YIDR GRP   ++ + LFG++AF   
Sbjct: 364 ILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVK 423

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S    +VF WL+AI+GL+    W++I +SHIRFR AM  QG+ + EL F S +G+WGS Y
Sbjct: 424 SGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAY 483

Query: 543 AATMLFLALIAEFWVSIAPIG--EDHLD-AKSFFENYLAMPILIVFYFGYKIYNR----D 595
           +A +  L L+A+F+ S+ PIG  ++  D AK FF+NYL   I++  +  +KIY +     
Sbjct: 484 SALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQTGQ 543

Query: 596 WKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           W      K+IDL T R   D              L + P + R  H+WC
Sbjct: 544 WWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLDSCPWYVRHFHYWC 592

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  345 bits (886), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 214/654 (32%), Positives = 326/654 (49%), Gaps = 72/654 (11%)

Query: 1   MSSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSY 60
           M+  N A + D     +   E    SKL  +S N+   E+     GK +  + S E+   
Sbjct: 1   MTDRNLAMEMDIERKGSSSTETCSDSKLNTKSHNEYTYES-----GKCSLLNGSTEER-- 53

Query: 61  AGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITS 120
                      K   ++R IDSFK   +G+ +  +M                        
Sbjct: 54  -----------KRNVVQRVIDSFKPPVDGSFDPSNM------------------------ 78

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
                  +++++ RH++M ++           +G AL   GP  L+IG+ + GT +   I
Sbjct: 79  -------KRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTI 131

Query: 181 QACGEMAVSYSNLP--GNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
              GE+ V    LP  G F  Y T  +D    F ++ +Y +QW  V+PLE++ + +T+ +
Sbjct: 132 HGLGELTV---RLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRF 188

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           WT  V+                  G +G+ EA+F F++ KV+ I GF IL          
Sbjct: 189 WTQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGP 248

Query: 299 TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
           T  Y+G++YWHDPG        + FK V           G SE   + AS +++P+  +P
Sbjct: 249 THQYVGSRYWHDPGPLA-----NGFKGVAAVMVTASYSLGGSEMTCL-ASGETDPKE-LP 301

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHF 418
            A K + +RILF FL S+ LVGFLVPY +  L+G  S   + SP+VLA+  H V+VVPH 
Sbjct: 302 HAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSSA--ENSPFVLALYLHHVKVVPHI 359

Query: 419 INAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIA 478
           +N VIL+++LSV NS  ++S R L S++ QG  P  F Y+DR GRP   ++ + +FG++A
Sbjct: 360 VNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLA 419

Query: 479 FCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVW 538
           F    S    VF+WL+AI+GL+    W++I +SH+RFR AM  Q +S+ EL F S +GVW
Sbjct: 420 FLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVW 479

Query: 539 GSVYAATMLFLALIAEFWVSIAPIGEDHLDAKS----FFENYLAMPILIVFYFGYKIYNR 594
           GSVYA  + FL L+A+F++++ P+ E   D+KS    FF+NYL   ILI  +  +K Y R
Sbjct: 480 GSVYAGVLNFLTLVAQFYIALWPV-EGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFR 538

Query: 595 ----DWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
                W    +   +DL T R   D              L+N   + R  ++WC
Sbjct: 539 ITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAWYTRYYYYWC 592

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  342 bits (876), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/570 (33%), Positives = 302/570 (52%), Gaps = 19/570 (3%)

Query: 83  FKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLA 142
            K+     EE++ +          +   I      +    +  +L+++++ RH++M ++ 
Sbjct: 24  LKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAIG 83

Query: 143 XXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPT 202
                     +G AL   GP  ++IG+ + GT +   I   GE+ V +  + G F  Y T
Sbjct: 84  GSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFP-VVGAFANYST 142

Query: 203 FLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXX 262
             +D    F V+ +Y +QW  V+PLE++ +++T+++WTT V+                  
Sbjct: 143 RFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLF 202

Query: 263 GAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSIDR 322
           G + + +  F F+  K++ I GF IL          T  +IGA+YWHDPGA       + 
Sbjct: 203 GVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALA-----NG 257

Query: 323 FKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFL 382
           FK V           G SE   + AS +++P+  IP A K + +RI+F FL S+ LVGFL
Sbjct: 258 FKGVAAVMVTASYSLGGSEMTCL-ASGETDPKE-IPHAIKQIFWRIIFFFLVSLTLVGFL 315

Query: 383 VPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRIL 442
           VPY + +L+G  +     SP+V+AI  H +RV+PH IN VIL+++LSV NS  ++S R L
Sbjct: 316 VPYTNDQLLGGSN--VNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTL 373

Query: 443 FSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQI 502
            S++ QG  P+ F Y+DR GRP   ++ + LFG++AF   SS    VFTWL+A++GL+  
Sbjct: 374 CSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATA 433

Query: 503 FTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPI 562
             W++I +SHIRFR AM  QG+S+ EL F S +G+WGSVY+  M  + L+A+F+VS+ PI
Sbjct: 434 VVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPI 493

Query: 563 ---GEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD-----WKLFIRAKNIDLITHRNIF 614
               +     ++FF+NYL   IL+  +  +KIY R      WK+   A+ IDL + R   
Sbjct: 494 EGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAE-IDLESGRKNI 552

Query: 615 DAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           D              +     + R  H+WC
Sbjct: 553 DIEVVKHEVAARKKYISEQRWYIRYYHYWC 582

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  332 bits (850), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/526 (36%), Positives = 290/526 (55%), Gaps = 17/526 (3%)

Query: 126 HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGE 185
           +L++ ++ RH++M ++           +G AL   GP  ++IG++I G+ +   I   GE
Sbjct: 69  NLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGE 128

Query: 186 MAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNN 245
           + + +  + G F  Y T L+D    F V+ +Y  QW  V+P+EL+ ++MT+ +WTTKV+ 
Sbjct: 129 ITMRFP-VVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDP 187

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
                            G K + EA+F F+  KV+ I GF IL             +IG 
Sbjct: 188 VVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGT 247

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           +YWH PGA       + FK V           G SE + +  S +++P+  +P A K + 
Sbjct: 248 EYWHHPGALA-----NGFKGVASVFVTASYSLGGSEMVCL-CSAETDPKE-LPHAIKQVF 300

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILL 425
           +RI+F FL S+ LVGFLVPY +  L+G  S     SP+V+AI   G+RV+P  INAVIL+
Sbjct: 301 WRIVFFFLVSLTLVGFLVPYTNENLLGGSS--VNNSPFVIAIKLSGIRVLPSIINAVILI 358

Query: 426 AVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSK 485
           ++LSV NS  ++S R L S++ QG  P+ F Y+DR GRP   +I++ LFG++AF   S+ 
Sbjct: 359 SILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSAS 418

Query: 486 EEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAAT 545
              VF WL+AI+GL+    W++I +SHIRFR AM  Q RS+ EL F+S +GV+GS+Y+AT
Sbjct: 419 MGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSAT 478

Query: 546 MLFLALIAEFWVSIAPIG---EDHLDAKSFFENYLAMPILIVFYFGYKIYNR----DWKL 598
           +  L LIA+F++S+ P+G         +SFF+NYL   +L+  +  +KIY +     W  
Sbjct: 479 VNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFD 538

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           F     IDL T R   D              L + P + R  +FWC
Sbjct: 539 FKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRFYNFWC 584

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/561 (35%), Positives = 290/561 (51%), Gaps = 67/561 (11%)

Query: 3   SSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAG 62
           SSN+A  D+           K A     RSF   +      Y           ED     
Sbjct: 10  SSNSAKTDE-----------KSAFATTERSFVATKKHGAYHY-----------EDDQVQP 47

Query: 63  RKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKE 122
            KK Y    K     R IDSFK  E G                              S +
Sbjct: 48  NKKAY----KRNLFHRCIDSFKPPENG------------------------------SFD 73

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            D+ L++S++ RH++M ++           +G AL   GP  ++IG+ I GT +   I  
Sbjct: 74  PDS-LKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHG 132

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GE+ V +  + G F  Y T  +D    F V+ +Y +QW  V+PLE++ ++MTI +W T 
Sbjct: 133 LGEITVRFP-VVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTS 191

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           ++                  G +G+ EA+F F++ KV+ I+GF IL          T  Y
Sbjct: 192 IDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEY 251

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           +GA+YWHDPGA         FK V           G SE +A  AS +++P+  +PSA K
Sbjct: 252 VGARYWHDPGALA-----HGFKGVASVFVTASYSLGGSE-MACLASGETDPKE-LPSAIK 304

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAV 422
            + +RI+F FL S+ LVGFLVPY +  L+G  S     SP+V+A + + ++V+P  INAV
Sbjct: 305 QVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS--VNNSPFVIACNLYHIKVLPSIINAV 362

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL++++SV NS  ++S R L S++ QG  PQ F Y+DR GRP   +I + LFG++AF   
Sbjct: 363 ILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVK 422

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           SS   EVF WL+AI+GL+    W++I +SHIRFR AM  Q +++ EL F S +G+WGSVY
Sbjct: 423 SSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVY 482

Query: 543 AATMLFLALIAEFWVSIAPIG 563
           +A +  L LIA+F++S+ P+G
Sbjct: 483 SAVVNVLILIAQFYISLWPVG 503

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  317 bits (813), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 185/545 (33%), Positives = 293/545 (53%), Gaps = 20/545 (3%)

Query: 112 KEHDVAITSKEEDAHLRKSIQP-------RHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           ++ ++    ++E    R + QP       RH+ M ++            G +L  +GP  
Sbjct: 48  EDQEINDVPEQERIQRRLASQPYQKVLDQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPGA 106

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           L+IG+ ++GT ++C++Q+  E++  Y  + G++  + +  VDE  GF V+  Y + WL  
Sbjct: 107 LLIGFLLVGTSMFCVVQSAAELSCQYP-VSGSYATHVSRFVDESVGFTVSTNYALAWLIS 165

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
            P EL+  S+TI YW   VN                  G +G+AE +FF +  KVL I  
Sbjct: 166 FPSELIGCSITITYWNQSVNPAVWVAIFYIFIMGLNLFGVRGFAETEFFLSIIKVLAIII 225

Query: 285 FFILXXXXXXXXXX-TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFI 343
           F I+           +SGYIG KYWH PG+F    +   FK++           G SE +
Sbjct: 226 FIIIGIVLIAGGGPDSSGYIGTKYWHQPGSF----AQPVFKNLCNTFVSAAFSFGGSELV 281

Query: 344 AIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASP 402
            + ++E  N   +I  AAK   +RI   +++++ ++G LVPY    L+ GS S    ASP
Sbjct: 282 LLTSTEARNVS-SIARAAKGTFWRIAVFYITTVVIIGCLVPYTDERLLNGSSSEDVSASP 340

Query: 403 YVLAISSHGVR--VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDR 460
           +V+A+S+ G     V +F+N +IL+AVLSV NS  Y+S RI+ +L   G  P+  ++ID+
Sbjct: 341 FVIALSNSGSMGGKVANFMNVIILIAVLSVCNSCVYASSRIIQALGAAGQLPKACSFIDK 400

Query: 461 EGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMH 520
           +GRP   + IS +FG++ F     KE EVFTWL A+  +S  FTW  ICLS +RFR A+ 
Sbjct: 401 KGRPLVGIAISGVFGLLGFLVACDKEGEVFTWLFALCSISSFFTWFCICLSQVRFRMALR 460

Query: 521 VQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMP 580
            QGR  S++ ++S LGV+G +    + FL +  E +V+ +P+G +   A+ FFE  L++P
Sbjct: 461 AQGRPKSDIAYKSMLGVYGGIVGCVLNFLLIAGEIYVASSPVGGES-SARGFFEYCLSIP 519

Query: 581 ILIVFYFGYKIYNRDW-KLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRL 639
           I+IV YFG++ Y  DW   +I+ +NIDL T  +I +              + + P + R+
Sbjct: 520 IMIVVYFGHRFYRNDWGNWYIKRRNIDLDTGCSIENVELFRQQREQEQEKISSRPFYYRI 579

Query: 640 VHFWC 644
             FWC
Sbjct: 580 YRFWC 584

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  307 bits (787), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 171/469 (36%), Positives = 253/469 (53%), Gaps = 41/469 (8%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRH 135
           L+R +DSFK  E+G+  + +                               L+KS++ RH
Sbjct: 53  LQRMVDSFKPPEDGSFHSDN-------------------------------LKKSLKARH 81

Query: 136 VLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPG 195
           ++M ++           +G AL   GP  L+IG+ I GT +   I   GE+ V +  + G
Sbjct: 82  LVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVV-G 140

Query: 196 NFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXX 255
            F  Y T  ++    F V  +Y +QW  V+PLE++ A+MT++YW T V+           
Sbjct: 141 AFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGI 200

Query: 256 XXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR 315
                  G +G+ EA+F F+  KV+ I GF IL             ++GAKYWHDPG   
Sbjct: 201 IALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLA 260

Query: 316 GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSS 375
                + FK V           G +E   + AS +++P+  +PSA K + +RI+F FL S
Sbjct: 261 -----NGFKGVAGVLVIASYSLGGTEMACL-ASGETDPKE-LPSAIKQVFWRIVFFFLVS 313

Query: 376 IALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAF 435
           + LVGFLVPY +  LMG  S     SP+V+AI  HG+  +P  +NAVIL+++LSV NS  
Sbjct: 314 LTLVGFLVPYTNQNLMGGSS--VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCI 371

Query: 436 YSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLA 495
           ++S R L S++ QG  P+ F YIDR GRP   ++ ++LFG++AF   S    +VFTWL+A
Sbjct: 372 FASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMA 431

Query: 496 ISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAA 544
           I+GL+    W++I +SHIRFR AM  QG  + EL F S +G++GSVY+A
Sbjct: 432 IAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSA 480

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  307 bits (787), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 171/469 (36%), Positives = 253/469 (53%), Gaps = 41/469 (8%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRH 135
           L+R +DSFK  E+G+  + +                               L+KS++ RH
Sbjct: 53  LQRMVDSFKPPEDGSFHSDN-------------------------------LKKSLKARH 81

Query: 136 VLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPG 195
           ++M ++           +G AL   GP  L+IG+ I GT +   I   GE+ V +  + G
Sbjct: 82  LVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVV-G 140

Query: 196 NFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXX 255
            F  Y T  ++    F V  +Y +QW  V+PLE++ A+MT++YW T V+           
Sbjct: 141 AFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGI 200

Query: 256 XXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR 315
                  G +G+ EA+F F+  KV+ I GF IL             ++GAKYWHDPG   
Sbjct: 201 IALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLA 260

Query: 316 GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSS 375
                + FK V           G +E   + AS +++P+  +PSA K + +RI+F FL S
Sbjct: 261 -----NGFKGVAGVLVIASYSLGGTEMACL-ASGETDPKE-LPSAIKQVFWRIVFFFLVS 313

Query: 376 IALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAF 435
           + LVGFLVPY +  LMG  S     SP+V+AI  HG+  +P  +NAVIL+++LSV NS  
Sbjct: 314 LTLVGFLVPYTNQNLMGGSS--VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCI 371

Query: 436 YSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLA 495
           ++S R L S++ QG  P+ F YIDR GRP   ++ ++LFG++AF   S    +VFTWL+A
Sbjct: 372 FASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMA 431

Query: 496 ISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAA 544
           I+GL+    W++I +SHIRFR AM  QG  + EL F S +G++GSVY+A
Sbjct: 432 IAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSA 480

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  310 bits (795), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 186/552 (33%), Positives = 292/552 (52%), Gaps = 20/552 (3%)

Query: 105 SPLSAAIKEHDVAITSKEEDAHLRKSIQP-------RHVLMSSLAXXXXXXXXXXNGSAL 157
           S LS   ++ D    ++ E   LR + QP       RH+ M ++            G+AL
Sbjct: 41  SELSQIPEDLDYHDLTEREKIQLRLANQPYQKVLHQRHLSMIAIGGTLGTGLFIGLGAAL 100

Query: 158 HKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVY 217
             +GPA L+IGY ++GT ++C+IQ+  E+A  +  + G++ ++ +  VDE  GF VA  Y
Sbjct: 101 -TSGPAALLIGYLLVGTSMFCVIQSAAELACQFP-VSGSYASHVSRFVDESLGFTVATNY 158

Query: 218 CIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTC 277
            + WL + P EL+  S+TI YW + +N                  G + +AE +F  +  
Sbjct: 159 TLAWLVLFPSELIGCSLTISYWNSSINPAVWVSIFLVFVLWINLFGVRIFAETEFILSII 218

Query: 278 KVLMITGFFILXXXXXXXXXX-TSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXX 336
           KVL I  F I+             GYIG KYWHDPG F    +   FK++          
Sbjct: 219 KVLAIIIFIIIGIVLIAGGGPDPGGYIGTKYWHDPGPF----AKPVFKNLCQTFVAAAFS 274

Query: 337 XGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGS 395
            G +E + +  +E  N   +I  AAK   YRI   +++++ ++G LVPY+   L+  S S
Sbjct: 275 FGGTEMVLLTGTESKN-VSSIARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSS 333

Query: 396 GGTKASPYVLAISSHGVR--VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQ 453
               ASP+V+A+S+ G     V HF+NAVIL+AV+SV NS  Y+S R++ +L   G  P+
Sbjct: 334 EDISASPFVIALSNTGSMGAKVSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPK 393

Query: 454 WFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHI 513
            F Y+DR+GRP   + +S  FG++ F   + K+ EVFTWL A+  ++   TW +ICL+ +
Sbjct: 394 IFGYMDRKGRPLVGIAVSATFGLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQV 453

Query: 514 RFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFF 573
           R+R AM  + RS+  + ++S LG+WG V    + FL +  E +VS  P       A+ FF
Sbjct: 454 RYRMAMRARKRSLDSIAYKSILGIWGGVVGCIVNFLLVAGEVYVSAFPANAKS-SAEGFF 512

Query: 574 ENYLAMPILIVFYFGYKIYNRDW-KLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKN 632
           +  L++PI+IV + G+KI+  DW   +++ K++DL T  +I D              L +
Sbjct: 513 KYTLSIPIMIVVFLGHKIHRNDWGNWYVKRKDMDLDTGCSIEDFELFQAQKEAEKRALAS 572

Query: 633 GPTWKRLVHFWC 644
            P + R+  FWC
Sbjct: 573 RPLYYRVYRFWC 584

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  310 bits (793), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 184/526 (34%), Positives = 283/526 (53%), Gaps = 13/526 (2%)

Query: 124 DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQAC 183
           D  LRK++Q RH+ M ++            G +L  +GP  L+IGY I+G  ++C++Q+ 
Sbjct: 63  DQPLRKTLQQRHLTMIAIGGTLGTGLFIGLGESL-ASGPGSLLIGYIIVGIAVFCVVQSA 121

Query: 184 GEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKV 243
            E++  Y  + G++    T  ++E FGF VA  YC+ WL   P ELV ++M I YW   V
Sbjct: 122 AELSCQYP-VSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIRYWNDSV 180

Query: 244 NNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS-GY 302
           N+                 G +GYAE +F+ +  K++ I  F I+           S GY
Sbjct: 181 NSCVWIAIFWVFVMCLNLFGVEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGGPNSTGY 240

Query: 303 IGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 362
           IG KYWHDPG+F    +   FK +           G  E + + ++E S    +I  AAK
Sbjct: 241 IGTKYWHDPGSF----AHPVFKSLCNTFVSAAYSFGGCEIVVLTSAE-SRKISSIARAAK 295

Query: 363 IMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGV--RVVPHFI 419
              +RI   +L +I ++G LVPY  ++L+  + S    ASP+V+A+S+ G     V HF+
Sbjct: 296 GTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGTRVSHFM 355

Query: 420 NAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAF 479
           N VIL++ +SVSNS  Y+S RI+ +L      P    YIDR GRP   + I  LFG++ F
Sbjct: 356 NTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGLFGLLGF 415

Query: 480 CACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWG 539
              +  E  +FTWL +++ ++   TW +IC   +RFR A+  QGRS  E+ ++S LG++G
Sbjct: 416 LVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKSMLGIYG 475

Query: 540 SVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-L 598
               A +  + +I E ++SI P+ E    A  FF+N L++PI++V +FG+KIY + WK  
Sbjct: 476 GYVGAILNIVLIIGEVYISIFPLNESP-SANIFFQNCLSIPIMLVSFFGHKIYCKGWKDW 534

Query: 599 FIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           F+RAK+IDL T  +I D              + + P + R+  FWC
Sbjct: 535 FVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  302 bits (774), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 193/585 (32%), Positives = 304/585 (51%), Gaps = 40/585 (6%)

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSI 131
           K   L RF DSFKR +                   L A I E D   T+ EE   LR + 
Sbjct: 29  KGTFLYRFRDSFKRVD-------------------LDATIDEDDSKYTA-EEKVQLRLAK 68

Query: 132 QP-------RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACG 184
           QP       RH+ M ++            G +L  +GP  L+IG+ ++G  ++C++Q+  
Sbjct: 69  QPLKKALMQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPGCLLIGFILVGLSMFCVVQSAA 127

Query: 185 EMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN 244
           E++  Y  + G++  + T  +DE  GF V+  Y + WL   P EL+ ++M I YW   V+
Sbjct: 128 ELSCQYP-VSGSYATHVTRFIDESIGFTVSTNYALAWLISFPSELMGSAMVIQYWNDSVD 186

Query: 245 NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX-XTSGYI 303
                             G +G+AE +F+ +  K+L I  F I+           +SGYI
Sbjct: 187 PAVWIAIFYLFVMFLNLFGVEGFAETEFWLSIIKILAIIIFIIIGIVLICGGGPGSSGYI 246

Query: 304 GAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKI 363
           G KYWH+PG+F    +   FK +           G +E + + A+E S    AI  AAK 
Sbjct: 247 GTKYWHNPGSF----AHPVFKSLCNTFVSAAFSFGGAELVLLTAAE-SKKISAISRAAKG 301

Query: 364 MIYRILFIFLSSIALVGFLVPYDSSELMGSGSG-GTKASPYVLAISSHGV--RVVPHFIN 420
             +RI   +++++ ++G LVPY    L+G+ S     ASP+V+A+++ G     V +F+N
Sbjct: 302 TFWRIAVFYITTVVIIGCLVPYTDERLLGASSDEDVTASPFVIALTNAGSMGSSVANFMN 361

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
            +IL+AV+SV NS  Y+S R++ +L   G  P+   YID++GRP   ++I  +FG++AF 
Sbjct: 362 VIILVAVISVCNSCVYASSRVIQALGSAGQLPRICGYIDKKGRPLVGIVICGIFGLLAFL 421

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
              S+E  VFTWL A+  +S  FTW  IC S +R+R A+  Q RS  E+ ++S LG++G 
Sbjct: 422 IDCSEEGTVFTWLFALCSISSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSMLGIYGG 481

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LF 599
           +  + +  L ++ E +VSI+P+ E    A +FFEN L++PI+IV Y  +K Y + W+ LF
Sbjct: 482 ILGSLLNILLIMGELYVSISPLDESP-SASAFFENCLSIPIMIVVYIFHKTYKKGWRSLF 540

Query: 600 IRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           I  K+IDL T R + +              + + P + R+  FWC
Sbjct: 541 IPLKHIDLDTGRAVENLALFKQQREEQKIIIASKPFYYRVYRFWC 585

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  302 bits (773), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 187/574 (32%), Positives = 286/574 (49%), Gaps = 26/574 (4%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRH 135
           LKRF DSFK+ E    E   +        +    A + +             ++++  RH
Sbjct: 34  LKRFRDSFKKHEPILPENVDLSQMEDYERTNYLLAHQPY-------------KRTLSQRH 80

Query: 136 VLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPG 195
           + M S+            G +L  +GP  L+IG+ I+G  ++C++Q   E++  Y  + G
Sbjct: 81  LTMISIGGTLGTGLFIGLGYSL-TSGPGNLLIGFTIIGISIFCVVQCAAELSCQYP-VSG 138

Query: 196 NFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXX 255
           +F  + +  +D   GF V+  Y + WL   P EL+  ++T+ YW   VN           
Sbjct: 139 SFATHVSRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYWNDSVNPAVWIAIFYVF 198

Query: 256 XXXXXXXGAKGYAEADFFFN-TCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF 314
                  G +G+AE +F+ +      ++    I           ++GYIGAKYWHDPGAF
Sbjct: 199 IMCLNLFGVRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGAKYWHDPGAF 258

Query: 315 RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLS 374
                   FK +           G +E + + A+E S    +I  AAK   +RI   +++
Sbjct: 259 VKPV----FKGLCNTFVSAAFSFGGAELVVLTANE-SRKIESISRAAKGTFWRIAVFYIT 313

Query: 375 SIALVGFLVPYDSSELMGSGSG-GTKASPYVLAISSHGV--RVVPHFINAVILLAVLSVS 431
           ++ ++G LVP     L+G+ S     ASP+V+A+S+ G     V HF+NAVIL+AVLSV 
Sbjct: 314 TVVIIGCLVPSTDERLLGAASDVDVTASPFVIALSNTGSFGDKVSHFMNAVILIAVLSVC 373

Query: 432 NSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFT 491
           NS  Y++ R++ SL      P +  YIDR+GRP   + I  +FG++ F   SSKE EVFT
Sbjct: 374 NSCVYAASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFGLLGFLVASSKEGEVFT 433

Query: 492 WLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLAL 551
           WL A+  +S  FTW  IC S +RFR A+  QGRS  E+ ++S LG WG V    +  L +
Sbjct: 434 WLFALCSISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGCVLNILLI 493

Query: 552 IAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRAKNIDLITH 610
             E +VS+ P+G    +A+ FF+  L++PI+I  YF ++IY  +W    I  K IDL T 
Sbjct: 494 AGEIYVSLFPLGGSP-NAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTKKIDLDTG 552

Query: 611 RNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           R   D              + + P + R+  FWC
Sbjct: 553 RKAEDLELMKHEILTEKARIASKPLYYRIYRFWC 586

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  299 bits (766), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/549 (33%), Positives = 286/549 (52%), Gaps = 22/549 (4%)

Query: 110 AIKEHDVAITSKEEDAH---------LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKA 160
           A++  DV ++  +E            L+K++  RH++M ++            G +L  +
Sbjct: 59  AVEYADVDLSMMDEQQRRNYVLANQPLQKTLSQRHLMMIAIGGTLGTGLFIGIGYSL-SS 117

Query: 161 GPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQ 220
           GP  L+IG+ I+G  ++C++Q+  E+A  Y  + G++  + +  ++   GF VA  Y + 
Sbjct: 118 GPGSLLIGFLIVGLMMFCVVQSAAELACQYP-VSGSYAVHVSRFMEPSIGFTVATNYALA 176

Query: 221 WLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVL 280
           WL   P EL+  +MT+ YW   VN                  G + Y EA+F+ +  KV+
Sbjct: 177 WLISFPSELIGCAMTLQYWNKSVNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVV 236

Query: 281 MITGFFILXXXXXXXXXXTS-GYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGA 339
            I  F I+           S GYIG KYWHDPG+F    +   FK +           G 
Sbjct: 237 AIVIFIIIGIVLICGGGPNSTGYIGTKYWHDPGSF----AKPVFKGLCNTFVSAAFSFGG 292

Query: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSG-GT 398
           +E + + ASE S    ++  AAK   +RI   +++++ ++G LVPY + +L+G  +    
Sbjct: 293 AELVVLTASE-SRKVESVSRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDEDI 351

Query: 399 KASPYVLAISSHGV--RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFN 456
            ASP+V+A+S  G       HF+N VIL+AVLSV NSA Y+S RI+ +L   G  P+   
Sbjct: 352 TASPFVIALSGQGSMGTKASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICG 411

Query: 457 YIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFR 516
           Y+D++GRP   + I  +FG++ F   S  E +VFTWL A+  +S  FTW  IC S +RFR
Sbjct: 412 YVDQKGRPLVGIAICGVFGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFR 471

Query: 517 RAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENY 576
            A+  QGRS  E+  +S LG++G      +  L +  E +VSI P+G D   AK FF+  
Sbjct: 472 FALRAQGRSSDEIAHKSMLGIYGGFLGCLLNALLIAGEIYVSIFPLGGDP-SAKQFFQYC 530

Query: 577 LAMPILIVFYFGYKIY-NRDWKLFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPT 635
           L++PI+I  Y G+K++ N+  ++ I A+ IDL T R I D              L + P 
Sbjct: 531 LSIPIMIAVYIGHKLFANKSKRVLIPAQEIDLETGRKIKDLEQFKHEVLEDKEKLASKPL 590

Query: 636 WKRLVHFWC 644
           + R+  FWC
Sbjct: 591 YYRIYRFWC 599

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  297 bits (761), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 176/537 (32%), Positives = 284/537 (52%), Gaps = 20/537 (3%)

Query: 120 SKEEDAHLRKSIQP-------RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           ++ E   L+ + QP       RH+ M S+            G+AL  +GPA L+IGY ++
Sbjct: 56  TEREKTQLKLASQPYKKVLSQRHLTMISIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLV 114

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           G  ++C+IQ+  E+A  +  + G+++++ T  VDE  GF V   Y + WL + P EL+  
Sbjct: 115 GASMFCVIQSASELACQFP-VTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGC 173

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
           S+TI YW + +N                  G + +AE +F  +  KVL I  F I+    
Sbjct: 174 SLTISYWNSTINPAVWVAIFLVFVLWINLFGVRLFAETEFVLSIIKVLAIVIFIIIGIVL 233

Query: 293 XXXXXXTSG-YIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS 351
                  SG YIG +YWHDPG F    +   FK++           G SE + +  +E  
Sbjct: 234 IAGGGQDSGGYIGTRYWHDPGPF----AKPVFKNLCNTFVSAAFSYGGSEMVLLTGTESK 289

Query: 352 NPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSH 410
           N   +I  AAK   YRI   +++++ ++G LVPY+   L+  S S    ASP+V+A+ + 
Sbjct: 290 NIS-SIARAAKGTFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSEDISASPFVIALGNT 348

Query: 411 GV--RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468
           G     V +F+NA+IL++V+SV NS  Y+S R++ +L   G+ P    Y+D +GRP   +
Sbjct: 349 GSMGSKVSNFMNAIILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGI 408

Query: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528
            I+  FG++ F   ++K+ EVFTWL A+  ++   TW  ICL+ +RFR AM  + RS   
Sbjct: 409 AITGAFGLLGFLVATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEH 468

Query: 529 LGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFG 588
           + +RS LG++G +    + FL +  E +VS  P+ +    A+ FFE  L++PI+I+ + G
Sbjct: 469 IAYRSMLGIYGGIAGCIVNFLLIAGEIYVSAWPV-DGKSSAEGFFEYDLSIPIMIIVFLG 527

Query: 589 YKIYNRDWK-LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +KIY  DWK  +++ +++DL T  +I +              L   P + R+  FWC
Sbjct: 528 HKIYRNDWKNWYVKRRDMDLDTGCSIENLELFQSQKESEKEDLACKPLYYRIYRFWC 584

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  296 bits (759), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 185/522 (35%), Positives = 285/522 (54%), Gaps = 13/522 (2%)

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K +  RH+ M ++            G +L  +GPA L+IG+ ++GT ++C++Q+  E++
Sbjct: 74  QKVLSQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPAALLIGFLLVGTSMFCVVQSAAELS 132

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             +  + G++  + +  +DE  GF VA  Y + WL   P EL+  ++TI YW   VN   
Sbjct: 133 CQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAV 191

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS-GYIGAK 306
                          G +G+AE +F  +  KV+ I  F I+           S GYIGAK
Sbjct: 192 WVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGAK 251

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YWHDPGAF    +   FK++           G SE + + ++E  N   AI  AAK   +
Sbjct: 252 YWHDPGAF----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKN-ISAISRAAKGTFW 306

Query: 367 RILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVR--VVPHFINAVI 423
           RI   +++++ ++G LVPY+   L+ GS S    ASP+V+A+S+ G     V +F+N VI
Sbjct: 307 RIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVI 366

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           L+AV+SV NS  Y+S R++ +L   G  P   +Y+DR+GRP   + IS  FG++ F   S
Sbjct: 367 LVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVAS 426

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
            KE+EVFTWL A+  +S  FTW  IC+S IRFR A+  QGRS  E+ ++S LGV+G +  
Sbjct: 427 KKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILG 486

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLF-IRA 602
             +  L +  E +VS AP+G     A++FFE  L++PI+IV YF ++ Y RDWK F I+ 
Sbjct: 487 CVLNALLIAGEIYVSAAPVGSPS-SAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKR 545

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
             IDL T  ++ +              + + P + ++  FWC
Sbjct: 546 SEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC 587

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  297 bits (760), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 180/574 (31%), Positives = 291/574 (50%), Gaps = 25/574 (4%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRH 135
            +RF DSF R +                 S L       D  I         +KS+  RH
Sbjct: 51  FERFKDSFTRVDN------------IEPYSELDGDKYTKDEQIQMTLAAQPYKKSLHQRH 98

Query: 136 VLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPG 195
           + M ++            G +L  +GPA L+IG+ I+GT ++C++Q+  E++  Y  + G
Sbjct: 99  LTMIAIGGTLGTGLFIGLGYSL-ASGPASLLIGFLIVGTSMFCVVQSAAELSCQYP-VSG 156

Query: 196 NFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXX 255
           ++  + +  +DE  GF V+  Y + WL   P EL+  SMTI YW   +N           
Sbjct: 157 SYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMTISYWNDSINPCVWIAIFYVF 216

Query: 256 XXXXXXXGAKGYAEADFFFN-TCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF 314
                  G KG+AE +F+ +    + +I    +           +SGYIG KYWHDPG+F
Sbjct: 217 IMILNLFGVKGFAETEFWLSLIKVIAIIIFIIVGIVLICGGGPESSGYIGTKYWHDPGSF 276

Query: 315 RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLS 374
               +   FK +           G SE + + A+E  N   AI  AAK   +RI   +++
Sbjct: 277 ----APPVFKGLCNTFVSAAFSFGGSELVLLTAAESKNIS-AISRAAKGTFWRIAVFYIA 331

Query: 375 SIALVGFLVPYDSSELMGSGSG-GTKASPYVLAISSHG--VRVVPHFINAVILLAVLSVS 431
           ++ ++G LVPY+   L+G  S     ASP+VLA+ S     R + +F+N VIL+AV+SV+
Sbjct: 332 TVVIIGCLVPYNDRRLLGGASDEDVSASPFVLALGSSTDLGRKLSNFMNFVILIAVVSVA 391

Query: 432 NSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFT 491
           NS  Y+S R++ +L   G  P    YID+ GRP   + I  +FG++ F   SS E  VFT
Sbjct: 392 NSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAICGVFGLLGFLVASSNERTVFT 451

Query: 492 WLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLAL 551
           WL A+  +S  FTW  IC S +RFR A+  Q RS  ++ F+S LG++G +  + +  L +
Sbjct: 452 WLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKSMLGIYGGILGSILNILLI 511

Query: 552 IAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRA-KNIDLITH 610
           + E +VS +P+GE    A++FFEN L++P++++ +  ++ Y ++W+ + ++   IDL T 
Sbjct: 512 MGEIYVSASPLGEPS-SAEAFFENCLSIPLMLLVFIAHRFYRKNWRDWYKSLDEIDLDTG 570

Query: 611 RNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            +  D              +++ P + ++  FWC
Sbjct: 571 CSYDDIELFKHQREQIKHKIQSKPLYYKIYRFWC 604

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  295 bits (756), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 170/522 (32%), Positives = 279/522 (53%), Gaps = 13/522 (2%)

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K +  RH+ M ++            G +L  +GPA L+IG+ ++G  + C++Q   E++
Sbjct: 70  KKVLSQRHLTMIAIGGTLGTGLFIGLGESL-ASGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             Y  + G++  + +  +D   GF++   Y + WL   P ELV  S+TI YW   VN   
Sbjct: 129 CQYP-VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAA 187

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX-TSGYIGAK 306
                          GA+G+AE++F+ +  K++ +  F I+           ++GYIG K
Sbjct: 188 WVAIAFVLSMLLNMFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPDSTGYIGTK 247

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YWHDPG+F    +   FK++             +E + + ++E  N   ++  AAK   +
Sbjct: 248 YWHDPGSF----APPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARNVS-SVSRAAKGTFW 302

Query: 367 RILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGV--RVVPHFINAVI 423
           RI+  ++ ++ ++G LVPY+ S L+ GS S    ASP+V+A+S+ G   + V HF+NAVI
Sbjct: 303 RIVIFYIVTVIIIGCLVPYNDSRLINGSSSEDITASPFVIALSNTGTMGKRVSHFMNAVI 362

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           L+AV SV NS  Y+S R++  L+  G  P+   Y+DR GRP   M I   FG++ F   S
Sbjct: 363 LIAVFSVCNSCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGLLGFLVVS 422

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
             +  VFTWL A+  +S   TW  IC   +RFR AM  QGRS  ++ +RS LG++G +  
Sbjct: 423 KNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGIVG 482

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRA 602
             +  L +I E +VS AP+G     A +FFE  +++PI+I  Y G++IY +DW+  +I+ 
Sbjct: 483 CILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKR 541

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           ++IDL +  ++ D              + + P + R+  F+C
Sbjct: 542 RDIDLDSGHSLEDFEATKLERDHDKRYVASRPLYYRIYRFFC 583

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  294 bits (753), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 168/522 (32%), Positives = 276/522 (52%), Gaps = 13/522 (2%)

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K +  RH+ M ++            G +L  +GPA L+IG+ ++G  + C++Q   E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESL-ASGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             Y  + G++  + +  +D   GF++   Y + WL   P ELV  S+TI YW   VN   
Sbjct: 129 CQYP-VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAA 187

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVL-MITGFFILXXXXXXXXXXTSGYIGAK 306
                          GA+G+AE++F+ +  K++ +     I           ++GYIG K
Sbjct: 188 WVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTK 247

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YWHDPG+F    ++  FK++             +E + + ++E +    ++  AAK   +
Sbjct: 248 YWHDPGSF----AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSVSSVSRAAKGTFW 302

Query: 367 RILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGV--RVVPHFINAVI 423
           RI+  ++ ++ ++G LVPY+   L+ GS S    ASP+V+A+S+ G     V HF+NAVI
Sbjct: 303 RIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVI 362

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           L+AV SV NS  Y+S R++  L+  G  P+   Y+DR GRP   M I   FG++ F   S
Sbjct: 363 LIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVS 422

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
             +  VFTWL A+  +S   TW  IC   +RFR AM  QGRS  ++ +RS LG++G ++ 
Sbjct: 423 KNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFG 482

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRA 602
             +  L +I E +VS AP+G     A +FFE  +++PI+I  Y G++IY RDW+  +I+ 
Sbjct: 483 CILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKR 541

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            +IDL +  ++ D              + + P + R+  F+C
Sbjct: 542 MDIDLDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC 583

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  292 bits (748), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 185/581 (31%), Positives = 292/581 (50%), Gaps = 39/581 (6%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQP-- 133
           LKR  DSFK++E                   L+   ++      S++E   L+ + QP  
Sbjct: 32  LKRLKDSFKQSE-------------------LAPIDEDSGFDGLSEKEKIQLKLASQPYE 72

Query: 134 -----RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAV 188
                RH+ M ++            G +L   GP  L+IG+ ++GT ++C++Q+  E++ 
Sbjct: 73  KVLSQRHLTMIAIGGTLGTGLFIGLGYSL-ACGPGALLIGFLLVGTSIFCVVQSAAELSC 131

Query: 189 SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXX 248
            +  + G++  + +  +D+  GF VA  Y + WL   P EL+  S+TI YW    N    
Sbjct: 132 QFP-VSGSYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWDQTTNPAVW 190

Query: 249 XXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS-GYIGAKY 307
                         G +G+AE +F  +  K+L I  F I+           S GYIG KY
Sbjct: 191 VAIFYVFIMTLNLFGVRGFAEVEFVLSVIKILAIIIFIIIGIILIAGGGPDSKGYIGTKY 250

Query: 308 WHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYR 367
           WHDPG+F        FK++           G SE + +  S++S    AI  AAK   +R
Sbjct: 251 WHDPGSFNNPV----FKNLCNTFVSAAFSFGGSELVLL-TSKESKSVSAISRAAKGTFWR 305

Query: 368 ILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGV--RVVPHFINAVIL 424
           I   +++++ ++G LVPY    L+ G       ASP+V+A+S+ G   + V  F+N VIL
Sbjct: 306 IAIFYITTVVIIGCLVPYTDDRLLNGRSDEDVTASPFVIALSNTGSMGKKVSDFMNVVIL 365

Query: 425 LAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSS 484
           +AV+SV NS  Y++ R++ +L   G  P+   YIDR GRP   + IS +FG++ F   SS
Sbjct: 366 IAVVSVCNSCVYAASRVIQALGASGQLPKICGYIDRRGRPLVGIAISGIFGLLGFLVASS 425

Query: 485 KEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAA 544
           +E +VFTWL A+  +S  FTW  IC S IRFR A+  QGRS  ++ ++S LGV+G +   
Sbjct: 426 EESKVFTWLFALCSISSFFTWFCICYSQIRFRMALKYQGRSTDQIAYKSMLGVYGGILGC 485

Query: 545 TMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRAK 603
            +  L +  E +VS +P+GE    A+ FFE  L++PI+I  Y  ++IY +DW   +I+  
Sbjct: 486 ILNILLIAGEIYVSASPVGEKS-TAEGFFEYCLSIPIMISVYVLHRIYRKDWTHWYIKRS 544

Query: 604 NIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           +IDL T  ++ +                  P + ++  F C
Sbjct: 545 DIDLDTGCSVENIELFKEQREEEKIYAATKPFYYKIYRFLC 585

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  289 bits (739), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 168/491 (34%), Positives = 269/491 (54%), Gaps = 19/491 (3%)

Query: 159 KAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYC 218
           ++GP  L+IG+ I+G  ++C+IQ+  E++  Y  + G+F+++ +  ++   GF V+  Y 
Sbjct: 21  QSGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSFSSHVSRFIEPSLGFTVSCAYA 79

Query: 219 IQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCK 278
           + WL   P ELV  +MTI YW   +                     +G+AE++F+ +  K
Sbjct: 80  LSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSIIK 139

Query: 279 VLMITGFFILXXXXXXXXXXTS--GYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXX 336
           VL I  F I+           +  GY+G KYWHDPGAFR       F  +          
Sbjct: 140 VLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRPPF----FSSLCQTFVSAAFT 195

Query: 337 XGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSG 396
            G +E + + A+E S    +I  AAK   +RI   ++S++ ++G LVPY S  L G    
Sbjct: 196 FGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPALDGES-- 252

Query: 397 GTKASPYVLAISSHGV--RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQW 454
             +ASP+V+A+S+ G     V HF+NAVI+ AVLSV NS  Y++ R++ SL   G  P+ 
Sbjct: 253 -IRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGACGQLPEI 311

Query: 455 FNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIR 514
           F YID++GRP   + +  +FG++AF   ++K ++VF WL A+  ++  F W  IC+S +R
Sbjct: 312 FGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFCICVSQLR 371

Query: 515 FRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFE 574
           +RRA+ VQG    E+ ++S LG W  V    + FL +  E +VS+    +D  D ++FF+
Sbjct: 372 YRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSV----KDG-DVETFFQ 426

Query: 575 NYLAMPILIVFYFGYKIYNRDWKLF-IRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNG 633
           N +++P+LI+FYF +++Y RDWK + I A+++DL T R   D              + + 
Sbjct: 427 NCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHELIVSRARIASS 486

Query: 634 PTWKRLVHFWC 644
           P + R   FWC
Sbjct: 487 PWYYRAYRFWC 497

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  289 bits (740), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 172/532 (32%), Positives = 276/532 (51%), Gaps = 33/532 (6%)

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K++  RH+ M ++            G +L  +GP  L+IG+ + G  ++C++Q   E++
Sbjct: 75  QKNLSQRHLTMIAIGGTLGTGLFIGIGWSL-ASGPGNLLIGFLLTGLAIFCVVQCAAELS 133

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             Y  + G+F ++ +  VD  +GF V   YC+ W    P EL+  +MTI YW + VN   
Sbjct: 134 CQYP-VSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNPVV 192

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCK-----------VLMITGFFILXXXXXXXX 296
                          G +G+AE ++  +  K           V++I G            
Sbjct: 193 WVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICG----------GG 242

Query: 297 XXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRA 356
             ++GYIG KYWHDPG+F+       FK +           G +E + + A+E S    +
Sbjct: 243 PNSNGYIGTKYWHDPGSFKAPV----FKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVES 297

Query: 357 IPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG-SGGTKASPYVLAISSHGV--R 413
           I  AAK   +R++  ++S++ ++G LVPY    L+G   S    ASP+V+A+++ G    
Sbjct: 298 ISRAAKGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGE 357

Query: 414 VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISIL 473
            V +F+NAVIL+AVLSV NS  Y++ R++ SL   G  P    Y+DR+GRP   +++  L
Sbjct: 358 RVSNFMNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGL 417

Query: 474 FGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRS 533
           FG + F   S+K  EVF WL A+  +S +F W +IC S++R+R A+  Q RS  E+ ++S
Sbjct: 418 FGFLPFIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKS 477

Query: 534 QLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYN 593
            LG+WG+     +  L ++ E +VS+ P+GE    A++FF+  L++PI+I  Y G+K Y 
Sbjct: 478 MLGIWGAYLGLLLSALLIVGEIYVSLFPLGESP-SAEAFFKYCLSIPIMIAVYIGHKSYT 536

Query: 594 RDWKLF-IRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
            +WK F I    IDL T  +  D              L + P + R+  FWC
Sbjct: 537 GNWKSFVIPLSGIDLDTGLSHSDVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  289 bits (739), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 301/585 (51%), Gaps = 41/585 (7%)

Query: 73  EPHLKRFIDSFKRAE--------EGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEED 124
           E  ++R  DSFK++         E +E+T+           P                  
Sbjct: 34  ESLIRRMKDSFKQSNLHVIPEDLENSEQTEQEKIQWKLASQPY----------------- 76

Query: 125 AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACG 184
              +K +  RH+ M ++            G +L  +GPA L+IG+ I+GT ++C++Q+  
Sbjct: 77  ---QKVLSQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPAALLIGFLIVGTSMFCVVQSAA 132

Query: 185 EMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVN 244
           E++  +  + G++  + +  +DE  GF VA  Y + WL   P EL+  S+TI YW   VN
Sbjct: 133 ELSCQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCSLTISYWNQTVN 191

Query: 245 NDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS-GYI 303
                             G KG+AE +F  +  KV+ I  F I+           S GYI
Sbjct: 192 PAVWVAIFYTFIMVLNLFGVKGFAETEFALSIIKVVAIIIFIIIGIVLIAGGGPNSTGYI 251

Query: 304 GAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKI 363
           G KYWH+PGAF    +   FK++           G SE + + ++E S    AI  AAK 
Sbjct: 252 GTKYWHNPGAF----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTE-SKDISAISRAAKG 306

Query: 364 MIYRILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGVR--VVPHFIN 420
             +RI   +++++ ++G LVPY+ S L+ GS S    ASP+V+A+ + G     V +F+N
Sbjct: 307 TFWRIAIFYITTVVIIGCLVPYNDSRLLSGSTSEDISASPFVIALRNTGSMGAKVSNFMN 366

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
            VIL+AV+SV NS  Y+S R++ +L   G  P   +Y+DR+GRP   + IS  FG++ F 
Sbjct: 367 VVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFL 426

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
             S+KE+EVFTWL A+  +S  FTW  ICLS +RFR A+  QGRS  E+ ++S LGV+G 
Sbjct: 427 VASNKEDEVFTWLFALCSISSFFTWFCICLSQVRFRMALKTQGRSKDEIAYKSILGVYGG 486

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKL-F 599
           V    +  L +  E +VS AP+G     AK+FFE  L++PI+IV Y  ++IY +D +  +
Sbjct: 487 VLGCVLNALLIAGEVYVSAAPVGSPS-SAKAFFEYCLSIPIMIVVYIAHRIYRKDRRRWY 545

Query: 600 IRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           I+   IDL T  ++ +              + + P + ++  FWC
Sbjct: 546 IKRSEIDLDTGCSVENLELFKAQKEAEKQLIASKPFYYKIYRFWC 590

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  285 bits (728), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 180/575 (31%), Positives = 295/575 (51%), Gaps = 27/575 (4%)

Query: 76  LKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIK-EHDVAITSKEEDAHLRKSIQPR 134
           ++RF +SFKR +    +   +        S LS   K + D+A      +   +K +  R
Sbjct: 30  VRRFKNSFKRKDASVIQEGLLY-------SELSEEEKVQWDLA------NQPYKKVLDQR 76

Query: 135 HVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLP 194
           H+ M ++            G +L  +GPA L+IG+ ++G  + C++Q   E++  Y  + 
Sbjct: 77  HLTMIAIGGTLGTGLFIGLGESL-ASGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VS 134

Query: 195 GNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXX 254
           G++  + +  +D   GF+V   Y + WL   P ELV  S+T+ YW   VN          
Sbjct: 135 GSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFT 194

Query: 255 XXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX-XTSGYIGAKYWHDPGA 313
                   GA+G+AE++F+ +  K++ +  F I+           ++GYIG KYW+DPG+
Sbjct: 195 LSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGS 254

Query: 314 FRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFL 373
           F    +   FK+              +E + + ++E  +   ++  AAK   +RI   ++
Sbjct: 255 F----APPAFKNFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRAAKGTFWRIAVFYI 309

Query: 374 SSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGV--RVVPHFINAVILLAVLSV 430
            ++ ++G LVPY+   L+ GS S    ASP+V+A+S+ G     V  F+NAVIL+AV SV
Sbjct: 310 VTVIIIGCLVPYNDPRLINGSSSEDITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSV 369

Query: 431 SNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVF 490
            NS  Y+S R++  L+  G  P+   Y+DR GRP   M I   FG++ F   S  +  VF
Sbjct: 370 CNSCVYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVF 429

Query: 491 TWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLA 550
           TWL A+  +S   TW  IC   IRFR AM  QG+   ++ ++S LG++G V   T+  L 
Sbjct: 430 TWLFALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLL 489

Query: 551 LIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRAKNIDLIT 609
           +I E +VS AP+G     A +FFE  +++PI+I  Y G++IY RDW+  +I+ ++IDL +
Sbjct: 490 VIGEIYVSAAPVGMPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDS 548

Query: 610 HRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
             ++ D              + + P + RL  F+C
Sbjct: 549 GHSLEDLEATKLRRDQEKEYVASRPLYYRLYRFFC 583

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  283 bits (724), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 173/488 (35%), Positives = 270/488 (55%), Gaps = 15/488 (3%)

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K ++ RH+ M ++            G +L  +GPA L+IG+ ++GT ++C++Q+  E++
Sbjct: 74  QKVLKQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPAALLIGFLLVGTSMFCVVQSAAELS 132

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             +  + G++  + +  +D+  GF VA  Y + WL   P EL+  S+TI YW   VN   
Sbjct: 133 CQFP-VSGSYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWNQTVNPAV 191

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADF-FFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAK 306
                          G KG+AE +F       + +     I           ++GYIG +
Sbjct: 192 WVAIFYVFIMCLNLFGVKGFAETEFALSIIKVISIFIFIIIGIVLIAGGGPNSTGYIGTR 251

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YWH+PG+F    +   FK++           G SE + + ++E  N   +I  AAK   +
Sbjct: 252 YWHNPGSF----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-SISRAAKGTFW 306

Query: 367 RILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAIS---SHGVRVVPHFINAV 422
           RI   +++++ ++G LVPY+   L+ GS S    ASP+V+A+S   S G RV  +F+N V
Sbjct: 307 RIAIFYITTVVIIGCLVPYNDPRLLNGSTSEDISASPFVIALSNTGSMGTRV-SNFMNVV 365

Query: 423 ILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCAC 482
           IL+AV+SV NS  Y+S R++ +L   G  P+   Y+DR+GRP   + IS +FG++ F   
Sbjct: 366 ILVAVVSVCNSCVYASSRLIQALGASGQLPEICAYMDRKGRPLVGIGISGIFGLLGFLVA 425

Query: 483 SSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVY 542
           S+KE EVFTWL A+  +S  FTW  IC+S +RFR A+  QGRS +E+ ++S LGV+G V 
Sbjct: 426 SNKEGEVFTWLFALCSISSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVL 485

Query: 543 AATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIR 601
              +  L +  E +VS AP+G     AK FFE  L++PI+IV Y  ++IY  DWK  +I+
Sbjct: 486 GCVLNALLIAGEIYVSAAPVGGTS-TAKGFFEYCLSIPIMIVVYISHRIYRGDWKNWYIK 544

Query: 602 AKNIDLIT 609
              IDL T
Sbjct: 545 KSKIDLDT 552

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  278 bits (711), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 180/545 (33%), Positives = 287/545 (52%), Gaps = 24/545 (4%)

Query: 115 DVAITSKEE-------DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVI 167
           D+++ S+E+       +    KS+  RH++M S+            G +L  +GP  L+I
Sbjct: 61  DLSLLSEEQRRNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSL-ASGPGSLLI 119

Query: 168 GYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPL 227
           G+ I+G  ++C++Q+  EMA  Y  + G+F+ + +  ++   GF V+  Y + WL   P 
Sbjct: 120 GFLIVGLMMFCVVQSAAEMACQYP-VSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPS 178

Query: 228 ELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFI 287
           EL+  ++T+ YW++ VN                  G +GY EA+F+ +  KV+ I  F I
Sbjct: 179 ELIGCAITLRYWSS-VNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFII 237

Query: 288 LXXXXXXXXX-XTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIG 346
           +           +SGYIG KYWH+PG+F    +   FK +           G +E + + 
Sbjct: 238 IGIVLICGGGPHSSGYIGTKYWHNPGSF----AKPVFKGLCNTFISAAFSFGGAELVVLT 293

Query: 347 ASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSG-GTKASPYVL 405
           ASE S    ++  AAK   +RI   +++++ ++G LVPY    L+G  +G    ASP+V+
Sbjct: 294 ASE-SKKVESVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVI 352

Query: 406 AISSHGV--RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGR 463
           A+S  G     V HF+NAVIL+AVLSV NS  Y+S R++ +L   G  P+   YID++GR
Sbjct: 353 ALSGQGSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGR 412

Query: 464 PARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQG 523
           P   + I  +FG++ F     K+++VFTWL A+  +S  FTW  IC+S +RFR A+  QG
Sbjct: 413 PLVGIAICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQG 472

Query: 524 RSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILI 583
           RS  E+  +S LG++G +    +  L +  E +VSI P+G     A+ FF+  +++PI+I
Sbjct: 473 RSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPLGGSP-SAEQFFQYCMSIPIMI 531

Query: 584 VFYFGYKIYN---RDWK-LFIRAKNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRL 639
           V Y  +K Y    RD K + +    IDL + R I D              +   P + R+
Sbjct: 532 VVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAKPLYYRI 591

Query: 640 VHFWC 644
             FWC
Sbjct: 592 YRFWC 596

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  268 bits (684), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 164/522 (31%), Positives = 273/522 (52%), Gaps = 14/522 (2%)

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K++  RH+ M S+            GS+L     A L+    +  + ++C+IQA  E++
Sbjct: 75  QKTLSQRHLTMISIGGTLGTGLFIGIGSSLASGPGALLLGFLLVGLS-IFCVIQAAAELS 133

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             Y  + G+F+ + +  ++   GF V+  Y + WL   P ELV  ++TI YW   V+   
Sbjct: 134 CQYP-VSGSFSTHVSRFIEPSVGFMVSTSYALSWLISFPSELVGLTLTIGYWNNSVSPGI 192

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX--XTSGYIGA 305
                            +G+AE +++ +  K++ IT F I+             +GY+G 
Sbjct: 193 WVAIFYLLIMAMNLFSVRGFAETEYWLSIIKIIAITIFIIIGIVVICGGGPNNQAGYLGT 252

Query: 306 KYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMI 365
           KYWHDPGAF+       F  +           G +E + + A+E S    +I  AAK   
Sbjct: 253 KYWHDPGAFKKPY----FSGICNTFVSAAFSFGGAELVLLTANE-SRKVESISRAAKGTF 307

Query: 366 YRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGV--RVVPHFINAVI 423
           +RI   ++S++A++  LVPYD+  L+G+G G    SP+V+++++ G   + V HF+NA+I
Sbjct: 308 WRIAIFYISTVAVISCLVPYDNETLLGNGEG-VANSPFVISLANTGQFGKNVSHFMNAII 366

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           L AVLSV NS+ Y++ R++ +L   G  P    YID++GRP   + I  +FG++AF    
Sbjct: 367 LAAVLSVCNSSVYAASRVIQALGACGQLPSVCGYIDKKGRPLVGIAICGVFGLLAFLVEY 426

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
               EVF WL A+  ++   TW +ICLS +RFRRA+ VQG    E+ + S +G+W  V  
Sbjct: 427 DNVTEVFNWLFALCSIAAFVTWWSICLSQLRFRRALKVQGLGKEEIAYESMMGIWSGVVG 486

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKL-FIRA 602
             +  + +  E +V+I    ++H  AK+FF+  +++P++I  Y  ++IYN++W   F+RA
Sbjct: 487 IVLNTMLICGEIYVAIHASIDEH-SAKTFFQYCMSIPVMITVYAAHRIYNKNWHTWFVRA 545

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           K+IDL T +   D              +   P + R+  FWC
Sbjct: 546 KDIDLSTGKKAEDIELMKHEIMVSRAKIAASPLYYRIYRFWC 587

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/516 (29%), Positives = 255/516 (49%), Gaps = 15/516 (2%)

Query: 107 LSAAIKEHDVAITS--KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           +  +I E  V++ S    ++  ++++++PRH+ M +L             + L  AGP G
Sbjct: 20  IKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
            +I Y  +GT  Y + Q+ GEMA ++  +  +F  +    +    G A  ++Y + W   
Sbjct: 80  ALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAIT 138

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
             LEL      I +WT  V                     K Y E +F+    KVL I G
Sbjct: 139 FALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVG 198

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGA 339
           F I           T G +G +YW +PG +       D +  RF   +            
Sbjct: 199 FIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257

Query: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTK 399
           +E + I A E +NPR+ +P A   + +RILF ++ S+  +G LVP++  +L    S    
Sbjct: 258 TELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSY-IS 316

Query: 400 ASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYID 459
           +SP+V+AI + G +V+PH  NAVIL  ++S  NS  Y   RI +S++  G AP++  +  
Sbjct: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376

Query: 460 REGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAM 519
           + G P  A++ + + G +A+   SS    VF WLL I+ ++  FTW+ I +SHIRF +A+
Sbjct: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436

Query: 520 HVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAM 579
             QG S  +L F+++   WG+ YAA  + + +I + + + AP          FF  Y+++
Sbjct: 437 KHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP----KFKVSDFFTAYISV 492

Query: 580 PILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
            +  VF+ G++I+ R   LFI+ ++IDL T R   D
Sbjct: 493 MLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID 527

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  255 bits (652), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 147/500 (29%), Positives = 243/500 (48%), Gaps = 12/500 (2%)

Query: 122 EEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181
            +D  +++ ++PRH+ M SL             S +  AGP G ++ Y  MGT  +C+ Q
Sbjct: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116

Query: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241
           + GEMA ++  +  +F  Y    +    G A  ++Y   W     LEL      I YWT 
Sbjct: 117 SLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175

Query: 242 KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSG 301
            V                     + Y E +F+    KVL I GF I           + G
Sbjct: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI-YALVMVCGGSSEG 234

Query: 302 YIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRA 356
            +G +YW +PG +       ++   RF   +            +E + I A E  NPR+ 
Sbjct: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294

Query: 357 IPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVP 416
           +P A   + +RILF ++ S+  VG LVPY    L  +       SP+V+AI + G +V+P
Sbjct: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354

Query: 417 HFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGI 476
              N VIL+ +LS  NS  Y   R+L+ LS+ G AP  F   +++G P  A++ S +FG 
Sbjct: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414

Query: 477 IAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLG 536
           +A+   S   ++VF WLL I+ ++  F W+ I LSHIRF + +  +G S ++L F+++  
Sbjct: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474

Query: 537 VWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596
            WG+ YAA  + + ++ + + S AP          F  +Y+++ + IV + G+++  +  
Sbjct: 475 PWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT- 529

Query: 597 KLFIRAKNIDLITHRNIFDA 616
           +L +R +++D+ T R   DA
Sbjct: 530 RLILRKEDVDIDTDRREIDA 549

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  254 bits (650), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 147/516 (28%), Positives = 258/516 (50%), Gaps = 26/516 (5%)

Query: 112 KEHDVAITSKEEDAH---LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIG 168
           +EH+     +E D H   ++++++ RH+ M +L             S L  AGP G +I 
Sbjct: 47  EEHE-----QEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIA 101

Query: 169 YAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLE 228
           Y  MGT +Y I Q+ GEMA ++  +  +   +    +   FG A  ++Y   W     +E
Sbjct: 102 YIFMGTVVYSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVE 160

Query: 229 LVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
           L      I+YWT+ V                     + Y E +F+  + KV+ I G+ I 
Sbjct: 161 LSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLI- 219

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFI 343
                     + G IG + W +PG +       +++  RF   +            +E +
Sbjct: 220 YAFIVVCGGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELV 279

Query: 344 AIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPY 403
            I A E  NPR+ +P A   + +RILF ++ S+  VG LVPY+   +  +      ASP+
Sbjct: 280 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPF 339

Query: 404 VLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGR 463
           V++I + G +++P   NAV+L+ V+S +NS  Y   R+++SL+Q G AP+ F Y++R G 
Sbjct: 340 VISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGV 399

Query: 464 PARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQG 523
           P   ++++ L G++AF   ++  +  F WL+ IS L+ +  W+ I L+HIRF + +  +G
Sbjct: 400 PVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRG 459

Query: 524 RSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILI 583
            S   L F+++   W + YAA+ +F+ +  + + + +P      D   FF  Y+++ +++
Sbjct: 460 ISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSP----KFDVTQFFTAYISLMLML 515

Query: 584 VFYFGYKIYNR---DWKLFIRAKNIDLITHRNIFDA 616
           V + G +IY +    WKL    ++ID+ T+R   DA
Sbjct: 516 VVFIGCQIYYKCRFLWKL----EDIDIDTNRREIDA 547

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  255 bits (651), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 170/582 (29%), Positives = 284/582 (48%), Gaps = 39/582 (6%)

Query: 75  HLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQP- 133
           H + F++SFKR    T  +                   E+D    ++EE      + QP 
Sbjct: 33  HFREFMESFKRDGAVTVPSDL-----------------EYDE--LTEEEKVQWDLATQPY 73

Query: 134 ------RHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
                 RH+ M ++            G +L  +GP  L+IG+ ++G  + C++Q   E++
Sbjct: 74  KKVLDQRHLTMIAIGGTLGTGLFIGLGLSL-ASGPGSLLIGFMLVGISMLCVVQCGAELS 132

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDX 247
             Y  + G++  + +  +D   GF+V   Y + WL   P ELV  S+T+ YW   VN   
Sbjct: 133 CQYP-VSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSLTLSYWNNSVNPAV 191

Query: 248 XXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX-XTSGYIGAK 306
                          G +G+AE +F+ +  KV+ +  F I+            +GYIG K
Sbjct: 192 WVAIFFVFVMLLNLFGVRGFAETEFYMSIFKVISLFVFIIIGIVLITGGGPGNTGYIGTK 251

Query: 307 YWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIY 366
           YW DPG+F    +   FK+              +E + + ++E  +   +I  AAK   +
Sbjct: 252 YWQDPGSF----ATPAFKNFCNTFVSAAYSFSGTEMVVLTSTEVRDIS-SISRAAKGTFW 306

Query: 367 RILFIFLSSIALVGFLVPYDSSELM-GSGSGGTKASPYVLAISSHGV--RVVPHFINAVI 423
           RI   ++ ++ ++G LVPY+   L+ G+ S    ASP+V+A+S+ G       +F+N VI
Sbjct: 307 RIALFYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALSNTGSMGSKAANFMNVVI 366

Query: 424 LLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACS 483
           L+AV+SV N   Y+S R++  L+  G  P    Y+DR GRP   + I+ +FG++ F   S
Sbjct: 367 LVAVVSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLVGIAITGVFGLLGFLVAS 426

Query: 484 SKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA 543
             +  VFTWL A+  +S   TW  IC   IRFR AM  Q RS  ++ + S LG++G V  
Sbjct: 427 KDQSTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSADDIVYISPLGIYGGVLG 486

Query: 544 ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRA 602
             +  L +  E +VS  P+G+    A++FF+  +++PI+IV Y G++IY +DW   +I+A
Sbjct: 487 CVLNVLLVAGEIYVSAFPVGQPS-SAENFFQYCMSIPIMIVVYLGHRIYRKDWSHWYIKA 545

Query: 603 KNIDLITHRNIFDAXXXXXXXXXXXXXLKNGPTWKRLVHFWC 644
           K+ID  +   + +              + + P + ++  F+C
Sbjct: 546 KDIDRDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  254 bits (648), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 154/505 (30%), Positives = 256/505 (50%), Gaps = 19/505 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K  D  L+K++Q RHV M ++            G++L  AGPA + I Y+ +G  ++  +
Sbjct: 94  KHTDG-LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTM 152

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
            A GEMA SY  + G F +Y +  VD   GFAV + Y  ++L + P +L  AS+ I YW 
Sbjct: 153 AAIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
            +  VN                  G K + E +F+ ++ KVL++ G  +L          
Sbjct: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGP 270

Query: 299 TSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
               +G +YW  PGAF+      D S+ +F   +             E   I A+E  NP
Sbjct: 271 DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNP 330

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLAISSHG 411
           R+++P A K+ ++RI+  +L +I L+G  V Y+   L+ +   GT A  SP+V+AI + G
Sbjct: 331 RKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSG 390

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           +RV+PH  NA +L+ V S  NS  Y   R L+SL+  G AP  F      G P  ++ + 
Sbjct: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
           +LF ++A+   SS   +VF + + +  +  + +W+ I +++I F RA+ VQG   S+  +
Sbjct: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510

Query: 532 RSQLGVWGSVYA-ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
            +    +G+ ++ A  +F+A I  F V +        D K+F   Y+ +P+ ++FYFGYK
Sbjct: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYK 566

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFD 615
              +     +++  +DL T + +FD
Sbjct: 567 FIKK--TKIVKSHEVDLFTGKEVFD 589

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  251 bits (641), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 253/507 (49%), Gaps = 19/507 (3%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E + A  +   D  ++++++ RH+ M +L             + L  AGP G +I Y  M
Sbjct: 53  EEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFM 112

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           G+ +Y I Q+ GEMA ++  +  +   +    +   FG A  ++Y   W     +E+   
Sbjct: 113 GSIVYFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVI 171

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
              I +WT+ V                     K Y E +F+  + KV+ I G+ I     
Sbjct: 172 GQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLI-YALV 230

Query: 293 XXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGA 347
                 + G IG +YW +PG +       D++  RF   +            +E + I A
Sbjct: 231 IVCGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290

Query: 348 SEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAI 407
            E +NPR+++P A   +++RI+  ++ S+  VG LVP++   L  S      +SP+V++I
Sbjct: 291 GEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL-ASNVAVIASSPFVISI 349

Query: 408 SSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARA 467
            + G RV+PH  NAV++L ++S +NS  Y   R+L++LSQ G AP+ F Y+ R G P   
Sbjct: 350 QNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLG 409

Query: 468 MIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSIS 527
           +I + L G++AF   ++     F WL+ IS L+ +  W+ I LSHIRF +A+  +G S  
Sbjct: 410 VIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRD 469

Query: 528 ELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYF 587
           +L F+++L  WG+ YAA  + + +  + + + +P      D   FF  Y+++ IL+V   
Sbjct: 470 DLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVLLI 525

Query: 588 GYKIYNR---DWKLFIRAKNIDLITHR 611
           G ++Y R    WKL    ++ID+ T R
Sbjct: 526 GCQLYYRCRFLWKL----EDIDIDTDR 548

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/498 (29%), Positives = 244/498 (48%), Gaps = 13/498 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++  ++++++PRH+ M +L             + L  AGP G +I Y  +GT  Y + Q+
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  +    +    G A  ++Y + W     LEL      I +WT  
Sbjct: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+    KVL I GF I           T G 
Sbjct: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GP 215

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PG +       D +  RF   +            +E + I A E +NPR+ +
Sbjct: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   + +RILF ++ S+  +G LVP++  +L    S    +SP+V+AI + G +V+PH
Sbjct: 276 PRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPH 334

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S  NS  Y S R+L+S+   G AP++  +  + G P  A++ + L G +
Sbjct: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S     VF WLL I+ ++  F WM I ++HIRF +A+  QG S  +L F+++   
Sbjct: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           WG+ YAA  + + +I + + + AP      +   FF  Y+++ +    + G++I+ R   
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509

Query: 598 LFIRAKNIDLITHRNIFD 615
           LF + ++IDL T R   D
Sbjct: 510 LFKKTEDIDLDTDRREID 527

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  252 bits (643), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 156/549 (28%), Positives = 266/549 (48%), Gaps = 26/549 (4%)

Query: 73  EPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQ 132
           EP LK   D F+      +E             PL +  +  +       ++  ++++++
Sbjct: 74  EPKLKAHSDDFEMYVYSQDEPS---------TDPLGSDTESGE----GDMQEGKVKRALK 120

Query: 133 PRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSN 192
           PRHV M +L             S L  +GP G +I Y  MGT +Y + Q+ GEMA ++  
Sbjct: 121 PRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMA-TFIP 179

Query: 193 LPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXX 252
           +  +   + +  +   FG A  ++Y   W     +EL      I+YWT  V         
Sbjct: 180 VTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEAVPRAAWIAIF 239

Query: 253 XXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPG 312
                       + Y E +F+  + KVL I G+ I             G IG +YW +PG
Sbjct: 240 WVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLI-YALVIVCGGSKQGPIGFRYWRNPG 298

Query: 313 AFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYR 367
            +       D+   RF   +            +E + I A E +NPRR +P A   + +R
Sbjct: 299 PWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVFFR 358

Query: 368 ILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAV 427
           ILF ++ S+  VG LVPY+ S L  + +    +SP+V++I + G R +P   NAV+L+ +
Sbjct: 359 ILFFYILSLFFVGLLVPYNHSSLDKTTTV-IASSPFVISIQNAGTRALPDIFNAVVLVTI 417

Query: 428 LSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEE 487
           +S +NS  Y   R+LFSL+  G AP+ F+ +  +G P   +I++ L G++AF   +    
Sbjct: 418 ISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNAN 477

Query: 488 EVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATML 547
           E F WL+ IS L+ +  W+ I +SHIRF + +  +G S  +L F+S+L  +G+ YAA  +
Sbjct: 478 EAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWV 537

Query: 548 FLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDL 607
            + +  + + + +P    H     FF +Y+++ +L+V + G +++ R  + F R ++ID+
Sbjct: 538 TVIIFVQGFQAFSP----HFKVTEFFTSYISLMLLVVVFCGAQLFYRC-RFFNRLEDIDI 592

Query: 608 ITHRNIFDA 616
            + R   DA
Sbjct: 593 DSDRREADA 601

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  250 bits (638), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 142/498 (28%), Positives = 252/498 (50%), Gaps = 13/498 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +D  ++++++PRH+ M +L               L K+GP G +I Y  MGT +Y + QA
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   + +  +   FG +  ++Y   W     +E+      I++WTTK
Sbjct: 158 LGEMA-TFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK 216

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                       Y E +F+  + KVL I G+ I             G 
Sbjct: 217 VPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLI-YALVIVCGGSKQGP 275

Query: 303 IGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW    A  G     D++  RF   +            +E + I A E +NPR+++
Sbjct: 276 IGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSV 335

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   +++RI+  ++ S+  +G LVPY+  +L  S +    +SP+V++I + G R +PH
Sbjct: 336 PRAINKVVFRIVIFYILSLFFIGLLVPYNDPKL-NSATSYIASSPFVISIENAGTRALPH 394

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NA+I++ ++S +NS  Y S R+L+SL+  G+AP+ F  +  +G P   +I++ L G++
Sbjct: 395 IFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLL 454

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   ++   E F WL+ IS L+ +  W+ I +SH+RF  A+  +G S  +L F+++   
Sbjct: 455 AFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMP 514

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           +GS YA   + + +  + + + +P      D  SFF  Y+++ +L V + G ++Y R  +
Sbjct: 515 YGSYYACFFITVIIFIQGFTAFSP----KFDVASFFTAYISLILLAVLFIGCQLYYR-CR 569

Query: 598 LFIRAKNIDLITHRNIFD 615
            F + ++ID+ T R   D
Sbjct: 570 FFWKVEDIDIDTDRREID 587

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  248 bits (633), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/496 (29%), Positives = 251/496 (50%), Gaps = 15/496 (3%)

Query: 127 LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186
           +++ ++PRHV M +L             S L  AGP G +I Y  MG+  YC+ Q+ GEM
Sbjct: 53  VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEM 112

Query: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNND 246
           A ++  +  +F  +    +    G A  ++YC  W     LEL      I+YWT+ V N 
Sbjct: 113 A-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNA 171

Query: 247 XXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAK 306
                             K Y E  F+    KV+ I GF +           T G +G +
Sbjct: 172 AWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKT-GPVGFR 230

Query: 307 YWHDPGAFRGDRSID------RFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 360
           YW +PG + GD  I       RF   +            +E + I A E +NPR+ +P A
Sbjct: 231 YWRNPGPW-GDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKA 289

Query: 361 AKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFIN 420
              + +RIL  ++ S+  +G LVP++  +L  S S  +  SP+++AI + G +++P   N
Sbjct: 290 INKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSY-SAGSPFIIAIQNSGTKILPDIFN 348

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           AVIL  ++S +NS  Y   R+L+ L+++  AP++F   +R G P  A++    FG + + 
Sbjct: 349 AVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYL 408

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
           + S+   + F WLL I+ ++  F+W+ I L H+RF +A+ +QG S  +L F+++L  WG+
Sbjct: 409 SVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGA 468

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600
            Y+A  + L +I + + S+AP      +  +FF  Y+++ + +V +  ++ + R  ++  
Sbjct: 469 YYSAFFITLIIIIQGFTSLAPT----FNVSNFFAAYISVFMFLVIWAVFQCWYRT-RIIH 523

Query: 601 RAKNIDLITHRNIFDA 616
           R +++D+ + R   DA
Sbjct: 524 RIEHVDIDSDRREVDA 539

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  249 bits (635), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 156/523 (29%), Positives = 261/523 (49%), Gaps = 22/523 (4%)

Query: 105 SPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           S L  + K+ D     K+E   LRK ++ RH+ M ++            G++L+ AGP  
Sbjct: 64  SRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMS 123

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           + I YA +G  ++  + A GEMA SY  L G F +Y +   D   GFAV + Y  ++L +
Sbjct: 124 MFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLIL 181

Query: 225 MPLELVTASMTIDYWTTK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMI 282
            P +L  A++ I YW  +  VN                  G K + E +F+ +T KV+++
Sbjct: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241

Query: 283 TGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRG-DRSID----RFKDVMXXXXXXXXXX 337
            G  IL          T   +G +++  PGAF+   +SID    +F   +          
Sbjct: 242 IGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAY 301

Query: 338 GASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGG 397
              E   I A+E +NPR++IP A K+ +YRI+  +L +I L+G  V YD   L  + + G
Sbjct: 302 LGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSG 361

Query: 398 T--KASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWF 455
           T   ASPYV+AI + G++ +PH  NA +L+ V S  NS  Y + R L+ L+    AP+ F
Sbjct: 362 TGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIF 421

Query: 456 NYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRF 515
              +R G P  ++++S  F ++A+ + SS   ++F + + +  +  + +W++I ++++ F
Sbjct: 422 AVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCF 481

Query: 516 RRAMHVQGRSISELGFRSQLGVWGSVYA-ATMLFLALIAEFWVSIAPIGEDHLDAKSFFE 574
            RA+  Q    S   +R+    +GS +  A  + +A I  F V +      H D K+F  
Sbjct: 482 FRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFIT 537

Query: 575 NYLAMPILIVFYFGYKIYNRD--WKLFIRAKNIDLITHRNIFD 615
            Y+ +P+ ++ YFGYK   +   WK     + +DL T +   D
Sbjct: 538 GYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAID 576

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  249 bits (635), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 154/510 (30%), Positives = 248/510 (48%), Gaps = 16/510 (3%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E  +    K  D  ++++++PRH+ M +L               L ++GP G +I Y  M
Sbjct: 88  ESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFM 147

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           G+ +Y + Q+ GEMA ++  +  +   +    +    G +  ++Y   W      EL   
Sbjct: 148 GSVVYFVTQSLGEMA-TFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVT 206

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
              I YWT KV                     K Y E +F+ ++ KVL I G+ I     
Sbjct: 207 GQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLI-YALV 265

Query: 293 XXXXXXTSGYIGAKYWHDPGAFRGDRSIDRFKDVMXXXXXXXXXXGA------SEFIAIG 346
                   G IG +YW    AF GD  I + KD             A      +E + I 
Sbjct: 266 IVCGGSRQGPIGFRYWRHGYAF-GDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGIS 324

Query: 347 ASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLA 406
           A E +NPR+ +P A   +I+RI   ++ S+  +G LVPY+   L   GS    +SP+V++
Sbjct: 325 AGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL-SDGSAIIASSPFVIS 383

Query: 407 ISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPAR 466
           + + G   +P   NAVIL+ VLS +NS  Y + R+L++L+ QG AP+ F Y++R G P  
Sbjct: 384 MLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYL 443

Query: 467 AMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSI 526
            + ++ L G +AF   S+     F WL+ IS L+ +  W  IC +HIRF +A+  +G S 
Sbjct: 444 GVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISR 503

Query: 527 SELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFY 586
            +L F+++   WG+ YAA  + L +  + + +  P      D KSFF +Y+++ +  V Y
Sbjct: 504 DDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-----WDTKSFFTSYISLILFGVLY 558

Query: 587 FGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
            G  IY R  +L I+ ++ID+ T R   +A
Sbjct: 559 LGCLIYYRG-RLLIKIEDIDIDTDRKEVEA 587

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  246 bits (629), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/517 (28%), Positives = 257/517 (49%), Gaps = 17/517 (3%)

Query: 108 SAAIKEHDVAITSKE---EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           SAA  + D++ T +    +D  ++++++ RH+ M +L             + L  AGP G
Sbjct: 72  SAANGDLDLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVG 131

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
            +I Y  MG+ +Y I Q+ GEMA ++  +  +   +    +   FG    ++Y   W   
Sbjct: 132 ALIAYIFMGSIIYFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAIT 190

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
             +E+      I YWT  V                     K Y E +F+  + KVL I G
Sbjct: 191 YAVEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIG 250

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGA 339
           + I           + G IG +YW +PG +       D +  RF   +            
Sbjct: 251 YLI-YALVIVCGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQG 309

Query: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTK 399
           +E + I A E +NPR+++P A   +++RI   ++ S+  +G LVPY+   L  SG     
Sbjct: 310 TELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL-SSGDSYIA 368

Query: 400 ASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYID 459
           +SP+V++I + G   +P   NAV++L ++S +NS  Y   R+L++L+Q G AP+ F Y+ 
Sbjct: 369 SSPFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVT 428

Query: 460 REGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAM 519
           + G P   +I++   G++AF   ++     F WL+ IS L+ +  W  I LSHIRF +A+
Sbjct: 429 KHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQAL 488

Query: 520 HVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAM 579
             +G S  +L F+++L  WG+ Y+A  +F+ +  + + +  P      D  +FF +Y+++
Sbjct: 489 KYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-----WDTTTFFTSYISL 543

Query: 580 PILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
            +L+V + G ++Y R  +  ++ ++ID+ T R   +A
Sbjct: 544 ILLVVVFIGCQLYYRC-RFLLKVEDIDIDTDRREIEA 579

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  244 bits (624), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 146/499 (29%), Positives = 245/499 (49%), Gaps = 13/499 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++  ++++++PRHV M +L             S L  AGP G +I Y  MG+ +Y + Q+
Sbjct: 50  QEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQS 109

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I YWT  
Sbjct: 110 MGEMA-TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKA 168

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     + Y E +F+  + KV+ I G+ +L            G 
Sbjct: 169 VPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGY-LLYALIIVCGGSKQGP 227

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW +PG +      GD+   RF   +            +E + I A E +NPR+ +
Sbjct: 228 IGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTV 287

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   + +RILF ++ S+  VG LVPY+   L    +    +SP+V++I S G R++P 
Sbjct: 288 PKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTRILPD 346

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAV+L+ ++S +NS  Y   RILFSL+  G AP+ F+Y+  +G P   +I + L G++
Sbjct: 347 IFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLL 406

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF        E F WL+ IS L+ +  W+ I +SHIRF + +  +G S  +L F+S+L  
Sbjct: 407 AFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMP 466

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           +G+ YAA  + + +  + + +  P          FF  Y+++ +L V +   ++Y R  +
Sbjct: 467 YGAYYAAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISLILLAVVFCLAQLYYRC-R 521

Query: 598 LFIRAKNIDLITHRNIFDA 616
            F R ++ID+ + R   DA
Sbjct: 522 FFNRLEDIDIDSDRREIDA 540

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  244 bits (624), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 151/514 (29%), Positives = 257/514 (50%), Gaps = 16/514 (3%)

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
           +  H      K +   L+K+++ RHV M ++            GS+L  AGPA ++I YA
Sbjct: 63  VVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYA 122

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
            +G  ++ ++   GEMA +Y  L G F +Y T   D   GFAV + Y  ++  ++P +L 
Sbjct: 123 FVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180

Query: 231 TASMTIDYWTT--KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
             ++ I YW    KVN                  G + + E +++ +  K+ ++ G  IL
Sbjct: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIIL 240

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSI-----DRFKDVMXXXXXXXXXXGASEFI 343
                         +G KYW +PGAF+   +       RF                +E  
Sbjct: 241 LLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300

Query: 344 AIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS-- 401
            I  SE  NPR+A+P A K+ +YRI+  +L SI L+G  VP++   L+ + S  T AS  
Sbjct: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASAS 360

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           P+V+AI + G+ V+PH +NA IL+ V S +NS  Y + R L+ L+    AP+ F   +++
Sbjct: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           G P  ++++ +LF ++A+   SS   EVFT+ +    +  + +W++I +++IRF +A  V
Sbjct: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480

Query: 522 QGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPI 581
           QG   S L ++S L  +G+ ++   LF  ++     +      D  D KSF   Y+ +P 
Sbjct: 481 QGIDKSTLAYQSPLQPYGAWFS---LFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPT 537

Query: 582 LIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
            I+ Y GYK++ +     I ++ +DL++ +   D
Sbjct: 538 YIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVD 569

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  244 bits (622), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 142/514 (27%), Positives = 248/514 (48%), Gaps = 25/514 (4%)

Query: 113 EHDV-AITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           EHD  A  +  ED  +++ ++ RH+ M +L             + L  AGP G +I Y  
Sbjct: 69  EHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIF 128

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
           MG+ +Y + QA GEMA ++  +  +   +    +   FG A  ++Y   W     +E+  
Sbjct: 129 MGSIVYFVTQALGEMA-TFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISV 187

Query: 232 ASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXX 291
               I YWT  V                     K Y E +F+    KV+ I G+ +    
Sbjct: 188 VGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALI 247

Query: 292 XXXXXXXTSGYIGAKYWHDPGAFRGDRSID-----------RFKDVMXXXXXXXXXXGAS 340
                    G IG +YW +PGA+    + D           RF   +            +
Sbjct: 248 IVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGT 307

Query: 341 EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA 400
           E + I A E +NPR+ +P A   +++RI+  ++ S+  +G LVP+  S L    +    +
Sbjct: 308 ELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL-SDDTTVIAS 366

Query: 401 SPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDR 460
           SP+V++I + G +++P   NA++++ VLS +NS  Y   R+L+SL+    AP+ F  + R
Sbjct: 367 SPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTR 426

Query: 461 EGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMH 520
           +G P   +I + L G++AF    +     F WL+ IS L+ +  W+ I L+H+RF + + 
Sbjct: 427 QGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLK 486

Query: 521 VQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMP 580
            +G S  +L F+++   WGS YAA  +F+ +  + + + +P    H D  +FF +Y+++ 
Sbjct: 487 QRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSP----HFDVTTFFTDYISLI 542

Query: 581 ILIVFYFGYKIYNR---DWKLFIRAKNIDLITHR 611
           +L V + G ++Y R    WKL    +++D+ + R
Sbjct: 543 LLAVVFIGAQLYYRCRFLWKL----EDVDIDSDR 572

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  244 bits (622), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 251/502 (50%), Gaps = 19/502 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            +A +++ ++ RH+ M +L               L  AGP G +I Y  MG+  Y + Q+
Sbjct: 80  RNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQS 139

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I++WT K
Sbjct: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNK 198

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KVL I GF I           T G 
Sbjct: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GP 257

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PGA+       D++  RF   +            +E + I A E +NPR+ +
Sbjct: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A K +++RIL  ++ S+  +G LVPY+  +L  + +     SP+++AI + G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-TATSYVSVSPFIIAIENSGTKVLPH 376

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S +NS  Y   RILF LS+   AP++ +   + G P  A+ I+ +FG +
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGAL 436

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S+  ++VF WLL I+G++  F W+ I +SHIRF +A+  +G S  EL F+++L  
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR--- 594
             + +AAT + + ++ + + + AP      D   F   Y+++ + +  +  ++I  R   
Sbjct: 497 GLAYFAATFMIIIILIQGFTAFAP----KFDGIDFLAAYISIFLFLAIWILFEIIFRCRF 552

Query: 595 DWKLFIRAKNIDLITHRNIFDA 616
            WK+    +++D+ + R   +A
Sbjct: 553 IWKI----EDVDIDSDRRDIEA 570

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  243 bits (621), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 247/502 (49%), Gaps = 15/502 (2%)

Query: 118 ITSKEEDAH--LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTC 175
           + ++E   H  ++++++PRH+ M +L               L  AGP G +I Y  +GT 
Sbjct: 82  LCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTI 141

Query: 176 LYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMT 235
           ++ + Q+ GEM V++  +  +F  +    +   FG A  ++Y   W     +EL      
Sbjct: 142 IFSVTQSLGEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKV 200

Query: 236 IDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXX 295
           I +WTT V                     K Y E +F+    KVL + GF I        
Sbjct: 201 IQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSG 260

Query: 296 XXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                G  G +YW DPGA+       D+S  RF   +            +E + I A E 
Sbjct: 261 AG-PHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEA 319

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSH 410
           +NPR+A+P A K +I RILF ++ S+  +G LVP++  +L  S +    +SP+++AI + 
Sbjct: 320 ANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLT-SATSFVSSSPFIIAIQNS 378

Query: 411 GVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMII 470
           GV ++P   N VIL+ ++S  NS  Y   RILF L+    APQ+F    + G P  A++ 
Sbjct: 379 GVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLF 438

Query: 471 SILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELG 530
           + LFG +AF   ++  ++VF WLL+I  ++  F W+ I LSHIRF +A+  +G S + L 
Sbjct: 439 TSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLP 498

Query: 531 FRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
           F++    W + YA   + L ++ + + + AP      +   F  +Y+++ +L V  +G  
Sbjct: 499 FKAIFMPWLAYYATAFIILIILIQGFTAFAP----RFNVSDFVASYISL-LLFVIIWGVF 553

Query: 591 IYNRDWKLFIRAKNIDLITHRN 612
              +  ++F + ++IDL + R 
Sbjct: 554 QAMKKCRIFWKVEDIDLDSDRK 575

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  242 bits (617), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 133/477 (27%), Positives = 239/477 (50%), Gaps = 12/477 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            +  ++++++PRH+ M +L             S L ++GP G +I Y  +G+ +Y + Q+
Sbjct: 52  RETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQS 111

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I YWT  
Sbjct: 112 LGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDA 170

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KV+ I G+ I             G 
Sbjct: 171 VPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSH-QGP 229

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW +PG +       D +  RF   +            +E + I A E +NPR+ +
Sbjct: 230 IGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 289

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   + +RILF ++ S+  +G LVPYD   L  + +    +SP+V++I + G +V+PH
Sbjct: 290 PRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNT-TAVIASSPFVISIQNAGTKVLPH 348

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NA++++ ++S +NS  Y   R+L+SL+  G AP+ F Y+ ++G P   +I++ L G++
Sbjct: 349 IFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLL 408

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   ++   E F WL+ IS L+ +  W+ I LSH+RF + +  +G S  +L F+++L  
Sbjct: 409 AFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMP 468

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR 594
           WG+ YAA  + + +I + + +  P          FF +Y+++ +L V + G +++ R
Sbjct: 469 WGAYYAAFFIGVIIIIQGFKAFTP----KFRVSDFFTSYISLILLAVLFLGCQLFYR 521

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  242 bits (618), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 138/496 (27%), Positives = 246/496 (49%), Gaps = 13/496 (2%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           +  D  ++++++ RH+ M +L               L  +GP G +I Y  MG+ +Y I 
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
           Q+ GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I+YWT
Sbjct: 155 QSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWT 213

Query: 241 TKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS 300
            KV                     K Y E +F+    KVL I G+ +L          + 
Sbjct: 214 KKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGY-LLYALIIVCGGSSQ 272

Query: 301 GYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRR 355
           G IG +YW +PG +       D++  RF   +            +E + I A E +NPR+
Sbjct: 273 GPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 332

Query: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVV 415
           ++P A   +++RI   ++ S+  +G LVPYD   L    +    +SP+V++I + G +++
Sbjct: 333 SVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAV-VASSPFVISIQNAGTKIL 391

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           P   NA++++ V+S +NS  Y   R+L++L+Q G AP+ F Y+ R G P   ++ +   G
Sbjct: 392 PDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALG 451

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
           ++AF   ++     F WL+ IS L+ +  W+ I +SHIRF +A+  +G S  +L F+++ 
Sbjct: 452 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKF 511

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
             W + YA   + + +  + + + +P    H D  +FF  Y+++ IL V + G +IY R 
Sbjct: 512 MPWAAYYATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQIYYRC 567

Query: 596 WKLFIRAKNIDLITHR 611
            + F + ++ID+ T R
Sbjct: 568 -RFFWKLEDIDIDTDR 582

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  241 bits (616), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 143/468 (30%), Positives = 237/468 (50%), Gaps = 8/468 (1%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++A +++ ++ RH+ M +L             + L  AGP G +I Y  MG+  Y + Q+
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQS 139

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT K
Sbjct: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KVL I GF I           T G 
Sbjct: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GP 257

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PGA+       D++  RF   +            +E + I A E +NPR+++
Sbjct: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A K +++RIL  ++ S+  +G LVPY+  +L  S S     SP+++AI + G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPH 376

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S +NS  Y   RILF LS+   AP++ +   + G P  A+ ++  FG +
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S+  ++VF WLL I+G++  F W+ I +SHIRF +A+  +G S  EL F+++L  
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585
             + YAAT + + +I + + + AP       A ++   +L + + I+F
Sbjct: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILF 544

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  241 bits (616), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 139/499 (27%), Positives = 251/499 (50%), Gaps = 13/499 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            D  ++++++ RH+ M +L             + L  +GP G +I Y  MG+ +Y I Q+
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I+YWT K
Sbjct: 149 LGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK 207

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+    KVL I G+ +L          + G 
Sbjct: 208 VPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGY-LLYALIIVCGGSSQGP 266

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW +PG +       D +  RF   +            +E + I A E +NPR+ +
Sbjct: 267 IGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 326

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   +++RI   ++ S+  +G LVPY+  E + S S    +SP+V++I + G +V+P 
Sbjct: 327 PRAINKVVFRIALFYIMSLFFIGMLVPYND-ERLASTSAVIASSPFVISIQNAGTKVLPD 385

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NA++++ ++S +NS  Y   R+L++L+  G AP+ F ++ R G P   +I++   G++
Sbjct: 386 IFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLL 445

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   ++     F WL+ IS L+ +  W+ I +SHIRF +A+  +G S  +L F+++L  
Sbjct: 446 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMP 505

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           +G+ YA   + + +  + + + +P    H D  +FF +Y+++ IL V + G +I+ R  +
Sbjct: 506 FGAYYATFFVTVIIFIQGFQAFSP----HWDTTAFFTSYISLIILAVLFIGCQIFYRC-R 560

Query: 598 LFIRAKNIDLITHRNIFDA 616
            F R ++ID+ + R   +A
Sbjct: 561 FFWRVEDIDIDSDRREIEA 579

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 156/552 (28%), Positives = 266/552 (48%), Gaps = 31/552 (5%)

Query: 72  KEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAI-TSKEEDAHLRKS 130
           K+P L +  +  K  EEG               S L+  + E    I T+  ++  ++++
Sbjct: 8   KQPQLHK--NEIKVMEEGES-------------SSLADGVLEQQSQIDTASSQERGIQRA 52

Query: 131 IQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSY 190
           ++PRHV M +L             + L  AGP G +I Y  MG+  + + Q+ GEMA ++
Sbjct: 53  LKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMA-TF 111

Query: 191 SNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXX 250
             +  +F  +    +    G A  ++YC  W     LEL      I YWT  V N     
Sbjct: 112 IPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWII 171

Query: 251 XXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHD 310
                         K Y E  F+    KV+ I GF I           T G +G +YW +
Sbjct: 172 IFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKT-GPVGFRYWRN 230

Query: 311 PGAFRGD------RSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIM 364
           PG + GD      +S  RF   +            +E + + A E +NPR+ +P A + +
Sbjct: 231 PGPW-GDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKV 289

Query: 365 IYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVIL 424
             RIL  ++ S+  +G LVP++  +L  S +  + +SP+++AI + G R +P   NAVIL
Sbjct: 290 FLRILLFYVGSLFFIGLLVPFNDPKL-DSTANYSASSPFIIAIQNSGTRALPDIFNAVIL 348

Query: 425 LAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSS 484
             ++S +NS  Y   R+L+ L+++G AP+    I+R G P   + I  LFG + + + SS
Sbjct: 349 TTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSS 408

Query: 485 KEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAA 544
              + F WLL I+ ++  F W+ I L HIRF +A+  QG S  +L F+++L  WG+ YAA
Sbjct: 409 GSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAA 468

Query: 545 TMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKN 604
             + L +I + + + AP      +  +FF  Y+++ + I  +  +++  +  +L  + ++
Sbjct: 469 FFILLIIIIQGFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFKS-RLIHKVED 523

Query: 605 IDLITHRNIFDA 616
           +D+ + R   +A
Sbjct: 524 VDIDSDRREIEA 535

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  240 bits (613), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 247/502 (49%), Gaps = 19/502 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
            D  ++++++ RH+ M +L             + L  +GP G +I Y  MGT +Y + Q+
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I YWT K
Sbjct: 147 LGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KV+ I G+ I             G 
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSH-QGP 264

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW +PGA        D    RF   +            +E + I A E +NPR+++
Sbjct: 265 IGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 324

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   +++RI+  ++ S+  VG LVPY+   L  S +    +SP+V++I + G +V+P 
Sbjct: 325 PRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAV-IASSPFVISIQNAGTKVLPD 383

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAV+L+ V+S +NS  Y   R+L++L+Q G AP+ F Y+ R G P   +I + L G++
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   +      F WL+ IS L+ +  W+ I L+HIRF +A+  +G S  +L F+++   
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR--- 594
           WG+ YA+  + + +  + + + AP      D   FF  Y+++ +L+V + G ++Y R   
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAFAP----KFDVSEFFTAYISLILLVVLFAGCQLYYRCRF 559

Query: 595 DWKLFIRAKNIDLITHRNIFDA 616
            WKL    ++ID+ + R   DA
Sbjct: 560 LWKL----EDIDIDSDRREIDA 577

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  240 bits (612), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 148/519 (28%), Positives = 257/519 (49%), Gaps = 25/519 (4%)

Query: 111 IKEHDVAITSKEEDAH-----LRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGL 165
           +  H+  I   EE+AH     ++++++ RH+ M +L             + L  AGP G 
Sbjct: 85  VVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGS 144

Query: 166 VIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVM 225
           +I Y  MGT +Y + Q+ GEMA ++  +  +   +    +   FG +  ++Y   W    
Sbjct: 145 LIAYIFMGTIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITY 203

Query: 226 PLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGF 285
            +E+      I+YWT KV                     K Y E +F+  + KVL I G+
Sbjct: 204 AVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGY 263

Query: 286 FILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGAS 340
            I             G IG +YW +PGA+       D+S  RF   +            +
Sbjct: 264 LIYALIIVCGGSH-QGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGT 322

Query: 341 EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA 400
           E + I A E +NPR+ +P A   +++RI+  ++ S+  +G LVPY+ S L  S +    +
Sbjct: 323 ELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAV-IAS 381

Query: 401 SPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDR 460
           SP+V++I + G   +P   NAV+L+ V+S +NS  Y   R+L+SL++ G AP+ F Y+ R
Sbjct: 382 SPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTR 441

Query: 461 EGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMH 520
           +G P   ++ +   G++AF   ++     F WL+ IS L+ +  W+ I L+HIRF +A+ 
Sbjct: 442 QGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALK 501

Query: 521 VQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMP 580
            +G S  +L F+++L  +G+ YAA  + + +  + + +  P          FF +Y+++ 
Sbjct: 502 HRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-----FKVSEFFTSYISLI 556

Query: 581 ILIVFYFGYKIYNR---DWKLFIRAKNIDLITHRNIFDA 616
           +L V + G +IY +    WKL    ++ID+ + R   +A
Sbjct: 557 LLAVVFIGCQIYYKCRFIWKL----EDIDIDSDRREIEA 591

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  239 bits (609), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 143/487 (29%), Positives = 238/487 (48%), Gaps = 14/487 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +DA ++++++PRH+ M +L             S L  AGP G +I Y  MGT  Y + Q+
Sbjct: 78  QDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQS 137

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT  
Sbjct: 138 LGEMA-TFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFA 196

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+    KVL I GF I           T G 
Sbjct: 197 VPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GP 255

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PG +       D +  RF   +            +E + I A E  NPRR +
Sbjct: 256 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTV 315

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   + +RILF ++ S+  +G LVP++  +L    S    +SP+V+AI + G +V+PH
Sbjct: 316 PRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPH 374

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S  NS  Y   R+L+ L++   AP+ F    ++G P  +++ +  FG +
Sbjct: 375 IFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFL 434

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S+  ++VF WLL I+ ++  F W+ I L+HIRF + +  +  S ++L F+++   
Sbjct: 435 AYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMP 494

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           WG+ Y+A  + L +I + + + AP      +  +FF  Y+++ + +  +  ++I  R   
Sbjct: 495 WGAYYSAFFISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFLAIWVVFQIRFRT-- 548

Query: 598 LFIRAKN 604
            FI  KN
Sbjct: 549 RFILTKN 555

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  238 bits (608), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 250/502 (49%), Gaps = 20/502 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ED H++++++ RH+ M +L             + L KAGP G +I Y  MGT +Y I Q+
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I YWT K
Sbjct: 163 LGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDK 221

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KVL I G+ I             G 
Sbjct: 222 VPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSH-QGP 280

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW +PGA+       D++  RF   +            +E + I A E +NPR+ +
Sbjct: 281 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 340

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   +++RI+  ++ S+  +G LVPY+   L  S +    +SP+V++I + G   +P 
Sbjct: 341 PRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAV-IASSPFVISIQNAGTYALPD 399

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAV+L+ V+S +NS  Y   R+L+SL+Q G AP+ F Y+ ++G P   ++ +   G++
Sbjct: 400 IFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 459

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   ++     F WL+ IS L+ +  W+ I L+HIRF +A+  +G S  +L F+++L  
Sbjct: 460 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMP 519

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR--- 594
           +G+ YAA  + + +  + + +  P          FF +Y+++ +L V + G ++Y +   
Sbjct: 520 YGAYYAAFFVTVIIFIQGFQAFCP-----FKVSDFFTSYISLILLAVVFTGCQLYYKCRF 574

Query: 595 DWKLFIRAKNIDLITHRNIFDA 616
            WKL    ++ID+ T R   +A
Sbjct: 575 IWKL----EDIDIDTDRREIEA 592

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  237 bits (605), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 143/487 (29%), Positives = 240/487 (49%), Gaps = 13/487 (2%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E D+  T   E+A +++ ++PRH+ M +L             + +  AGP G +I Y  M
Sbjct: 88  EEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFM 147

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           GT ++ + Q+ GEMA ++  +  +F  + +  V + FG A  ++Y   W     LEL   
Sbjct: 148 GTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
              I++WT KV                     K Y E +F+  + KV+ I GF I     
Sbjct: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266

Query: 293 XXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGA 347
                 T G +G +YW  PG +       D++  RF   +            +E + I A
Sbjct: 267 VCGAGIT-GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325

Query: 348 SEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAI 407
            E +NPR+++P A K +  RIL  ++ S+  +G LVPY+  +L  + S    ASP+++AI
Sbjct: 326 GEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSY-VSASPFIIAI 384

Query: 408 SSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARA 467
            + G +V+PH  NAVIL  ++S +NS  Y   RIL+ LS    AP++F    R G P  A
Sbjct: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIA 443

Query: 468 MIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSIS 527
           ++ +  FG +A+   S+  +  F WLL I+G++  F W++I +SHIRF + +  +G S  
Sbjct: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503

Query: 528 ELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYF 587
           +L +++ L    + Y A  + L ++ + + + AP      D+ +F   Y++  + +  Y 
Sbjct: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559

Query: 588 GYKIYNR 594
             + Y R
Sbjct: 560 VAQCYFR 566

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  237 bits (605), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 146/505 (28%), Positives = 253/505 (50%), Gaps = 18/505 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K+E+  L+K ++ RH+ M ++            G+AL   GP  ++I YA +G  ++  +
Sbjct: 74  KDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTM 133

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
              GEMA SY  L G F +Y +  VD   GFA+ + Y  ++  + P +L  A++ I YW 
Sbjct: 134 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           ++  VN                  G K + E +F+ ++ KV+++ G  +L          
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 299 TSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
               +G +YW DPGAF+        S  +F   +             E   I  SE  NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG--SGGTKASPYVLAISSHG 411
           R+++P A K+ +YRI+  +L ++ L+G  V Y+   L+ +   S    ASP+V+AI + G
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           ++V+PH  NA +L+ V S  NS  Y S R L++L+  G AP+ F    + G P  A+I+S
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
           +LF  +A+   SS   ++F + + +  +  I +W+ I + +I F +A   QG   S+  +
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 532 RSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
            +    +G+ +A +  + +ALI  F V +        D K+F   Y+ +P+ I+ + GYK
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYK 547

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFD 615
           +  +     I++ ++DL T + I+D
Sbjct: 548 LIYK--TKVIKSTDVDLYTFKEIYD 570

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  235 bits (599), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 244/507 (48%), Gaps = 14/507 (2%)

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
           +KE    I+ + E   +R+ ++ RH+ M +L             + L  AGP G +I Y 
Sbjct: 11  MKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYL 70

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
            M T  Y + Q+ GEMA ++  +  +F  +    V   FG A  ++Y   W     LEL 
Sbjct: 71  FMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129

Query: 231 TASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXX 290
                I +WT  V                     K Y E +F+    KV+ I GF I   
Sbjct: 130 VVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCF 189

Query: 291 XXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAI 345
                   T G +G +YW  PGAF       D++  RF   +            +E + I
Sbjct: 190 CMVCGAGVT-GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGI 248

Query: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVL 405
            A E +NPR+ +P A K +++RILF ++ S+  +G LVPYD  +L  + S    ASP+++
Sbjct: 249 TAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSY-VSASPFII 307

Query: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465
           AI + G  V+PH  NAVI+  ++S  NS  Y   RI++ LS    AP   +   + G P 
Sbjct: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367

Query: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525
            A++++ LFG +A+   S+  ++ F WLL I+G++  FTW+ I LSHIRF +A+ ++G S
Sbjct: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427

Query: 526 ISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585
             +L F+++     + Y    + L +I + + S  P      +   F   Y+++ + I  
Sbjct: 428 RDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAI 482

Query: 586 YFGYKIYNRDWKLFIRAKNIDLITHRN 612
           +  ++ + R  +L  R +++D+ T R 
Sbjct: 483 WIAFQAWFRC-RLIWRVEDVDIDTDRR 508

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  237 bits (604), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 250/502 (49%), Gaps = 20/502 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ED H+R++++ RH+ M +L             + L  AGP G +I Y  MGT +Y + Q+
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG +  ++Y   W     +E+      I+YWTTK
Sbjct: 162 LGEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK 220

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KVL I G+ I             G 
Sbjct: 221 VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLI-YALVIVCGGSKQGP 279

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           IG +YW +PGA+       D++  RF   +            +E + I A E +NPR+ +
Sbjct: 280 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 339

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A   +++RI+  ++ S+  +G LVPY    L  S +    +SP+V++I + G   +P 
Sbjct: 340 PRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAV-IASSPFVISIQNAGTYALPD 398

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NA++L+ V+S +NS  Y   R+L+SL+Q G AP+ F Y+ ++G P   ++ +   G++
Sbjct: 399 IFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 458

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   ++     F WL+ IS L+ +  W+ I LSHIRF +A++ +G S  +L F+++   
Sbjct: 459 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMP 518

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR--- 594
           +G+ YA+  + + +  + + S  P          FF +Y+++ +L V + G ++Y +   
Sbjct: 519 YGAYYASFFVTVIIFIQGFQSFCP-----FRVADFFTSYISLILLAVVFTGCQLYYKCRF 573

Query: 595 DWKLFIRAKNIDLITHRNIFDA 616
            WKL    ++ID+ + R   +A
Sbjct: 574 IWKL----EDIDIDSDRREIEA 591

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  236 bits (601), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 147/505 (29%), Positives = 251/505 (49%), Gaps = 18/505 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K+E+  LRK ++ RH+ M ++            G+AL   GP  ++I YA +G  ++  +
Sbjct: 76  KDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTM 135

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
              GEMA SY  L G F +Y +  VD   GFA+ + Y  ++  + P +L  A++ I YW 
Sbjct: 136 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           ++  VN                  G K + E +F+ ++ KV+++ G  +L          
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 299 TSGYIGAKYWHDPGAFRGDRSI-----DRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
               +G +YW DPGAF+   +       +F   +             E   I  SE  NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG--SGGTKASPYVLAISSHG 411
           R+++P A K+ +YRI+  +L ++ L+G  V Y+   L+ +   S    ASP+V+AI + G
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           + V+PH  NA +L+ V S  NS  Y S R L++L+  G AP+ F    R G P  A+I+S
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
           +LF  +A+   SS   ++F + + +  +  I +W+ I + +I F +A   QG   S+  +
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 532 RSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
            +    +G+ +A    + +ALI  F V +        D K+F   Y+ +P+ I+ + GYK
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYK 549

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFD 615
           +  +     I++ ++DL T + I+D
Sbjct: 550 LIYK--TKVIKSTDVDLYTFKEIYD 572

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  235 bits (599), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 146/507 (28%), Positives = 252/507 (49%), Gaps = 22/507 (4%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K+E   LRK ++ RH+ M ++            G+AL   GP  ++I YA +G  ++  +
Sbjct: 75  KDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTM 134

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
              GEMA SY  L G F +Y +  VD   GFA+ + Y  ++  + P +L  A++ I YW 
Sbjct: 135 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 192

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           ++  VN                  G K + E +F+ ++ KVL++ G  +L          
Sbjct: 193 SRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGP 252

Query: 299 TSGYIGAKYWHDPGAFR-------GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQS 351
               +G +YW DPGAF+       G +   +F   +             E   I  SE  
Sbjct: 253 DHDRLGFRYWRDPGAFKEYSAAIGGGKG--KFVSFLAVFVYSLFSYTGIELTGIVCSEAQ 310

Query: 352 NPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGG--TKASPYVLAISS 409
           NPR+++P A K+ +YRI+  +L ++ L+G  V Y+   L+ +        ASP+V+AI +
Sbjct: 311 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQN 370

Query: 410 HGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMI 469
            G++V+PH  NA +L+ V S  NS  Y S R L++L+  G AP+ F+  ++ G P  A+I
Sbjct: 371 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALI 430

Query: 470 ISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISEL 529
            S+LF  +A+   S+   ++F + + +  +  I +W+ I + +I F +A   QG   S+ 
Sbjct: 431 FSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 490

Query: 530 GFRSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFG 588
            + +    +G+ +A    +F+ALI  F V +        D K+F   Y+ +P+ +  + G
Sbjct: 491 AYVAPGQRYGAYFALVFCIFIALIKNFTVFLG----HKFDYKTFITGYIGLPVYVFSWVG 546

Query: 589 YKIYNRDWKLFIRAKNIDLITHRNIFD 615
           YK+  +     I++ ++DL T + I+D
Sbjct: 547 YKLIYK--TKVIKSTDVDLYTFKEIYD 571

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  234 bits (597), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 250/514 (48%), Gaps = 22/514 (4%)

Query: 115 DVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGT 174
           D     K +   L+K +Q RHV M ++            GSAL +AGP  ++I Y+IMG 
Sbjct: 46  DWGYDGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGW 105

Query: 175 CLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASM 234
            ++ ++   GEMA +Y  L G F +Y T   D   GFAV + Y  ++L + P +L  A++
Sbjct: 106 VVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163

Query: 235 TIDYWTT--KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
            + YW    KVN                  G K + E +F+ ++ KVL++     L    
Sbjct: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVL 223

Query: 293 XXXXXXTSGYIGAKYWHDPGAFR---GDRSI----DRFKDVMXXXXXXXXXXGASEFIAI 345
                 +   +G +YW DPG F+   G  SI     +F                +E   I
Sbjct: 224 VLGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGI 283

Query: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPY 403
            A+E  NPRR +P A K+ +YRI+  +L ++ L+G  V Y+   L+ +    T A  SPY
Sbjct: 284 VAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPY 343

Query: 404 VLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGR 463
           V+AI + G+ V+PH  NA +L  V S  NS  Y   R L+ L+    AP+ F   +  G 
Sbjct: 344 VVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGV 403

Query: 464 PARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQG 523
           P  ++ +  LF  +A+   SS  E +F++ + ++ +  + +W++I +++I F RA  VQG
Sbjct: 404 PYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463

Query: 524 RSISELGFRSQLG-VWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPIL 582
              + L +++    V   +     L +AL+  F V +     D  D K+F   Y+ +P+ 
Sbjct: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVY 519

Query: 583 IVFYFGYKIYNR-DWKLFIRAKNIDLITHRNIFD 615
           I+ +  YKI ++  W   I++ N+DL T++   D
Sbjct: 520 ILCFVCYKIVHKTKW---IKSANVDLFTYKTAID 550

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  234 bits (596), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 137/502 (27%), Positives = 250/502 (49%), Gaps = 13/502 (2%)

Query: 120 SKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCI 179
           ++ +D  ++++++ RH+ M +L             + L  AGP G +I Y  MG+ +Y +
Sbjct: 97  AQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFV 156

Query: 180 IQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYW 239
            Q+ GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I YW
Sbjct: 157 TQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 215

Query: 240 TTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXT 299
           T  V                     K Y E +F+  + KVL I G+ I            
Sbjct: 216 TKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSH- 274

Query: 300 SGYIGAKYWHDPGAFR----GDRSID-RFKDVMXXXXXXXXXXGASEFIAIGASEQSNPR 354
            G IG +YW +PG +      D++ + RF   +            +E + I A E +NPR
Sbjct: 275 QGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 334

Query: 355 RAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRV 414
           +++P A   +++RI   ++ S+  +G LVP++   L  + S    +SP+V++I + G R 
Sbjct: 335 KSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL-ANDSAVIASSPFVISIQNAGTRA 393

Query: 415 VPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILF 474
           +P   NAV+LL ++S +NS  Y   R+L++L+  G AP+ F+Y+ + G P   +I +   
Sbjct: 394 LPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAAL 453

Query: 475 GIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQ 534
           G++AF   ++     F WL+ IS L+ +  W+ I LSHIRF +A+  +G S  +L F+++
Sbjct: 454 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAK 513

Query: 535 LGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR 594
           L  WG+ YA+  + + +  + + +  P      D  +FF +Y+++ +L V + G ++Y R
Sbjct: 514 LMPWGAYYASFFVTVIIFIQGFQAFTP----KFDVSTFFTSYISLILLAVLFSGCQLYYR 569

Query: 595 DWKLFIRAKNIDLITHRNIFDA 616
             +   + ++ID+ + R   +A
Sbjct: 570 C-RFIWKVEDIDIDSDRREIEA 590

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  232 bits (591), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/496 (27%), Positives = 245/496 (49%), Gaps = 13/496 (2%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           +E+   +++ ++ RH+ M +L               L  AGP G +I Y  MGT ++ + 
Sbjct: 29  QEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVT 88

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
           Q+ GEM  ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT
Sbjct: 89  QSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147

Query: 241 TKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS 300
             V                     + Y E +F+  + KVL I GF I           T 
Sbjct: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVT- 206

Query: 301 GYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRR 355
           G +G +YW +PG +       + +  RF   +            +E + I A E   PR+
Sbjct: 207 GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266

Query: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVV 415
            +P A K +++RIL  ++ S+ ++G LVPY+  +L  + S    +SP+++ I + G +++
Sbjct: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKIL 325

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           PH  NAVIL+ ++S  NS  Y   RIL+ L++   AP++F    + G P   ++ + +FG
Sbjct: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
            +A+   ++  ++ FTWLL I G++  F W+ I  SHIRF +A+  +G S ++L +++ L
Sbjct: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
             W + YA   + + ++ + + S AP         +FF  Y+++ + I+F+  ++I+ + 
Sbjct: 446 MPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC 501

Query: 596 WKLFIRAKNIDLITHR 611
            +L  + +++DL T R
Sbjct: 502 -RLVWKLQDVDLDTDR 516

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  233 bits (594), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 247/499 (49%), Gaps = 20/499 (4%)

Query: 126 HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGE 185
           H++++++ RH+ M +L             + L  AGP G +I Y  MGT +Y I Q+ GE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 186 MAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNN 245
           MA ++  +  +   +    +   FG +  ++Y   W     +E+      I YWT KV  
Sbjct: 165 MA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 223

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
                              K Y E +F+  + KVL I G+ I             G IG 
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSH-QGPIGF 282

Query: 306 KYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 360
           +YW +PGA+       ++S  RF   +            +E + I A E +NPR+ +P A
Sbjct: 283 RYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 361 AKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFIN 420
              +++RI+  ++ S+  +G LVPY+   L  S S    +SP+V++I + G   +P   N
Sbjct: 343 INKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPS-SAVIASSPFVISIQNAGTYALPDIFN 401

Query: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480
           AV+L+ V+S +NS  Y   R+L+SL+Q G AP+ F Y+ ++G P   ++ +   G++AF 
Sbjct: 402 AVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFL 461

Query: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540
             ++     F WL++IS L+ +  W+ I L+HIRF +A+  +G S  +L F+++L  +G+
Sbjct: 462 VVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGA 521

Query: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR---DWK 597
            YA+  + + +  + + +  P          FF +Y+++ +L V +   ++Y +    WK
Sbjct: 522 YYASFFVTIIIFIQGFQAFCP-----FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 598 LFIRAKNIDLITHRNIFDA 616
           L    ++ID+ + R   +A
Sbjct: 577 L----EDIDIDSDRREIEA 591

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  232 bits (592), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/513 (28%), Positives = 250/513 (48%), Gaps = 21/513 (4%)

Query: 109 AAIKEHDVAITSKE--EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLV 166
           ++ +  D+A    E  E   +++S++ RH+ M +L             + L  AGP G +
Sbjct: 46  SSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGAL 105

Query: 167 IGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMP 226
           + Y  MGT ++ + Q+ GEMA ++  +  +F+ +    +    G A  ++Y + W     
Sbjct: 106 VAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFA 164

Query: 227 LELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFF 286
           LEL      I +WT KV                     K Y E +F+  + KVL + GF 
Sbjct: 165 LELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFL 224

Query: 287 ILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASE 341
           I           T G IG +YW +PGA        +    RF   +            +E
Sbjct: 225 IYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTE 283

Query: 342 FIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS 401
            + I A E +NPR+A+P A + ++ RIL  ++ S+  +G  VPY+  +L  + S    +S
Sbjct: 284 LVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSS 342

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           P+++ I + G RV+PH  NAVIL  ++S  NS  Y   RILFS+++ G AP++      +
Sbjct: 343 PFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQ 402

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           G P  +++    FG +++   S+   + F WLL I+G++  F W+ I  SH+RF +A+  
Sbjct: 403 GVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKH 462

Query: 522 QGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPI 581
           +G S  +L +++    W + YA   + + ++ + + S AP    H   + F   Y+++ +
Sbjct: 463 RGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGL 518

Query: 582 LIVFYFGYKIYNR---DWKLFIRAKNIDLITHR 611
            +VF+  ++IY R    WKL    +++D+ T R
Sbjct: 519 FLVFWGFFQIYFRCRIIWKL----EDVDIDTDR 547

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  232 bits (592), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/482 (29%), Positives = 238/482 (49%), Gaps = 13/482 (2%)

Query: 124 DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQAC 183
            A ++++++PRHV M +L               L  AGP G +I + ++GT  Y + Q+ 
Sbjct: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129

Query: 184 GEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKV 243
           GEMA ++  +  +F  +    +    G A  ++Y   W     LEL      I YWT  V
Sbjct: 130 GEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188

Query: 244 NNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYI 303
             +                  K Y E +F+  + KV+ I GF I             G I
Sbjct: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLI-YSLCMVCGAGPEGPI 247

Query: 304 GAKYWHDPGAFRGD---RSID--RFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
           G +YW  PG +      ++++  RF   +            +E + I A E  NPR+A+P
Sbjct: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA-SPYVLAISSHGVRVVPH 417
            A   + +RIL  ++ S+  +G LVPY+  +L GS +G   A SP+++AI +    V+PH
Sbjct: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S  NS  Y   RILF LS+   AP++F+   + G P  A++I+ +FG +
Sbjct: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S+  +EVF WLL I+ ++   TW+ I +SHIRF + +  +G S  +L ++++   
Sbjct: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMP 487

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
           + + YAA  + + +I + + + AP    H +   FF  Y+++ +  + +  ++   R  K
Sbjct: 488 YAAYYAAFFITVIIIIQGFTAFAP----HFNVSDFFAAYISVFLFFIVWAIFQTIYRT-K 542

Query: 598 LF 599
           LF
Sbjct: 543 LF 544

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  232 bits (592), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/503 (28%), Positives = 245/503 (48%), Gaps = 13/503 (2%)

Query: 119 TSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
           T    DA +++ ++ RH+ M +L             + L +AGP G +I Y  MGT +Y 
Sbjct: 65  TGYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYS 124

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           + Q+ GEMA ++  +  +F  +    +    G A  ++Y   W     LEL      I Y
Sbjct: 125 VTQSLGEMA-TFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQY 183

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           WT  V                     K Y E +F+    KV+ I GF +L          
Sbjct: 184 WTYAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGF-LLYCLCMVCGAG 242

Query: 299 TSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
            +G +G +YW +PG +       D++  RF   +            +E + I A E +NP
Sbjct: 243 VTGPVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANP 302

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVR 413
           R+A+P A K +++RILF ++ S+  +G LVPY+   L  + S    +SP+++AI + G  
Sbjct: 303 RKAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSY-VASSPFIIAIKNSGTP 361

Query: 414 VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISIL 473
           V+PH  NAVI   ++S  NS  Y   RILF LS+   AP+  +   + G P  A++++ +
Sbjct: 362 VLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSV 421

Query: 474 FGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRS 533
            G +A+   S+  +  F WLL I+ ++  FTW+ I LSHIRF +A+  +G S  +L F++
Sbjct: 422 VGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKA 481

Query: 534 QLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYN 593
            L    + YA+ ++F+ +I + + + AP          F   Y+++ + I  +  ++I  
Sbjct: 482 ALMPGLAYYASFLMFVIIIIQGFTAFAP----KFSGSDFAAAYISIFLFIGIWCLFQIIF 537

Query: 594 RDWKLFIRAKNIDLITHRNIFDA 616
           R  +   + +++D+ T R   +A
Sbjct: 538 RC-RFIHKVEDVDIDTDRRDIEA 559

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  233 bits (593), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 134/499 (26%), Positives = 245/499 (49%), Gaps = 14/499 (2%)

Query: 118 ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
           + ++  +  ++++++ RH+ M +L             + L  AGP G +I Y  MGT +Y
Sbjct: 83  LEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIY 142

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
            + Q+ GEMA ++  +  +   +    +   FG A  ++Y   W     +E+      I 
Sbjct: 143 FVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQ 201

Query: 238 YWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXX 297
           YWT  V                     K Y E +F+    KVL I G+ I          
Sbjct: 202 YWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGS 261

Query: 298 XTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSN 352
              G IG +YW  PGAF       +++  +F   +            +E + I A E +N
Sbjct: 262 H-QGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAAN 320

Query: 353 PRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGV 412
           PR+ +P A   +++RI+  ++ S+  +G L+PY+   L  +      +SP+V++I +   
Sbjct: 321 PRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL-SAQDAVIASSPFVISIKNAHT 379

Query: 413 RVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISI 472
           +V+P   NAV+++ V+S +NS  Y   R+L++L+  G AP+ F+Y+ R G P   ++ + 
Sbjct: 380 KVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTA 439

Query: 473 LFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFR 532
             G++AF   ++     F WL+ IS L+ +  W+ I L+HIRF +A+  +G S  +L F+
Sbjct: 440 SLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFK 499

Query: 533 SQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIY 592
           ++L  WG+ YAA  + + +  + + +  P      D  +FF +Y+++ +L V   G ++Y
Sbjct: 500 AKLMPWGAYYAAFFVTVIIFIQGYQAFCP-----WDVSTFFTSYISLILLAVLVVGCQLY 554

Query: 593 NRDWKLFIRAKNIDLITHR 611
            R  +  ++ ++ID+ T R
Sbjct: 555 YRG-RFLLKLEDIDIDTDR 572

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  231 bits (590), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/504 (29%), Positives = 245/504 (48%), Gaps = 17/504 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           KE+   L+K ++ RH+ M ++            G+AL   GPA ++I Y+ +G  ++ ++
Sbjct: 44  KEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVM 103

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
              GEMA +Y  L G F +Y T   D   GFAV + Y  ++  + P +L   ++ I YW 
Sbjct: 104 ACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
            +  VN                  G + + E +F+ ++ K++++ G  +           
Sbjct: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221

Query: 299 TSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
               +G +YW +PGAF+        S  +F   +             E   I A+E  NP
Sbjct: 222 NHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENP 281

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS--PYVLAISSHG 411
           RR IP A K+ +YRI+  ++ +I L+G  V Y+   L+ +    T A+  P+V+AI + G
Sbjct: 282 RRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSG 341

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           VR +PH  N  +L+ V S  NS  Y   R L+SL+  G AP+ F   +R G P  A+   
Sbjct: 342 VRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGC 401

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
            LF ++A+   SS   ++F + + +  +  I +W++I +++I F RA   Q    +   +
Sbjct: 402 FLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAY 461

Query: 532 RSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKI 591
           R+    +G+    T+ F  LIA        IGE   D KSF   Y+ +P+ ++FYFGYKI
Sbjct: 462 RAPFQPYGAY--ITLFFCVLIAFIKNFTVFIGE--FDYKSFITGYIGLPLYVIFYFGYKI 517

Query: 592 YNRDWKLFIRAKNIDLITHRNIFD 615
             +  KL ++A+  DL + +   D
Sbjct: 518 IYKT-KL-VKAEEADLYSFKEAID 539

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  232 bits (591), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 257/514 (50%), Gaps = 18/514 (3%)

Query: 112 KEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           +E  + I  K +   L+K ++ RHV M ++            G++L  AGP  ++I Y+ 
Sbjct: 40  QESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSF 99

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
           +G  +Y ++   GEMA +Y  L G F +Y +   D   GFAV + Y  ++L + P +L  
Sbjct: 100 VGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTA 157

Query: 232 ASMTIDYWTT--KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILX 289
           A++ + YW +  KVN                  G K + E +F+ ++ KVL++    +L 
Sbjct: 158 AALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLL 217

Query: 290 XXXXXXXXXTSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIA 344
                    +   +G +++ DPGAFR        S  +F   +            +E   
Sbjct: 218 FVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCG 277

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SP 402
           I A+E  NPRR +P A K+ +YRI+  +L +I L+G  V Y+   L+ +    T A  SP
Sbjct: 278 IVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASP 337

Query: 403 YVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREG 462
           +V+AI + G+ V+PH  NA +L+ V S  NS  Y + R L+ L+    AP+ F   ++ G
Sbjct: 338 FVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWG 397

Query: 463 RPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQ 522
            P  ++I+ ILF ++A+   SS   +VF + + +  +  + +W+AI +++I F RA+  Q
Sbjct: 398 VPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQ 457

Query: 523 GRSISELGFRSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPI 581
           G   S L + + L   G+ +A      +ALI  F V +        D K+F   Y+ +P+
Sbjct: 458 GVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPV 513

Query: 582 LIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
            I+ +FGYK Y R  K F++ +  DL T + + D
Sbjct: 514 FIICFFGYK-YIRGTK-FVKPEEADLYTFKELID 545

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  231 bits (588), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 141/505 (27%), Positives = 249/505 (49%), Gaps = 14/505 (2%)

Query: 112 KEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           +E ++A   +  +A +++ ++ RH+ M +L             + L  AGP G +I Y  
Sbjct: 45  QEEEIA-NGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLF 103

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231
           MGT +Y + Q+ GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL  
Sbjct: 104 MGTLVYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSV 162

Query: 232 ASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXX 291
               I +WT+ V                     + Y E +F+  + KVL I GF I    
Sbjct: 163 VGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLC 222

Query: 292 XXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIG 346
                  T G +G +YW +PG         + +  +F   +            +E + I 
Sbjct: 223 MVCGAGVT-GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGIT 281

Query: 347 ASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLA 406
           A E +NPR+++P A K +++RILF ++ S+  +G LVPY+  +L    S    ASP++++
Sbjct: 282 AGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIIS 340

Query: 407 ISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPAR 466
           I + G  ++PH  NAVIL  ++S +NS  Y   RI+F LS+   AP+  +  ++ G P  
Sbjct: 341 IQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWV 400

Query: 467 AMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSI 526
           ++I + LFG +A+   S+  E  F WLL I+G++  F+W+ I +SH+RF +A+  +G S 
Sbjct: 401 SVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISR 460

Query: 527 SELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFY 586
            +L F+++     + YA   + L +I + + S  P      D   F   Y++  + I  +
Sbjct: 461 DDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIW 516

Query: 587 FGYKIYNRDWKLFIRAKNIDLITHR 611
             ++++ R  +L  + +++D+ T R
Sbjct: 517 IVFQLWFRC-RLIWKIEDVDIDTDR 540

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  232 bits (591), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 146/487 (29%), Positives = 238/487 (48%), Gaps = 19/487 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K++   L+K ++ RH+ M ++            G+AL  AGPA ++I Y  +GT ++  +
Sbjct: 76  KDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTM 135

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
            A GEMA +Y  L G F +Y +   D   GFAV + Y  ++  + P +L  A++ I YW 
Sbjct: 136 AALGEMA-AYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWV 193

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
            +  VN                  G K + E +F+ ++ K++++ G  I           
Sbjct: 194 DRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGP 253

Query: 299 TSGYIGAKYWHDPGAFRG--------DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
               +G +YW  PGAF+         + S  +F   +             E   I A+E 
Sbjct: 254 NHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEA 313

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLAIS 408
            NPRR IP A K+ ++RILF ++++I L+G  V YD   L+ + +  T A  SP+V+AI 
Sbjct: 314 ENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQ 373

Query: 409 SHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468
           + GV V+PH  N  +L+ V S  NS  Y   R L+SL+  G AP+ F   +R G P  AM
Sbjct: 374 NSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAM 433

Query: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528
              +LF ++A+   SS   E+F + + +  +  + +W +I ++ I F RA+  QG   S 
Sbjct: 434 GGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRST 493

Query: 529 LGFRSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYF 587
             + +    +GS +A    + LALI  F V +     +  D K+F   Y+ +P+    + 
Sbjct: 494 FAYVAPFQPYGSYFALFFCVLLALIKNFSVFLG----NEFDYKTFITGYIGLPVYAFSFI 549

Query: 588 GYKIYNR 594
           GYK+Y +
Sbjct: 550 GYKLYYK 556

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  231 bits (588), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 140/502 (27%), Positives = 248/502 (49%), Gaps = 19/502 (3%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++A +++ ++ RH+ M +L             + L  AGP G +I Y  MG+  Y + Q+
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQS 139

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT  
Sbjct: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KV+ I GF I           T G 
Sbjct: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GP 257

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PGA+       +++  RF   +            +E + I A E +NPR+ +
Sbjct: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A K +++RIL  ++ S+  +G LVPY+  +L  S +     SP+++AI + G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPH 376

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S +NS  Y   R+LF LS+   AP++F+   + G P  A+  + +FG +
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S+   +VF WLL I+G++  F W+ I +SHIRF +A+  +G S  EL F+++L  
Sbjct: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR--- 594
             + YA   + + ++ + + S  P      +  +F   Y+++ + +  +  +++  R   
Sbjct: 497 GLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIFRCRF 552

Query: 595 DWKLFIRAKNIDLITHRNIFDA 616
            WK+    +++D+ + R   +A
Sbjct: 553 VWKI----EDVDIDSDRRDIEA 570

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  229 bits (584), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 249/499 (49%), Gaps = 13/499 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++A +++ ++ RH+ M +L             + L  AGP G +I Y  MG+  + + Q+
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQS 139

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT K
Sbjct: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KV+ I GF I           T G 
Sbjct: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GP 257

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PGA+       +++  RF   +            +E + I A E +NPR+ +
Sbjct: 258 VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A K +++RIL  ++ S+  +G LVPY+  +L  + S     SP+++AI + G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPH 376

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S +NS  Y   RILF LS+   AP++ +   + G P  A+  + +FG +
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           A+   S+  ++VF WLL I+G++  F W+ I +SHIRF +A+  +G S  EL F+++L  
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
             + Y++  + + +I + + + AP      +  SF   Y+++ + I  +  ++   R  +
Sbjct: 497 GLAYYSSFFMIIIIIIQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-R 551

Query: 598 LFIRAKNIDLITHRNIFDA 616
              + +++D+ + R   +A
Sbjct: 552 FIWKIEDVDIDSDRRDIEA 570

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  228 bits (581), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 140/507 (27%), Positives = 252/507 (49%), Gaps = 15/507 (2%)

Query: 110 AIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGY 169
           A KE +   +S +E   +++ ++ RH+ M +L            G  L  AGP G +I Y
Sbjct: 52  AAKETE---SSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISY 108

Query: 170 AIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLEL 229
             MGT +Y + Q+ GEM V++  +  +F+ +    +    G    ++Y + W     LEL
Sbjct: 109 LFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167

Query: 230 VTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILX 289
                 I YWT  V                     K Y E +F   + KV+ + GF I  
Sbjct: 168 SVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227

Query: 290 XXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIA 344
                    + G IG +YW +PGA+       D++  RF   +            +E + 
Sbjct: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYV 404
           I A E +NPR+A+P A K ++ RIL  ++ S+  +G LVPY+  +L   G     +SP++
Sbjct: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIF-VSSSPFM 346

Query: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464
           ++I + G +V+P   NAV+L+ +LS  NS  Y   R+L+SLS+   AP++ + + R G P
Sbjct: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406

Query: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524
             +++ + +FG +AF   S+   + F WLL I+G++  F W+ I  SHIRF +A+  +G 
Sbjct: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466

Query: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIV 584
           S  +L +++Q+  + + YA+  + L ++ + + + AP          F   Y+++ + + 
Sbjct: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIFLFLA 522

Query: 585 FYFGYKIYNRDWKLFIRAKNIDLITHR 611
            +  ++++ +  +L  + ++ID+ + R
Sbjct: 523 IWLSFQVWFKC-RLLWKLQDIDIDSDR 548

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  229 bits (585), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 249/503 (49%), Gaps = 17/503 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K E   L+K ++ RH+ M ++            G +L  AGP   +I Y  +G  ++  +
Sbjct: 59  KYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTM 118

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
              GEMA ++  L G F +Y +   D   GFAV + Y I++  + P +L  A+M + YW 
Sbjct: 119 ACLGEMA-TFIPLDG-FTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWV 176

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
            +  VN                  G + + E +F+ ++ KVL++ G  IL          
Sbjct: 177 PRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAG 236

Query: 299 TSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
           +   +G +YW  PGAF         S+ +F   +             E   I A+E SNP
Sbjct: 237 SHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNP 296

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVR 413
           RR++P A K+  YRIL  ++ SI L+G  VPY+  +L+ +      ASP+ +AI + G+ 
Sbjct: 297 RRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGIT 356

Query: 414 VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISIL 473
           V+P   N  +L+ V S +NS  Y + R L+SL+    AP+ F + +R G P  ++ +S L
Sbjct: 357 VLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCL 416

Query: 474 FGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRS 533
           F ++A+   SS   +VF + + +  ++ + TW++I +++I F RA+  Q    S   + +
Sbjct: 417 FCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVA 476

Query: 534 QLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYN 593
               +G+    ++ F  LIA        +G  H D K+F   Y+ +PI ++ YFGYKI  
Sbjct: 477 PFQPYGAY--VSLFFCCLIAIIKNFTVFLG--HFDYKTFITGYIGLPIFVLCYFGYKITC 532

Query: 594 RDWKLFIR-AKNIDLITHRNIFD 615
           +     IR A+ +DL++ +++ D
Sbjct: 533 KSE---IRSARYVDLVSQKSLVD 552

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  228 bits (580), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 250/521 (47%), Gaps = 37/521 (7%)

Query: 115 DVAITSKEED--AHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           D +  S EED    L++ ++ RHV + +L             S LH  GPAGL I Y I+
Sbjct: 61  DTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCII 120

Query: 173 GTCLYCIIQACGEMAVSYSNLPGNFN---AYPTFLV----DEGFGFAVAWVYCIQWLCVM 225
            + +Y I+ A GEM V Y  LPG+ +      T LV    DE   FA  W Y   ++ ++
Sbjct: 121 SSVIYPIMNAVGEM-VCY--LPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILV 177

Query: 226 PLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGF 285
             E   A+  ++YWT  V                     K + E +F+F + K+L I G 
Sbjct: 178 AAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGL 237

Query: 286 FILXXXXXXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGASE 341
            IL          +   +G +YW +PGAF     D S+  F D+               E
Sbjct: 238 IILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGSLGNFLDIYSGIIKGAFAFILGPE 297

Query: 342 FIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGT 398
            +A+ +SE S+ RR I  A+K  IYR++F ++     +G +V ++   L   + + + G 
Sbjct: 298 LVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGA 357

Query: 399 KASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYI 458
            +SP+V+ I + G+ V+PH INA IL +  S  N+  ++S R LF+++Q G AP+ F  I
Sbjct: 358 GSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRI 417

Query: 459 DREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRA 518
           ++ G P  A+I+S L   +A+   SS    VFTWL  IS +S    W+  C++++RFR+A
Sbjct: 418 NKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKA 477

Query: 519 MHVQGRSISELGFRSQLGVWGSVY----AATMLFLALIAEFWVSIAPIGEDHLDAKSFFE 574
           +       + L  R     WG  Y    + T++ +  I   + +  P      +   F  
Sbjct: 478 IFY-----NNLYDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIP---KFWNVSDFIA 529

Query: 575 NYLAMPILIVFYFGYKIYNR---DW---KLFIRAKNIDLIT 609
            Y+ +PI +  Y G+K+YN    D+   KL    ++ID+IT
Sbjct: 530 AYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVIT 570

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  226 bits (577), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/498 (27%), Positives = 245/498 (49%), Gaps = 12/498 (2%)

Query: 119 TSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
           TS      +++ ++ RH+ M +L            G  L  AGP G +I Y  MGT +Y 
Sbjct: 58  TSPRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYS 117

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           + Q+ GEMA ++  +  +F+ +    +    G    ++Y + W     LEL      I Y
Sbjct: 118 VTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQY 176

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           WT  V                     K Y E +F   + KV+ + GF I           
Sbjct: 177 WTHAVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQ 236

Query: 299 TSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
             G IG +YW +PGA+       +++  RF   +            +E + I A E +NP
Sbjct: 237 PDGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 296

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVR 413
           R+A+P A K ++ RIL  ++ S+  +G LVPY+  +L   G+    ASP++++I + G +
Sbjct: 297 RKAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTF-VSASPFMISIENSGTK 355

Query: 414 VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISIL 473
           V+P   NAV+L+ + S  NS  Y   R+L+SLS+   AP+  + + R G P  A++++ L
Sbjct: 356 VLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSL 415

Query: 474 FGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRS 533
           FG +AF   S+   + F WLL I+G++  F W+ I  SHIRF +A+  +G S  +L +++
Sbjct: 416 FGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKA 475

Query: 534 QLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYN 593
           ++  + + YA+  + L ++ + + + AP          F   Y+++ +  + +  ++++ 
Sbjct: 476 RMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPVDFVAAYISVFLFAIIWLSFQLWF 531

Query: 594 RDWKLFIRAKNIDLITHR 611
           +  +L  + ++ID+ + R
Sbjct: 532 KC-RLICKLQDIDIDSDR 548

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  226 bits (577), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 154/560 (27%), Positives = 266/560 (47%), Gaps = 23/560 (4%)

Query: 69  LGV-KEPHLKRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHL 127
           LGV K       + SF    +  +  K          S  S A+ + +     K  D  L
Sbjct: 3   LGVFKTGQGSSIVPSFSNHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRL 62

Query: 128 RKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMA 187
           +K ++ RHV M ++            G++L  AGP  ++I Y+ +G  ++ ++   GEMA
Sbjct: 63  KKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMA 122

Query: 188 VSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT--KVNN 245
            +Y  L G F +Y +   D   GFAV + Y +++  + P +L  A++ I YW    KVN 
Sbjct: 123 -AYIPLDG-FTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNP 180

Query: 246 DXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGA 305
                            G K + E +F+ ++ KV+++ G  IL          T   +G 
Sbjct: 181 GVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGF 240

Query: 306 KYWHDPGAFR-------GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIP 358
           +YW  PGAF+       GD  I RF   +             E   I A+E  NPR+ IP
Sbjct: 241 RYWKHPGAFKEYSKSIHGD--IGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIP 298

Query: 359 SAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLAISSHGVRVVP 416
            A K+ ++RI+  ++ +I L+G  V  +   L+ + +  T A  SP+V+AI + G+  +P
Sbjct: 299 KAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALP 358

Query: 417 HFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGI 476
           H  NA +L+ V S  NS  Y + R L+SL+    AP+ F   +R G P  ++ +++LF +
Sbjct: 359 HIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCL 418

Query: 477 IAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLG 536
           +A+ + SS   ++F + + +  ++ + TW++I +++I F RA+  QG   S   + + L 
Sbjct: 419 LAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQ 478

Query: 537 VWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
            +G+ ++      LALI  F V +        D ++F   Y+ +P+  + YFGYK   + 
Sbjct: 479 PYGAYFSLFFCCLLALIKNFTVFL----NHKFDYRNFITGYIGLPLFFICYFGYKFVKK- 533

Query: 596 WKLFIRAKNIDLITHRNIFD 615
                + + +DL + +   D
Sbjct: 534 -TKIRKPEEVDLFSFKAAID 552

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  226 bits (577), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/517 (28%), Positives = 253/517 (48%), Gaps = 20/517 (3%)

Query: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
           ++     +  K E   L+K ++ RHV M ++            GS+L  AGP  ++I Y+
Sbjct: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYS 93

Query: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230
            +G  +Y ++   GEMA ++  L G F +Y +  VD   GFAV + Y  ++  V P +L 
Sbjct: 94  FVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151

Query: 231 TASMTIDYWTTK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
             +M + +W ++  VN                  G + + E +F+ ++ KVL++ G  +L
Sbjct: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILL 211

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFI 343
                          G ++W DPGAF+        S  +F                +E  
Sbjct: 212 LFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELC 271

Query: 344 AIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--S 401
            I A+E  NPRR++P A K+ +YRI+  ++ +I L+G  V Y+   L+ +    T A  S
Sbjct: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAAS 331

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           P+V+AI +  + V+PH  N  +L+ V S  NS  Y + R L+ L+  G AP+ F   ++ 
Sbjct: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           G P  ++ +S+LF ++A+   SS   +VF + + +  +  + +W+ I +++IRF +A+ V
Sbjct: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451

Query: 522 QGRSISELGFRSQLGVWGSVYAATML--FLALIAEFWVSIAPIGEDHLDAKSFFENYLAM 579
           Q    S L + +    W S Y A      + LI  + V +        D K+F   Y+ +
Sbjct: 452 QFGDKSSLSYTAAFQPW-STYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISGYIGI 506

Query: 580 PILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           P+ ++ Y GYK+  R  KL I+ +++DL T ++  DA
Sbjct: 507 PVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAIDA 541

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  226 bits (576), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/501 (27%), Positives = 248/501 (49%), Gaps = 18/501 (3%)

Query: 119 TSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
           TS  +   +++ ++ RH+ M +L            G  L  AGP G +I Y  MGT +Y 
Sbjct: 58  TSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYS 117

Query: 179 IIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDY 238
           + Q+ GEMA ++  +  +F+ +    +    G    ++Y + W     LEL      I Y
Sbjct: 118 VTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQY 176

Query: 239 WTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           WT  V                     K Y E +F   + KV+ + GF             
Sbjct: 177 WTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQ 236

Query: 299 TSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
           + G IG +YW +PGA+       +++  RF   +            +E + I A E +NP
Sbjct: 237 SGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 296

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVR 413
           RRA+P A K ++ RIL  ++ S+  +G LVPY+  +L   G+    +SP++++I + G +
Sbjct: 297 RRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTF-VSSSPFMISIENSGTK 355

Query: 414 VVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISIL 473
           V+P   NAV+L+ +LS  NS  Y   R+L+SLS+   AP++ + + + G P  A++ +  
Sbjct: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSA 415

Query: 474 FGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRS 533
           FG +AF   S+   +VF WLL I+G++  F W+ I LSHIRF +A+  +G S  +L +R+
Sbjct: 416 FGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRA 475

Query: 534 QLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYN 593
           ++  + + YA+  + L ++ + + + AP          F   Y+++ + I  +  ++++ 
Sbjct: 476 RMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFIAAYISVFLFIAIWLLFQVWF 531

Query: 594 R---DWKLFIRAKNIDLITHR 611
           +    WKL    +++D+ + R
Sbjct: 532 KCRFVWKL----QDVDIDSDR 548

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  226 bits (575), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 147/508 (28%), Positives = 250/508 (49%), Gaps = 16/508 (3%)

Query: 118 ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
           +  K E   L+K+++ RHV M ++            GS+L  AGPA ++I Y+ +G  +Y
Sbjct: 42  VDGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVY 101

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
            ++   GEMA ++  L G F +Y +  VD   GFAV + Y  ++  V P +L   +M + 
Sbjct: 102 TVMACLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159

Query: 238 YWTT--KVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXX 295
           YW +  KVN                  G + + E +F+ ++ KVL++ G  +L       
Sbjct: 160 YWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLG 219

Query: 296 XXXTSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
                   G +YW DPGAF+        S  +F                +E   I A+E 
Sbjct: 220 GGPNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEA 279

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLAIS 408
            NPRR++P A K+ +YRI+  ++ SI L+G  V Y+   L+ +    T A  SP+V+AI 
Sbjct: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIK 339

Query: 409 SHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468
           + G+ V+PH  NA +LL V S  NS  Y + R L+ L+    AP+ F   +  G P  ++
Sbjct: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399

Query: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528
            +S+LF ++A+   SS   ++F + + +  +  + +W++I ++++RF +A+  Q    S 
Sbjct: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459

Query: 529 LGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFG 588
             + +    W +    ++ F  LI         +G    D K+F   Y+ +P+  + Y G
Sbjct: 460 FSYTAPFQPWST--WVSLFFCCLIGLIKNYTVFLGHT-FDYKTFISGYIGIPVYAICYVG 516

Query: 589 YKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           YK+ +R  KL I+ +++DL T +   DA
Sbjct: 517 YKLVHRS-KL-IKPEDVDLYTFKAAIDA 542

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  226 bits (575), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 144/505 (28%), Positives = 247/505 (48%), Gaps = 27/505 (5%)

Query: 113 EHDVAITSKEEDA-HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAI 171
           E D+   +KE  + +L+  +Q RH+ + +L             S L   GPA LVI Y +
Sbjct: 41  EVDIESGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIV 100

Query: 172 MGTCLYCIIQACGEMAVSYSNLPGNFN-----AYPTFLV----DEGFGFAVAWVYCIQWL 222
           + T +Y I+   GEM V Y  LPGN +      Y  +LV    DE  GFA +W Y   ++
Sbjct: 101 ISTIVYPIMNMFGEM-VCY--LPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFI 157

Query: 223 CVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMI 282
            ++  E   AS  ++YWT+K+                     K Y EA+F+F   K+  I
Sbjct: 158 VLVATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCI 217

Query: 283 TGFFILXXXXXXXXXXTS---GYIGAKYWHDPGAFRG---DRSIDRFKDVMXXXXX-XXX 335
           TG  I+           +    ++G  YW +P +FR    + S+  F DV          
Sbjct: 218 TGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVTNGSLGNFLDVYNALIKGAFA 277

Query: 336 XXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGS-- 393
                E +++ +SE  + RR I  A++  +YR++F ++     +  +VPY+   L+ +  
Sbjct: 278 FILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALA 337

Query: 394 -GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAP 452
               G  +SP+V+ I + G+ ++PH IN  IL + +S  N+  ++S R L ++ + G AP
Sbjct: 338 LNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAP 397

Query: 453 QWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSH 512
           + F+ I+R G P  A+ +SI+   +AF  CS+   +VF W   IS +S    W   C+++
Sbjct: 398 RIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAY 457

Query: 513 IRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSF 572
           +RFRR +   G     L F+++  V+ + Y+   + + ++   ++ I P   ++ D   F
Sbjct: 458 LRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQD---F 513

Query: 573 FENYLAMPILIVFYFGYKIYNRDWK 597
              Y+ +P+ +V YFG+ IY+  W+
Sbjct: 514 IAAYITLPVFLVLYFGHIIYSGRWR 538

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  225 bits (574), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 135/502 (26%), Positives = 243/502 (48%), Gaps = 16/502 (3%)

Query: 105 SPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           +P +   KE +V+   K+E   +++ +  RH+ M +L             + L  +GP G
Sbjct: 39  TPTTTPSKE-NVSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVG 97

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
            +I Y  +GT +Y + Q+ GEMA ++  +  +F  +    +    G A  ++Y   W   
Sbjct: 98  SLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMT 156

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
             LEL      I +WT  V                     + Y E +F+    KV  I G
Sbjct: 157 FALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILG 216

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGA 339
           F I           T G +G +YW +PG +       + +  RF                
Sbjct: 217 FIIYCFCIVCGAGKT-GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQG 275

Query: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTK 399
           +E + I A E +NPR+ +P A + +++RIL  ++ S+  +G LVPYD  +L    S    
Sbjct: 276 TELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VS 334

Query: 400 ASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYID 459
           +SP+++AI + G +++PH  N VIL+ ++S  NS  Y   R+LF L++ G  P+ F    
Sbjct: 335 SSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTT 394

Query: 460 REGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAM 519
           + G P  A++ + LFG +AF   S+  +E F WLL + G++  F+W+ I  +HIRF + +
Sbjct: 395 KSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCL 454

Query: 520 HVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAM 579
             +G S ++L F+++   + + YA  ++ + +  + + + AP      D  +FF +Y+++
Sbjct: 455 QSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISV 510

Query: 580 PILIVFYFGYKIYNR---DWKL 598
            +  +F+  ++++ +    WKL
Sbjct: 511 FLFFIFWGSFQLWFKCRYVWKL 532

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  225 bits (573), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/501 (27%), Positives = 241/501 (48%), Gaps = 13/501 (2%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           +  +A ++++++ RH+ M +L             + L  AGP G +I Y  M T +Y ++
Sbjct: 71  QVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVV 130

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
           Q+ GEMA ++  +   F  + +  +   FG A  ++Y   W     LEL      I++WT
Sbjct: 131 QSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189

Query: 241 TKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTS 300
           T V                     K Y E +F+    KV+ + GF I           T 
Sbjct: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT- 248

Query: 301 GYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRR 355
           G +G +YW +PGA+       D++  RF   +            +E + I A E +NPR+
Sbjct: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308

Query: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVV 415
           ++P A K +++RIL  +      +G LVPY+  +L  S      +SP+++AI + G +V+
Sbjct: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           PH  NAV+L  ++S  NS  Y   RI++ L++   AP +F   +  G P  A+  +  FG
Sbjct: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
            +A+   S+     F WLL I+G++  FTW+ I   HIRF +A+  +G S  +L F+++ 
Sbjct: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
             W + YA   + + ++ + + + AP          F   Y+++ + I  + G +I+ R 
Sbjct: 488 MPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC 543

Query: 596 WKLFIRAKNIDLITHRNIFDA 616
            ++F R   +D+ T R   +A
Sbjct: 544 -RIFHRLDEVDIDTDRRDIEA 563

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  225 bits (573), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 155/512 (30%), Positives = 248/512 (48%), Gaps = 26/512 (5%)

Query: 118 ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLY 177
           I  K E   L+K+++ RHV M ++            G++L  AGP   +I YA +G  ++
Sbjct: 59  IDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVF 118

Query: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237
             +   GEMA +Y  L G F +Y +   D   GFAV + Y  ++  + P +L  A++ I 
Sbjct: 119 FTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176

Query: 238 YWT--TKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXX 295
           YW    KVN                  G + + E +F+ ++ KVL++ G  +L       
Sbjct: 177 YWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLG 236

Query: 296 XXXTSGYIGAKYWHDPGAFR-------GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGAS 348
                  +G +YW  PG+F+       GD    RF   +             E   I A+
Sbjct: 237 GGPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAA 294

Query: 349 EQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLA 406
           E  NPR++IP A K+ +YRI+  +L SI L+G  V YD   L+ + +  T A  SP+V+A
Sbjct: 295 EAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVA 354

Query: 407 ISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPAR 466
           I + G+  +PH INA +L+ V S  NS  Y S R L+SL+    AP+ F   +R G P  
Sbjct: 355 IINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYY 414

Query: 467 AMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSI 526
           A+ +S+LF ++A+   SS   ++F + + +  +  I +W++I +++I F RA+  QG   
Sbjct: 415 ALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDK 474

Query: 527 SELGFRSQL---GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILI 583
           S   + +     G W S++   +  +ALI  F V +        D K+F   Y+ +P+  
Sbjct: 475 STFAYVAPFQPYGAWFSLFFCCL--IALIKNFTVFL----NHQFDYKNFITGYIGLPVFF 528

Query: 584 VFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
             YFGYK +    K+ I    +DL T +   D
Sbjct: 529 FCYFGYK-FTYKTKV-IDPLKVDLYTFKAAID 558

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  224 bits (571), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 141/505 (27%), Positives = 244/505 (48%), Gaps = 18/505 (3%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K+E   LRK ++ RH+ M ++            G+AL   GP  ++I Y  +G  ++  +
Sbjct: 74  KDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTM 133

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240
              GEMA SY  L G F +Y +  VD   GFA+ + Y  ++  + P +L  A++ I YW 
Sbjct: 134 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 241 TK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
           ++  VN                  G + + E +F+ ++ KV+++ G  +L          
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 299 TSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNP 353
               +G +YW DPGAF+        S  +F                 E   I  SE  NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLAISSHG 411
           R+++P A K+ +YRI+  +L ++ L+G  V Y+   L+ +      A  SP+V+AI + G
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471
           ++V+PH  N  +L+ V S  NS  Y S R L++L+  G AP+ F    + G P  A+++S
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531
           +LF  +A+   S+   ++F + + +  +  I +W+ I + +I F RA   QG   S+  +
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 532 RSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590
            +    +G+ +A    + +ALI  F V +        D K+F   Y+ +PI +  + GYK
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLG----HTFDYKTFITGYIGLPIYVFSWVGYK 547

Query: 591 IYNRDWKLFIRAKNIDLITHRNIFD 615
           +  +     ++  + DL T + I+D
Sbjct: 548 LIYK--TKVVKPADADLYTLKEIYD 570

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  224 bits (572), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 145/511 (28%), Positives = 237/511 (46%), Gaps = 20/511 (3%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E   ++    E   L++ +Q RHV + +L             S LH  GPAGL I Y I+
Sbjct: 96  EKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIII 155

Query: 173 GTCLYCIIQACGEMAV----SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLE 228
              +Y I+ A GEM        S+  G+     T  VD   GFA  W Y   ++ ++  E
Sbjct: 156 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAE 215

Query: 229 LVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
              AS  ++YWTT V                     K Y E++F+F + K+L I G  IL
Sbjct: 216 CTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIIL 275

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGASEFIA 344
                         +G +YW  PGAF       S+  F D+               E + 
Sbjct: 276 SFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVC 335

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGTKAS 401
           + ++E ++ RR I  A++  ++R++F ++     +  +VPY+   L   +  G  G  +S
Sbjct: 336 MTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSS 395

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           P+V+ I + G++V+PH IN  IL +  S +N+  ++S R L +++Q G AP+    I+R 
Sbjct: 396 PFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRW 455

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           G P  A+ +S L   +A+   SS   +VF W   IS +S    WM  C++++RFR+A+  
Sbjct: 456 GVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFY 515

Query: 522 QGRSISELGFRSQLGVWGSVYA--ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAM 579
            G     L F++    WG  Y   A+++ + +I       A     +     F   Y+ +
Sbjct: 516 NGL-FDRLPFKT----WGQPYTVWASLIVVGIIT-LTNGYAIFIPKYWKIADFIAAYITL 569

Query: 580 PILIVFYFGYKIYNRDW-KLFIRAKNIDLIT 609
           PI +V +FG+K+Y R W + ++    ID+ T
Sbjct: 570 PIFLVLWFGHKLYTRTWSQWWLPVSEIDVTT 600

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  222 bits (566), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 134/494 (27%), Positives = 234/494 (47%), Gaps = 17/494 (3%)

Query: 107 LSAAIKEHDVA----ITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGP 162
           + A +  H+ +    +  K   + +++ ++PRHV M SL             S +  AGP
Sbjct: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGP 84

Query: 163 AGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWL 222
            G ++ Y  + T  YC+ Q+ GEMA ++  +  +F  + +  V    G A  ++Y + W 
Sbjct: 85  VGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143

Query: 223 CVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMI 282
               LE+      I YW+  V                     K Y E +F+  + KV+ I
Sbjct: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203

Query: 283 TGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXX 337
             F +             G IG +YW DPG +       +    +F   +          
Sbjct: 204 LCF-LFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262

Query: 338 GASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSG- 396
             +E + + A E  NPRR +P A   + +RIL  ++ S+ ++G LV YD  +L+  GS  
Sbjct: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322

Query: 397 GTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFN 456
              ASP+V+AI++ G +V+P  +N VI++ ++S  NS  Y   R+L+ L + G AP + +
Sbjct: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382

Query: 457 YIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFR 516
                G P  A++ + +FG + +   SSK   VF WLL+I+ +S  FTW+ I +SHIRF 
Sbjct: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442

Query: 517 RAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENY 576
           + +  +G S  +L F+++   +G+ YAA  + + ++ + + +  P       A  F   Y
Sbjct: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYY 497

Query: 577 LAMPILIVFYFGYK 590
           ++  I +V +  ++
Sbjct: 498 ISAFIFVVIWLLFQ 511

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  222 bits (565), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 134/501 (26%), Positives = 238/501 (47%), Gaps = 15/501 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++  ++++++ RH+ M +L             S L  AGP G ++ Y  +GT +Y I Q+
Sbjct: 51  QETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQS 110

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +   +    +   FG A  ++Y   W     +EL      I YWT +
Sbjct: 111 LGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDR 169

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     + Y E +F+  + KVL I G+ I             G 
Sbjct: 170 VPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLI-YAFIIVCGGSKQGP 228

Query: 303 IGAKYWHDPGAFRGDRSIDR-------FKDVMXXXXXXXXXXGASEFIAIGASEQSNPRR 355
           IG        A RG R+  R       F   +            +E + I A E +NPR+
Sbjct: 229 IGLPATGGIPA-RGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRK 287

Query: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVV 415
            +P A   + +RILF ++ S+  VG LVPYD   L    S    ASP+V++I + G +++
Sbjct: 288 NVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKIL 347

Query: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475
           P   NAV+L+ V+S +NS  Y   R+ +SL+  G AP+   ++ ++G P   ++I+ L G
Sbjct: 348 PDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMG 407

Query: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535
           +++F   +      F WL+ IS L+ +  W+ I L+HIRF + +  +G S  +L F+++ 
Sbjct: 408 LMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKF 467

Query: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595
             W + YA   + + +  + + +  P      D  +FF +Y+++ ++++ + G +IY + 
Sbjct: 468 MPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISLFLMLLVFIGCQIYYKC 523

Query: 596 WKLFIRAKNIDLITHRNIFDA 616
            +     ++ID+ + R   DA
Sbjct: 524 -RFLWAVEDIDIDSDRREIDA 543

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  223 bits (569), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/513 (28%), Positives = 236/513 (46%), Gaps = 24/513 (4%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E   ++    E   L++ +Q RHV + +L             S LH  GPAGL I Y I+
Sbjct: 92  EKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIII 151

Query: 173 GTCLYCIIQACGEMAV----SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLE 228
              +Y I+ A GEM        S+  G+     T  VD   GFA  W Y   ++ ++  E
Sbjct: 152 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAE 211

Query: 229 LVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
              AS  ++YWTT V                     K Y E++F+F + K+L I G  IL
Sbjct: 212 CTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIIL 271

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGASEFIA 344
                         +G +YW  PGAF       S+  F D+               E + 
Sbjct: 272 SFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVC 331

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGTKAS 401
           + ++E ++ RR I  A++  ++R++F ++     +  +VPY+   L   +  G  G  +S
Sbjct: 332 MTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSS 391

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           P+V+ I + G++V+PH IN  IL +  S +N+  ++S R L +++Q G AP+    I++ 
Sbjct: 392 PFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKW 451

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           G P  A+ +S L   +A+   SS   +VF W   IS +S    WM  C++++RFR+A+  
Sbjct: 452 GVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFY 511

Query: 522 QGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSI----APIGEDHLDAKSFFENYL 577
            G     L  R     WG  Y    ++ +LI    ++I    A     +     F   Y+
Sbjct: 512 NG-----LYDRLPFKTWGQPYT---VWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYI 563

Query: 578 AMPILIVFYFGYKIYNRDWK-LFIRAKNIDLIT 609
            +PI +V +FG+K+Y R W+  ++    ID+ T
Sbjct: 564 TLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTT 596

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  222 bits (566), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 259/526 (49%), Gaps = 28/526 (5%)

Query: 110 AIKEHDVAITSK----------EEDAH---LRKSIQPRHVLMSSLAXXXXXXXXXXNGSA 156
           +I+  DV ++S+          E D H   ++++++PRHV M +L               
Sbjct: 43  SIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKP 102

Query: 157 LHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWV 216
           L  +GP G +I Y  MG+ +Y + Q+ GEMA ++  +  +   +    +   FG A  ++
Sbjct: 103 LSLSGPVGSLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYM 161

Query: 217 YCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNT 276
           Y   W     +EL      I+YWT  V                     K Y E +F   +
Sbjct: 162 YWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVAS 221

Query: 277 CKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSID------RFKDVMXXX 330
            KV+ I G+ +L          + G IG +YW +PG + G  +I       RF   +   
Sbjct: 222 IKVIAIVGY-LLYALIIVCGGSSQGPIGFRYWRNPGPW-GTGTIAKNVNKARFLGWVGSL 279

Query: 331 XXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL 390
                    +E + I A E SNPR+ +P A   + +RIL  ++ S+  VG LVPY+S +L
Sbjct: 280 VNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL 339

Query: 391 MGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGY 450
             S S    +SP+V++I + G +V+P   NAV+L+ +LS  NS  Y   R+L+SL+  G 
Sbjct: 340 E-SNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGN 398

Query: 451 APQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICL 510
           AP+ F+Y+ ++G P   +I + L G++AF A +      F WL+ IS L+ +  W  I +
Sbjct: 399 APKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISV 458

Query: 511 SHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAK 570
           +HIRF + + ++G S   L F+++L  WG+ YAA  + L +  + + + AP      D  
Sbjct: 459 AHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP----RFDVS 514

Query: 571 SFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
            FF  Y+++ +L+V +   ++Y R  +   + ++ID+ + R   DA
Sbjct: 515 EFFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRREIDA 559

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  222 bits (565), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 141/499 (28%), Positives = 238/499 (47%), Gaps = 13/499 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           ++A +++ ++ RH+ M +L             + L  AGP G +I Y  M T ++ + Q+
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  + +  +    G A  ++Y   W     LEL      I +WT  
Sbjct: 153 LGEMA-TFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHA 211

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KVL I GF I           T G 
Sbjct: 212 VPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT-GP 270

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PG +       D +  RF   +            +E + I A E +NPR+ +
Sbjct: 271 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 330

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A K + +RIL  ++ S+  +G LVPYD  +L  + S    ASP+++AI + G +++PH
Sbjct: 331 PRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSY-ISASPFIIAIENSGTKILPH 389

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S  NS  Y   RILF L++   AP+WF Y  R G P  ++  +  FG +
Sbjct: 390 IFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGAL 449

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   SS   + F WLL I  ++  F W+ I ++H+RF +A+  +G S  +L F+++   
Sbjct: 450 AFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMP 509

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597
             + Y+   + + +I + + + AP      +   F   Y+++ +    +  +++Y R  K
Sbjct: 510 HLAYYSIFFMTIIIIIQGFTAFAP----TFNGSDFVAAYISIFLFFFLWLCFQLYFRS-K 564

Query: 598 LFIRAKNIDLITHRNIFDA 616
           L    + +D+ T R   DA
Sbjct: 565 LLWTVEEVDIDTDRRDVDA 583

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  219 bits (558), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/460 (28%), Positives = 234/460 (50%), Gaps = 12/460 (2%)

Query: 157 LHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWV 216
           L  AGP G +I Y  MGT +Y + Q+ GEMA ++  +  +F+ +    +    G    ++
Sbjct: 20  LAHAGPVGALISYIFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 217 YCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNT 276
           Y + W     LEL      I YWT  V                     K Y E +F   +
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 277 CKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMXXXX 331
            KV+ + GF I             G IG +YW +PGA+       D++  RF   +    
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 332 XXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM 391
                   +E + I A E +NPR+A+P A K ++ RIL  ++ S+  +G LVPY+  +L 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 392 GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYA 451
             GS    ASP++++I + G +V+P   NAV+L+ ++S  NS  Y   R+L+SLS+   A
Sbjct: 259 SDGSF-VSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 452 PQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLS 511
           P++ + + + G P  A++ + +FG +AF   S+   + F WLL I+G++  F W+ I  S
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 512 HIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKS 571
           HIRF +A+  +G S ++L +++++  + + YA+  + L ++ + + + AP          
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SFQPVD 433

Query: 572 FFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHR 611
           F   Y+++ + +  +F ++++ +   + ++ +++D+ + R
Sbjct: 434 FVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDR 472

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  221 bits (564), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/509 (30%), Positives = 245/509 (48%), Gaps = 23/509 (4%)

Query: 121 KEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCII 180
           K E   L+K +Q RHV M ++            GS+L +AGP  ++I Y+IMG  ++ ++
Sbjct: 53  KHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVM 112

Query: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYW- 239
              GEMA +Y  L G F +Y T   D   GFAV W Y  ++L + P +L   ++ I +W 
Sbjct: 113 SCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 240 -TTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXX 298
              +V+                  G + + E +F+ ++ KVL++    IL          
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 299 TSGYIGAKYWHDPGAFRGDRSID--------RFKDVMXXXXXXXXXXGASEFIAIGASEQ 350
           T   +G +YW DPGAF+     D        +F   +            +E   I A+E 
Sbjct: 231 THDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAEC 290

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM--GSGSGGTKASPYVLAIS 408
            +PRR +P A K+ +YRI+  +L +I L+G  V Y+   LM   S      ASPYV+AI 
Sbjct: 291 KDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIE 350

Query: 409 SHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468
           +  + V+P+  NA +L  V S  NS  Y   R L+ L+  G AP+ F   ++ G P  A+
Sbjct: 351 NAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNAL 410

Query: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528
               LF  +A+ + S      F + + ++ +  + +W++I +++I F RA   QG   S 
Sbjct: 411 ACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKST 470

Query: 529 LGFRSQLGVW-GSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYF 587
           L + +    + G V     +F+ALI  F    A IG++ +D  +F   Y+ +PI I  + 
Sbjct: 471 LSYVAPCQPYAGWVALIFCIFVALIKNF---DAFIGKE-VDVPTFITGYIGLPIYIFCFI 526

Query: 588 GYKIYNR-DWKLFIRAKNIDLITHRNIFD 615
           GYKI ++  W   I +K +DL T +   D
Sbjct: 527 GYKIVHKTKW---IPSKEVDLFTFKEAID 552

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score =  213 bits (543), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 192/326 (58%), Gaps = 6/326 (1%)

Query: 323 FKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFL 382
           FK++           G SE + + ++E  N   AI  AAK   +RI   +++++ ++G L
Sbjct: 5   FKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-AISRAAKGTFWRIAIFYITTVVIIGCL 63

Query: 383 VPYDSSELM-GSGSGGTKASPYVLAISSHGVR--VVPHFINAVILLAVLSVSNSAFYSSC 439
           VPY+ S L+ GS S    ASP+V+A+S+ G     V +F+N VIL+AV+SV NS  Y+S 
Sbjct: 64  VPYNDSRLLNGSTSEDISASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASS 123

Query: 440 RILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGL 499
           R++ +L   G  P   +Y+DR+GRP   + IS +FG++ F   S+KE+EVFTWL A+  +
Sbjct: 124 RLIQALGASGQLPSICSYMDRKGRPLVGIAISGVFGLLGFLVASNKEDEVFTWLFALCSI 183

Query: 500 SQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSI 559
           S  FTW  IC+S IRFR A+  QGRS  E+ ++S LGV+G V    +  L +  E +VS 
Sbjct: 184 SSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSA 243

Query: 560 APIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK-LFIRAKNIDLITHRNIFDAXX 618
           AP+G     AK+FFE  L++PI+IV Y  ++IY +DW+  +I+  +IDL T  +I +   
Sbjct: 244 APVGSPS-SAKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLDL 302

Query: 619 XXXXXXXXXXXLKNGPTWKRLVHFWC 644
                      + + P + ++  FWC
Sbjct: 303 FKAQKEAEKELIASKPFYYKIYRFWC 328

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  221 bits (562), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 152/555 (27%), Positives = 260/555 (46%), Gaps = 26/555 (4%)

Query: 77  KRFIDSFKRAEEGTEETKHMXXXXXXXXSPLSAAIKEHD----VAITSKEEDAHLRKSIQ 132
           + + D  K+ +  T  T+          + +S +    D      +  K E   L+K ++
Sbjct: 17  EEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLE 76

Query: 133 PRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSN 192
            R V M ++            G++L  AGP  ++I YA +G  ++  + + GEMA SY  
Sbjct: 77  GRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMA-SYIP 135

Query: 193 LPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT--KVNNDXXXX 250
           L G F +Y T   D   GFAV + Y  ++  + P +L  A++ I YW    KVN      
Sbjct: 136 LDG-FTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWIT 194

Query: 251 XXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHD 310
                       G + + E +F+ ++ KVL++    IL              +G ++W  
Sbjct: 195 IFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKH 254

Query: 311 PGAFR-------GDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKI 363
           PGAF        GD    +F   +            +E + I   E  NPR+++P A K+
Sbjct: 255 PGAFNNYSPAITGDTG--KFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKL 312

Query: 364 MIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA--SPYVLAISSHGVRVVPHFINA 421
            +YRI+  +L SI L+G  V YD   L+ + +  T A  SP+V+AI + G++V+PH  NA
Sbjct: 313 TMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNA 372

Query: 422 VILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCA 481
            +L+ V S  NS  Y + R L+SL+    AP+ F   +R G P  ++ +S+LF ++A+ +
Sbjct: 373 CVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMS 432

Query: 482 CSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSV 541
            SS   ++F + + +  +  + +W+ I ++++ F RA+  QG   S   + +    +G+ 
Sbjct: 433 VSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAY 492

Query: 542 YAATML-FLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600
           +A      +ALI  F V +        D K+F   Y+ +P+  + YFGYK+  +     I
Sbjct: 493 FALFFCSLIALIKNFTVFLG----HQFDYKTFITGYIGIPVFFISYFGYKLIYK--TKII 546

Query: 601 RAKNIDLITHRNIFD 615
               +DL T +   D
Sbjct: 547 DPLEVDLYTFKAAID 561

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  220 bits (561), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 146/516 (28%), Positives = 240/516 (46%), Gaps = 20/516 (3%)

Query: 112 KEHDVAITSKEEDAHLR-----KSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLV 166
            E+DV  +   E   +R     ++++PRH+ M +L               L  AGP G++
Sbjct: 54  NEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGML 113

Query: 167 IGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMP 226
           I Y  M T  + ++Q+ GEMA +Y  +   F+ +    +   FG A  ++Y   W     
Sbjct: 114 IAYLFMATIAFSVMQSLGEMA-TYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFA 172

Query: 227 LELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFF 286
           LEL      + YWT KV                     K Y E +F+    KV+ I GF 
Sbjct: 173 LELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFI 232

Query: 287 ILXXXXXXXXXXTSGYIGAKYWHDPGAFRGDRSID------RFKDVMXXXXXXXXXXGAS 340
           I           T G +G +YW    AF GD  I       RF   +            +
Sbjct: 233 IYCFIMVCGAGKT-GPVGFRYWRHGYAF-GDGIISKNKNEARFLGWVSSLINAAFTYQGT 290

Query: 341 EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKA 400
           E + I A E +NPR+ +P + K  ++RIL  ++ S+  VG LVP++   L  S S    +
Sbjct: 291 ELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAA-S 349

Query: 401 SPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDR 460
           SP++LAI + G + +P   NAVIL  V+S +NS  Y   R+++S+++   AP       +
Sbjct: 350 SPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASK 409

Query: 461 EGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMH 520
            G P  A++ +   G +A+   SS    VF WL+ I+G++  F+W  I  SH+RF +A+ 
Sbjct: 410 GGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALK 469

Query: 521 VQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMP 580
            +G S ++L F++    W ++Y+   + L ++ + +    P    H  A  F  +Y+++ 
Sbjct: 470 QRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTP----HFQASDFVASYISVG 525

Query: 581 ILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616
           +  V +  ++I+ R   L +    ID+ T R   DA
Sbjct: 526 LFFVIWAVFQIWFRC-PLLVPIAEIDIDTDRRDVDA 560

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  218 bits (556), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 155/527 (29%), Positives = 246/527 (46%), Gaps = 39/527 (7%)

Query: 107 LSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLV 166
           LS++ ++H    T       L++ ++ RHV + +L             S LH  GPAGL 
Sbjct: 56  LSSSTEKHSPHYTDMTGH-ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLF 114

Query: 167 IGYAIMGTCLYCIIQACGEMAVSY----SNLPGNFNAYPTF-LVDEGFGFAVAWVYCIQW 221
           I Y I+ + +Y I+Q  GEM V Y     + P  F AY     VDE  GFA AW Y   +
Sbjct: 115 ISYCIISSVIYPIMQGIGEM-VCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCY 173

Query: 222 LCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLM 281
           + ++  E   AS  ++YWTT V                     K Y E++F+F + K+L 
Sbjct: 174 VILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILC 233

Query: 282 ITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF----RGDRSIDRFKDVMXXXXXXXXX- 336
           I G  IL              +G +YW +PG F    RG  S   F D+           
Sbjct: 234 IVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGG-SFGSFLDIYTGIIKGGFAF 292

Query: 337 XGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGS 393
               E IA+ +SE  + RR I  AA+  ++R++F ++     +  +V Y+   L   +  
Sbjct: 293 ILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQ 352

Query: 394 GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQ 453
              G  +SP+V+ I + G++V+PH INA IL +  S  N+  ++S R L +++Q G AP+
Sbjct: 353 NKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPR 412

Query: 454 WFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHI 513
            F  ++R G P  A+ +S     +A+  CSS   +VF W   IS +S    W+ +C+++I
Sbjct: 413 IFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYI 472

Query: 514 RFRRAMHVQGRSISELGFRSQ----LGVWG----SVYAATMLFLALIAEFWVSIAPIGED 565
           RF +A+   G   S L + ++    L  W     S+   T  +   I  FW         
Sbjct: 473 RFHKAILFHGMQ-SRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFW--------- 522

Query: 566 HLDAKSFFENYLAMPILIVFYFGYKIYNRD---WKLFIRAKNIDLIT 609
             DAK+F   Y+ +P+  V + G+++Y R     K +   + ID++T
Sbjct: 523 --DAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVT 567

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  217 bits (553), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 138/525 (26%), Positives = 255/525 (48%), Gaps = 36/525 (6%)

Query: 111 IKEHDVAITSKEE---------DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAG 161
           I++ D + T+++E         DA +++ ++ RH+ M +L             + L  +G
Sbjct: 37  IQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSG 96

Query: 162 PAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQW 221
           P G +I Y  +GT  Y + Q+ GEMA ++  +  +F  + +  +    G AV ++Y   W
Sbjct: 97  PVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSW 155

Query: 222 LCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLM 281
                LEL      +DYWT  V                     K Y E +F+    KV+ 
Sbjct: 156 AVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVA 215

Query: 282 ITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFRGD------------RSIDRFKDVMXX 329
           I GF I           T G +G +YW +PG + GD            ++  RF      
Sbjct: 216 IVGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNS 273

Query: 330 XXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSE 389
                     +E + I A E +NPR+ +P A K +++RIL  ++ S+  +G LVP+D  +
Sbjct: 274 LINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPK 333

Query: 390 LMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQG 449
           L    S    +SP+++AI + G +++P   NA+IL+ ++S  NS  Y   RILFSL++ G
Sbjct: 334 LSSDDSY-VSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTG 392

Query: 450 YAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAIC 509
            AP+  +   ++G P  +++ + +FG++A+   +   + VF WL+ I+ ++  + W+ I 
Sbjct: 393 LAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFIL 452

Query: 510 LSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDA 569
           +SHIRF + +  +G S  +L F++ L    + YA   + + +I + + +  P      D 
Sbjct: 453 ISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDV 508

Query: 570 KSFFENYLAMPILIVFYFGYKIYNR---DWKLFIRAKNIDLITHR 611
             FF  Y+++ +  + +  ++++ +    WKL    +++D+ ++R
Sbjct: 509 SDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNR 549

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  217 bits (552), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/477 (27%), Positives = 227/477 (47%), Gaps = 12/477 (2%)

Query: 123 EDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182
           +DA +++ ++ RH+ M +L             + L  AGP G +I Y  M T ++ + Q+
Sbjct: 85  QDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQS 144

Query: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242
            GEMA ++  +  +F  + +  +    G A  ++Y   W     LEL      I +WT  
Sbjct: 145 LGEMA-TFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203

Query: 243 VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGY 302
           V                     K Y E +F+  + KV+ I GF I           T G 
Sbjct: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GP 262

Query: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMXXXXXXXXXXGASEFIAIGASEQSNPRRAI 357
           +G +YW +PG +         +  RF   +            +E + I A E +NPR+ +
Sbjct: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322

Query: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417
           P A K + +RIL  ++ S+  +G LVP+D  +L    S    +SP+++AI + G +V+PH
Sbjct: 323 PRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSY-VSSSPFIIAIQNSGTKVLPH 381

Query: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477
             NAVIL  ++S  NS  Y   R++F L++   AP+WF    + G P  A++ +  FG +
Sbjct: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441

Query: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537
           AF   SS   + F WLL I G++  F W+ I ++H+RF + +  +G S  +L F++ L  
Sbjct: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501

Query: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR 594
           W + YA   + + +I + + + AP      +   F   Y+++ +    +  +++Y R
Sbjct: 502 WLAYYAIFFMIIIIIIQGFTAFAPT----FNGSDFVAAYISVFLFFFLWVSFQLYFR 554

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  218 bits (555), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/496 (28%), Positives = 227/496 (45%), Gaps = 26/496 (5%)

Query: 120 SKEEDA---HLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCL 176
           S + DA    L++ +Q RHV + +L             S LH  GPAGL I Y I+   +
Sbjct: 152 SADGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVI 211

Query: 177 YCIIQACGEMAV----SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           Y I+ A GEM        S+  G+     T  VD   GFA  W Y   ++ ++  E   A
Sbjct: 212 YPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAA 271

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
           S  ++YWTT V                     K Y E++F+F + K+L I G  IL    
Sbjct: 272 SGVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 331

Query: 293 XXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGASEFIAIGAS 348
                     +G +YW  PG+F       S+  F D+               E + + ++
Sbjct: 332 FWGGGPKHDRLGFRYWQHPGSFAHHLAGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSA 391

Query: 349 EQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGTKASPYVL 405
           E ++ RR I  A++  ++R++F ++     +  +VPY+   L   +  G  G  +SPYV+
Sbjct: 392 ECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVI 451

Query: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465
            I + G++V+PH IN  IL +  S +N+  ++S R L +++Q G AP+    I+R G P 
Sbjct: 452 GIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPY 511

Query: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525
            A+ +S L   +A+   SS   +VF W   IS +S    W+  C++++RFR+A+   G  
Sbjct: 512 VAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNG-- 569

Query: 526 ISELGFRSQLGVWGSVYAA----TMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPI 581
              L  R     WG  Y      T++ +  I   +    P    + +   F   Y+ +PI
Sbjct: 570 ---LYDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIP---KYWNVADFIAAYITLPI 623

Query: 582 LIVFYFGYKIYNRDWK 597
            +V + G+K+Y R W 
Sbjct: 624 FLVLWLGHKLYTRTWN 639

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  214 bits (544), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/505 (28%), Positives = 239/505 (47%), Gaps = 22/505 (4%)

Query: 120 SKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCI 179
           + + D  L+K ++ RH+ + +L             S LH  GPAGL   Y I+   +Y +
Sbjct: 44  APQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPV 103

Query: 180 IQACGEMAVSYSNLPGNFNAYP-------TFLVDEGFGFAVAWVYCIQWLCVMPLELVTA 232
           + A GEM V Y  LPG+ ++         T  VD   GFA  W Y   ++ ++  E   A
Sbjct: 104 MNALGEM-VCY--LPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAA 160

Query: 233 SMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXX 292
           S  + YWTT V                     K Y E++F+F + K+L I G   +    
Sbjct: 161 SGVVQYWTTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFIL 220

Query: 293 XXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGASEFIAIGAS 348
                     +G +YW  PGAF       +  RF D+               E +A+ ++
Sbjct: 221 FWGGGPHHDRLGFRYWQKPGAFAYHITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSA 280

Query: 349 EQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGTKASPYVL 405
           E  + RR I  A++  +YR++F ++SS   +G +V Y+   L   +  G  G  +SP+V+
Sbjct: 281 EAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVI 340

Query: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465
            I + G++V+PH IN  IL +  S  NS  +++ R L S+SQ+G+AP+    ++R G P 
Sbjct: 341 GIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPY 400

Query: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525
            A+ ++ L   IA+   SS   +VFTW   IS +S    W+ I ++++RFR+A+  Q   
Sbjct: 401 AAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL- 459

Query: 526 ISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585
              + F++    +G+ +    + +  +   +    P    + +   F   Y+ +PI +V 
Sbjct: 460 YERVPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIP---ANWNVSDFIAAYVTLPIFLVL 516

Query: 586 YFGYKIYNRDWKLF-IRAKNIDLIT 609
           + G+K++ R WK + I    ID+ T
Sbjct: 517 WIGHKLWTRTWKTWAIPVPEIDVTT 541

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  215 bits (547), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/511 (27%), Positives = 231/511 (45%), Gaps = 24/511 (4%)

Query: 113 EHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIM 172
           E   +     E   L++ +Q RHV + +L             S LH  GP GL I Y I+
Sbjct: 91  EKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIII 150

Query: 173 GTCLYCIIQACGEMAV----SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLE 228
              +Y I+ A GEM        S+  G+     T  VD   GFA  W Y   ++ ++  E
Sbjct: 151 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAE 210

Query: 229 LVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFIL 288
              AS  ++YWTT V                     K Y E++F+F + K+L I G  IL
Sbjct: 211 CTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIIL 270

Query: 289 XXXXXXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGASEFIA 344
                         +G +YW  PGAF       S+  F D+               E + 
Sbjct: 271 SFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVC 330

Query: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGTKAS 401
           + ++E ++ RR I  A++  ++R++F ++     +  +VPY+   L   +  G  G  +S
Sbjct: 331 MTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSS 390

Query: 402 PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDRE 461
           P+V+ I + G++V+PH IN  IL +  S +N+  ++S R L +++Q G AP+    I+R 
Sbjct: 391 PFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRW 450

Query: 462 GRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHV 521
           G P  A+  S L   +A+   SS   +VF W   IS +S    W+  C++++RFR+A+  
Sbjct: 451 GVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFY 510

Query: 522 QGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSI----APIGEDHLDAKSFFENYL 577
            G     L  R     WG  Y    ++ +LI    ++I    A     +     F   Y+
Sbjct: 511 NG-----LYDRLPFKTWGQPYT---VWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYV 562

Query: 578 AMPILIVFYFGYKIYNRDW-KLFIRAKNIDL 607
            +PI +V + G+K+Y R W + ++    ID+
Sbjct: 563 TLPIFLVLWLGHKLYTRTWHQWWLPVSEIDV 593

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  213 bits (543), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 141/524 (26%), Positives = 245/524 (46%), Gaps = 21/524 (4%)

Query: 105 SPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAG 164
           S  +++I + D+    K E   L+K+++ RHV M ++            G++L  AGP  
Sbjct: 42  SSRNSSIGDRDIFDDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGS 101

Query: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           L I Y+ +G  ++  +   GEMA ++  L G F +Y +  VD   GFAV + Y  ++L +
Sbjct: 102 LFITYSFVGVLVFFTMSCLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYSYLCKYLIL 159

Query: 225 MPLELVTASMTIDYWTTK--VNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMI 282
              +L   +M + YW  +  +N                  G K + E +F+ ++ KVL++
Sbjct: 160 PANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVM 219

Query: 283 TGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR--------GDRSIDRFKDVMXXXXXXX 334
            G  +L              +G +YW DPG+F+           S  +F           
Sbjct: 220 LGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYAL 279

Query: 335 XXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG 394
                 E   I A+E  NPR+ IP A K+ +YRI+  ++ +I L+   V Y+   L+ + 
Sbjct: 280 FCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKAT 339

Query: 395 SGGTKA--SPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAP 452
              T A  SP+V+AI + G+ ++PH  N  +L  VLS +NS  Y + R L+SL+    AP
Sbjct: 340 GQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAP 399

Query: 453 QWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSH 512
           ++F   ++ G P  ++  S  F  +A+   SS    VF + +    +  + +W+ I +++
Sbjct: 400 KFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTY 459

Query: 513 IRFRRAMHVQGRSISELGFRSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKS 571
           I F +A   QG   S   + +    +G+ +A      LAL+  F V +        D K+
Sbjct: 460 IHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLG----GQFDYKN 515

Query: 572 FFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615
           F   Y+ +P+  + + GYKI  +      R + +DL+T + + D
Sbjct: 516 FITGYIGIPVFFICFVGYKIVYKTKTH--RPEEVDLVTLKALID 557

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  209 bits (531), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 146/533 (27%), Positives = 246/533 (46%), Gaps = 18/533 (3%)

Query: 84  KRAEEGTEETKHMXXXXXXXXSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAX 143
           K+   G +E K          S L +  +  DV     + + +L+K +  RH+ + +L  
Sbjct: 13  KQEFNGMKEVKSNEETYRTSHSNLES--QNSDVV---SDYEHNLKKGLSNRHIQLIALGG 67

Query: 144 XXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTF 203
                      S L + GPA L + + I+ T +YCI+    EM V Y    G+     T 
Sbjct: 68  CIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEM-VCYLPQQGSVPELVTR 126

Query: 204 LVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXG 263
            VD   GFA  W Y   +  ++  EL  A+  + YWT +V                    
Sbjct: 127 YVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSA 186

Query: 264 AKGYAEADFFFNTCKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAFR---GDRSI 320
            + Y E++F+F + K++ I    ++              +G +YW +PGAF       ++
Sbjct: 187 VRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGNL 246

Query: 321 DRFKDVMXXXXXXXXXXGAS-EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALV 379
            RF D+             S E + +   E  + RR I  A++  IYRI+F +LSS  ++
Sbjct: 247 GRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMI 306

Query: 380 GFLVPYDSSELMGS---GSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436
           G +V  +   L+ +      G  +SP+V  I++ G+ V+ H IN  IL +  S  NS FY
Sbjct: 307 GVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFY 366

Query: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496
           +S R + +LS+QG AP+ F+ I+R G P  A+ +  L   +A+   SS   +VF WL  I
Sbjct: 367 ASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNI 426

Query: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556
             +S    W  I +++IRFR+A+ +  R +  + +RS L  + + +   ++ +  +   +
Sbjct: 427 CTISGFIGWFLIGVAYIRFRKAI-LFNRLLDRIPYRSPLQPFSAYFFTIVVAIITLTNGY 485

Query: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLIT 609
           V      +   D K F  +Y+++PI + FY G+K   +  +  I    ID+IT
Sbjct: 486 VVFI---KGRWDYKDFLTSYISLPIFLAFYLGHKTIYKT-RFCIPVDQIDVIT 534

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  208 bits (530), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 136/503 (27%), Positives = 233/503 (46%), Gaps = 16/503 (3%)

Query: 119 TSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYAIMGTCLYC 178
           + K E   L++ +Q RH+ + +L             S L   GPAGL+  Y I+   +Y 
Sbjct: 41  SQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYP 100

Query: 179 IIQACGEMAV----SYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASM 234
           ++ A GEM      S ++  G+ +   +   D   GFA  W Y   ++ ++  E   AS 
Sbjct: 101 VMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASG 160

Query: 235 TIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITGFFILXXXXXX 294
            + YWTT V                     K Y E++F+F   K+L I G   +      
Sbjct: 161 VVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 295 XXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDV-MXXXXXXXXXXGASEFIAIGASEQ 350
               +   +G +YW  PGAF       +  RF DV               E +A+ +SE 
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYHITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEA 280

Query: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSEL---MGSGSGGTKASPYVLAI 407
            + RR I  A++   YR++F +++S   +G +V  +   L   + SG  G  +SP+V+AI
Sbjct: 281 MDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAI 340

Query: 408 SSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARA 467
            +  ++++PH INA IL +  S  NS  +++ R L S+++ G AP+ F  I+R G P  A
Sbjct: 341 QNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNA 400

Query: 468 MIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSIS 527
           + +S  F  +A+   SS   + FTW   IS +S    W+ I ++++RFR+A+  +G    
Sbjct: 401 VAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YD 459

Query: 528 ELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYF 587
            + F+S    +G+ +   ++ +  +   + +  P          F   Y+ +P+ +V + 
Sbjct: 460 RVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIP---RFWKGADFVAAYITLPVFVVLWV 516

Query: 588 GYKIYNRDWKLF-IRAKNIDLIT 609
           G+KIY R    + I    +D+ T
Sbjct: 517 GHKIYTRTLSTWVIPVAEVDVTT 539

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  209 bits (531), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 163/586 (27%), Positives = 262/586 (44%), Gaps = 52/586 (8%)

Query: 46  GKSTDQSSSNEDLSYAGRKKWYELGVKEPHLK--RFIDSFKRAEEGTEETKHMXXXXXXX 103
           G S+D +++   +  AG      L  K+ + K   F+D      E  + T          
Sbjct: 13  GSSSDDAATTHTIGSAG-----ALPAKDKYNKTIEFVDV-----ESQQSTSS-------- 54

Query: 104 XSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPA 163
            + +S  + + D        +  L++ ++ RH+ M +L             S L   GPA
Sbjct: 55  -ATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPA 113

Query: 164 GLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYP-------TFLVDEGFGFAVAWV 216
           GL I Y I+ + +Y I+   GEM V Y  LPGN N             VD+  GFA AW 
Sbjct: 114 GLFISYIIISSVVYPIMCGFGEM-VCY--LPGNGNDASGSAAHLVARYVDKSLGFATAWN 170

Query: 217 YCIQWLCVMPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNT 276
           Y   ++ ++  E   AS  ++YWT  V                     K Y EA+F+F +
Sbjct: 171 YYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFAS 230

Query: 277 CKVLMITGFFILXXXXXXXXXXTSGYIGAKYWHDPGAF-----RGD--RSIDRFKDVMXX 329
            K+L I G  IL              +G +YW  PGAF     +G   R +D +  V+  
Sbjct: 231 IKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMKGGFGRFLDIYSGVIKG 290

Query: 330 XXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSE 389
                      E + + ++E  + RR I  AA+  I+R++F ++     +  +V Y+   
Sbjct: 291 GFAFIL---GPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPS 347

Query: 390 L---MGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLS 446
           L   + SG  G  +SP+V+ I + G+RV+PH INA IL +  S  N+  ++S R L +++
Sbjct: 348 LVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMA 407

Query: 447 QQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWM 506
           + G AP+ F  I+R G P  A+ +S     +AF   SS   +VF W   IS +S    W+
Sbjct: 408 RNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWI 467

Query: 507 AICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGED 565
             C+++IRFR+A+   G     L F++    WG  YA    LF+  +       A     
Sbjct: 468 CGCVAYIRFRKAIFFNGM-YDRLPFKT----WGQPYAVYYSLFVISLITLTNGYATFIPK 522

Query: 566 HLDAKSFFENYLAMPILIVFYFGYKIYNRDW--KLFIRAKNIDLIT 609
           +     F   Y+ +PI +V + G+K++ R +  + + R   ID+ T
Sbjct: 523 NWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTT 568

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  208 bits (529), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 136/513 (26%), Positives = 234/513 (45%), Gaps = 22/513 (4%)

Query: 113 EHDVAITSKEE--DAHLRKSIQPRHVLMSSLAXXXXXXXXXXNGSALHKAGPAGLVIGYA 170
           E + ++ +K +  D +L+K ++  H+ + ++             S L+K GPAGL I Y 
Sbjct: 36  EKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYC 95

Query: 171 IMGTCLYCIIQACGEMAVSYSNLP------GNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224
           IM T +Y ++ A  EM      LP      G+ +   T  VD   GFAV W Y   ++ +
Sbjct: 96  IMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVIL 155

Query: 225 MPLELVTASMTIDYWTTKVNNDXXXXXXXXXXXXXXXXGAKGYAEADFFFNTCKVLMITG 284
           +  E   AS  + YWTT V                     + Y  ++  F + K+  I G
Sbjct: 156 VAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILG 215

Query: 285 FFILXXXXXXXXXXTSGYIGAKYWHDPGAFR---GDRSIDRFKDVMXXXXXXXXX-XGAS 340
             I+              +G ++W DPGA+     D    R  D++              
Sbjct: 216 IIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFAFILGP 275

Query: 341 EFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGS---GSGG 397
           E + + ++E  + RR I  AA+  ++R++F +  S    G +V  +   L+ +   G  G
Sbjct: 276 ELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPG 335

Query: 398 TKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNY 457
             +SP+V+ I + G++V+PH IN  IL +  S  NS  Y++ R L SLSQ+GYAP+ FN 
Sbjct: 336 AGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNR 395

Query: 458 IDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRR 517
           ++R G P   +  +  F  +A+   SS   +VF W   IS +S    W+   ++++RFR+
Sbjct: 396 VNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRK 455

Query: 518 AMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYL 577
           A+         L F++    + + +   ++ +  +   + S       H + K F   Y+
Sbjct: 456 AVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV-----HWNYKDFIAAYI 509

Query: 578 AMPILIVFYFGYKIYNRDW-KLFIRAKNIDLIT 609
            +P+ ++ + G+K Y R W +  I    ID+ T
Sbjct: 510 TLPLFLILWLGHKAYTRTWSQWMISVSEIDVTT 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,010,494
Number of extensions: 2305398
Number of successful extensions: 10102
Number of sequences better than 10.0: 370
Number of HSP's gapped: 8843
Number of HSP's successfully gapped: 405
Length of query: 644
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 528
Effective length of database: 40,180,143
Effective search space: 21215115504
Effective search space used: 21215115504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)