Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D04120na 1ON64864831170.0
KAFR0D041401.50ON63764523720.0
KAFR0D04130na 2ON64464923330.0
Kpol_2000.921.50ON63764719860.0
Suva_3.1891.50ON63365319780.0
Skud_3.381.50ON63365319740.0
Smik_3.531.50ON63364619730.0
Skud_4.7841.50ON66366719680.0
YCL025C (AGP1)1.50ON63364619650.0
YDR508C (GNP1)1.50ON66366619610.0
Suva_2.6881.50ON66166719580.0
Smik_4.7901.50ON66366619450.0
CAGL0K05753g1.50ON66066219240.0
CAGL0B01012g1.50ON62361519110.0
NDAI0F043901.50ON66764518890.0
KNAG0F002701.50ON63462418850.0
TPHA0E036601.50ON64766418750.0
TDEL0C065101.50ON64263718720.0
NCAS0A004201.50ON67965518660.0
NDAI0A006401.50ON64165218560.0
TPHA0B047501.50ON63964718370.0
SAKL0C01650g1.50ON61362818160.0
KAFR0D00510na 2ON61763618080.0
TBLA0A051801.50ON67659318120.0
SAKL0C01232gsingletonON61362817960.0
NCAS0B085801.50ON62761617950.0
TBLA0A05190na 1ON66760717940.0
KAFR0D005001.50ON61759917840.0
KLTH0F01584g1.50ON59659017650.0
KNAG0C005901.50ON63465417560.0
Kpol_2002.441.50ON62764017370.0
KAFR0D00520na 1ON59857117290.0
Kwal_33.132041.50ON60764617070.0
ZYRO0F17446g1.50ON63363616780.0
KLLA0C01606g1.50ON62065016340.0
KLTH0F01606gna 1ON60462816300.0
Ecym_10561.50ON60661016240.0
AFR698C1.50ON60962915940.0
Kwal_33.13215na 1ON59856915500.0
SAKL0D02948gna 3ON59457915170.0
YBR068C (BAP2)3.284ON60957014720.0
Ecym_26643.285ON57557014620.0
Skud_2.1913.284ON60959414600.0
AGR039Cna 3ON58657214540.0
SAKL0D02926g3.285ON58357214510.0
NDAI0A074903.284ON59662314410.0
KAFR0A011203.284ON59256914360.0
NCAS0I015303.284ON59557314370.0
NCAS0A106803.284ON59358514340.0
KNAG0J022003.284ON60756914300.0
Smik_2.2013.284ON60959414280.0
NDAI0A056203.284ON57157414240.0
YDR046C (BAP3)3.284ON60457014250.0
Suva_4.3073.284ON60960114240.0
Suva_2.2033.284ON60457014130.0
Skud_4.3003.284ON60457014030.0
Smik_4.2843.284ON60457013990.0
AGR040C3.285ON57356913800.0
Kpol_1065.133.284ON59657413800.0
Kwal_27.105383.284ON60256913760.0
CAGL0H08393g3.284ON61264313740.0
SAKL0D02970g3.284ON60157113720.0
KNAG0H011503.284ON61757013730.0
CAGL0L07546g3.284ON63463613740.0
TPHA0M012003.284ON60759813720.0
KLTH0C05170g3.284ON59856613521e-180
Ecym_2663na 3ON58957113391e-178
AGR038C3.284ON58057013331e-177
KAFR0C004003.284ON58252413241e-176
TPHA0A039603.284ON61563013161e-174
Ecym_26623.284ON58954113101e-174
Skud_2.1923.285ON61955413071e-173
Smik_2.2023.285ON61752213041e-172
Suva_4.3083.285ON61858913031e-172
TBLA0G031203.284ON67364213001e-171
YBR069C (TAT1)3.285ON61961412891e-170
Kpol_1052.163.284ON61360512821e-169
TBLA0I020003.284ON66457812851e-169
TBLA0I020103.285ON62851912801e-168
Kpol_1052.143.285ON60252312671e-167
KNAG0J022103.285ON58152012571e-166
NCAS0I015203.285ON61450512291e-161
NDAI0A075003.285ON61957212221e-160
ZYRO0G12342g3.284ON62064212121e-158
SAKL0H08184gna 4ON59853111861e-155
ADL272Wna 4ON56449111231e-146
Kwal_27.126811.244ON59351911231e-145
Ecym_8297na 4ON56950911071e-143
NDAI0B052201.244ON61156811051e-142
KLLA0F01012gna 4ON55649310871e-141
KLTH0E15642g1.244ON59657110891e-140
TPHA0B010901.244ON60661610861e-140
TDEL0C00930singletonON59557510791e-139
SAKL0G14014g5.158ON60556610751e-138
ZYRO0D03762g1.244ON60057110731e-138
KNAG0C02140singletonON59857110671e-137
Kpol_543.791.244ON60557110501e-134
Suva_11.2731.244ON60156510481e-134
NCAS0B079001.244ON61958310471e-134
Skud_11.2751.244ON60256510431e-133
SAKL0D04664g1.244ON59352210351e-132
YKR039W (GAP1)1.244ON60256510341e-132
TPHA0A002405.158ON60353210321e-132
CAGL0B03773g5.158ON60560610251e-131
KLLA0A06886gsingletonON58756710171e-130
Skud_7.5255.158ON60355510131e-129
Kwal_33.14276na 5ON59657310111e-129
KLTH0B02046g5.158ON58957510081e-128
CAGL0L03267g1.244ON59751910081e-128
KAFR0E018505.158ON5604959991e-127
Smik_16.1155.158ON60352310001e-127
Ecym_60211.244ON6005679981e-127
YGR191W (HIP1)5.158ON6036059981e-127
Suva_7.4855.158ON6036089951e-126
NDAI0D021605.158ON5875959931e-126
Ecym_47895.158ON5885739901e-126
Suva_2.716singletonON6035719881e-125
NCAS0A071105.158ON5925899871e-125
Kwal_33.154075.158ON5875939851e-125
TPHA0A047005.158ON5695009771e-124
SAKL0D00836gna 5ON6015979781e-124
NCAS0D018705.158ON5955909761e-123
Kpol_534.221.368ON5926279751e-123
Kpol_543.78singletonON6055929701e-122
AGR319W5.158ON6265709721e-122
KNAG0G009005.158ON6135279701e-122
KLLA0A06930g1.244ON5875699671e-122
AFR230C1.244ON6046139671e-122
Kpol_1010.325.158ON5995129661e-122
Smik_11.3021.244ON5535189571e-121
NCAS0A089201.368ON5996469601e-121
NDAI0C029505.158ON6095389601e-121
KLLA0A11770g5.158ON5815469561e-121
Skud_15.1381.368ON5926059361e-118
Smik_15.1461.368ON5935659341e-117
YOL020W (TAT2)1.368ON5925279331e-117
TBLA0B077605.158ON6586419361e-117
TBLA0C012101.368ON6005829301e-117
Suva_15.1481.368ON5925659231e-116
NDAI0G060301.368ON5996419211e-115
CAGL0D02178g1.368ON5775399091e-114
TPHA0A025001.368ON5905809051e-113
KLTH0H13398g1.368ON5875598921e-111
AEL030W1.368ON5825848901e-111
Ecym_27161.368ON5925658721e-108
Sklu_YGOB_Anc_1.3681.368ON5414398591e-107
KLLA0A10813g1.368ON5846388621e-107
Kwal_34.16254singletonOFF4814658141e-101
Kwal_YGOB_34.162541.368ON4914658141e-101
KAFR0F04410singletonON5805268122e-99
YPL274W (SAM3)na 6ON5876008104e-99
KLTH0C08052gna 6ON5995888044e-98
TDEL0B00130singletonON5845508026e-98
KAFR0B00220singletonON5855788027e-98
TDEL0E05700singletonON5845747982e-97
SAKL0D04048gna 6ON5865747983e-97
Smik_6.483na 6ON5906217966e-97
YLL061W (MMP1)na 7ON5834907755e-94
ZYRO0D17952gna 6ON5855747748e-94
TPHA0G03770singletonON6045747732e-93
KLLA0B06776gna 6ON5885727695e-93
Kwal_56.22951na 6ON5966117662e-92
TDEL0H04510singletonON5845757633e-92
Smik_12.2na 7ON5834907616e-92
Suva_16.31singletonON5865387608e-92
AER405Cna 6ON4974917461e-90
TDEL0E00250singletonON5875787494e-90
TDEL0C061701.84ON5735047336e-88
SAKL0C02662g1.83ON5484987246e-87
Suva_16.18na 6ON5834907162e-85
TBLA0A054601.84ON6085667103e-84
Ecym_10871.83ON5704977074e-84
SAKL0C02640gsingletonON5485497046e-84
Ecym_10881.84ON5675237031e-83
KLTH0F02420g1.84ON6215027027e-83
ZYRO0F16632g1.84ON6074956991e-82
YNL268W (LYP1)1.84ON6116106931e-81
Kpol_2000.641.84ON6105026931e-81
SAKL0C02728g1.84ON5625216901e-81
TPHA0B044701.84ON5995666912e-81
CAGL0J08162g1.84ON5975006912e-81
Smik_14.681.84ON6114956903e-81
Kwal_33.134111.84ON5605026863e-81
Kwal_33.134011.83ON5595126864e-81
KAFR0D039401.83ON5975426868e-81
NDAI0F041901.84ON5994946842e-80
Skud_14.711.84ON6125016834e-80
NCAS0A006101.84ON6075006809e-80
Smik_5.241.83ON5905026789e-80
KNAG0C05920singletonON5995096781e-79
Suva_14.751.84ON6115996791e-79
Ecym_4758na 6ON5876026752e-79
Suva_5.41.83ON5905486744e-79
YEL063C (CAN1)1.83ON5905026735e-79
Skud_14.701.83ON5735606701e-78
KNAG0F004801.84ON5975766711e-78
TBLA0A07060na 8ON6255046713e-78
YNL270C (ALP1)1.83ON5735286663e-78
SAKL0C02684gsingletonON5885086622e-77
CAGL0J08184g1.83ON5725596593e-77
KLLA0C02343g1.83ON5815176594e-77
KLTH0F02398g1.83ON5555396551e-76
Smik_14.671.83ON5735116523e-76
CAGL0A01199gna 8ON6135386546e-76
NDAI0A006101.83ON5655316506e-76
Skud_5.261.83ON5905136492e-75
NCAS0A006001.83ON5445326443e-75
KLLA0E16281gna 8ON6055816441e-74
NCAS0B085701.83ON5324976363e-74
TDEL0C061801.83ON5835026351e-73
Suva_14.731.83ON4974616273e-73
KNAG0L02470singletonON6384996354e-73
KLLA0C02365g1.84ON5795106315e-73
Kpol_358.3na 8ON5755326281e-72
TBLA0A054501.83ON6064696282e-72
NDAI0F042001.83ON5665746228e-72
TPHA0H028507.44ON6015726249e-72
KNAG0C007901.83ON5794946184e-71
AFR667C1.84ON5635116174e-71
YPL265W (DIP5)na 8ON6085176179e-71
Skud_16.12na 8ON6075766179e-71
KNAG0L02460singletonON5885536132e-70
SAKL0G14916gna 8ON5815496114e-70
KAFR0B06430singletonON5935856115e-70
CAGL0E05632g7.44ON5985166107e-70
AFR668W1.83ON5564836061e-69
ZYRO0F16654g1.83ON5805026071e-69
KNAG0E003907.44ON5995406082e-69
TPHA0M00130singletonON6115106063e-69
Smik_6.473na 8ON6065156063e-69
KAFR0D007001.83ON5745196027e-69
SAKL0B10956g7.44ON5725326018e-69
Skud_15.5157.44ON6266006031e-68
TPHA0B044801.83ON6034986011e-68
Suva_8.4027.44ON6835906052e-68
KAFR0C051607.44ON5844965983e-68
Smik_15.5327.44ON6315155925e-67
YOR348C (PUT4)7.44ON6275435917e-67
Kpol_2000.651.83ON5954995871e-66
Ecym_2480na 8ON5865115862e-66
TDEL0H040707.44ON5775505852e-66
NCAS0D02260na 8ON5975325853e-66
Kwal_33.15545na 8ON5765345809e-66
Suva_16.40na 8ON6065175829e-66
KLLA0F23419g7.44ON5735355801e-65
Skud_47.1singletonON3283265583e-65
KLTH0B01166gna 8ON5775065651e-63
Ecym_80357.44ON5635045641e-63
NDAI0I02660na 8ON5945135643e-63
Kwal_26.69407.44ON5705185614e-63
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D04120
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...  1205   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              918   0.0  
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              903   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   769   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   766   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   764   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   764   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   762   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   761   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   759   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   758   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   753   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   745   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   740   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   732   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   730   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   726   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   725   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   723   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   719   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   712   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   704   0.0  
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      701   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   702   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   696   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   696   0.0  
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   695   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      691   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   684   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   681   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   673   0.0  
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   670   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   662   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   650   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   634   0.0  
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   632   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   630   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   618   0.0  
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   601   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   588   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   571   0.0  
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   567   0.0  
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   566   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   564   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   563   0.0  
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   559   0.0  
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   557   0.0  
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              558   0.0  
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   556   0.0  
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   555   0.0  
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   554   0.0  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            553   0.0  
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   553   0.0  
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   553   0.0  
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   548   0.0  
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   545   0.0  
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   543   0.0  
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   536   0.0  
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   536   0.0  
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   534   0.0  
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   533   0.0  
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   533   0.0  
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              533   0.0  
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   533   0.0  
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   533   0.0  
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   525   e-180
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   520   e-178
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   518   e-177
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                514   e-176
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              511   e-174
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   509   e-174
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   508   e-173
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   506   e-172
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   506   e-172
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              505   e-171
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   501   e-170
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   498   e-169
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   499   e-169
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   497   e-168
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   492   e-167
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   488   e-166
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              478   e-161
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   475   e-160
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   471   e-158
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   461   e-155
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   437   e-146
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   437   e-145
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   431   e-143
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   430   e-142
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   423   e-141
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   424   e-140
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   422   e-140
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   420   e-139
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   418   e-138
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   417   e-138
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   415   e-137
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   409   e-134
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   408   e-134
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   407   e-134
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   406   e-133
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   403   e-132
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   402   e-132
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   402   e-132
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   399   e-131
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   396   e-130
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   394   e-129
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   394   e-129
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   392   e-128
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   392   e-128
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   389   e-127
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   389   e-127
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   389   e-127
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   389   e-127
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   387   e-126
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    387   e-126
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   385   e-126
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   385   e-125
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   384   e-125
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   384   e-125
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   380   e-124
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   381   e-124
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   380   e-123
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   380   e-123
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   378   e-122
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   379   e-122
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   378   e-122
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   377   e-122
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   377   e-122
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   376   e-122
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   373   e-121
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   374   e-121
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    374   e-121
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   372   e-121
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   365   e-118
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   364   e-117
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   363   e-117
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   365   e-117
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   362   e-117
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   360   e-116
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   359   e-115
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   354   e-114
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   353   e-113
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   348   e-111
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   347   e-111
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   340   e-108
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   335   e-107
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   336   e-107
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   318   e-101
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   318   e-101
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              317   2e-99
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   316   4e-99
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   314   4e-98
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                313   6e-98
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      313   7e-98
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   311   2e-97
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   311   3e-97
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   311   6e-97
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   303   5e-94
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   302   8e-94
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   302   2e-93
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   300   5e-93
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   299   2e-92
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   298   3e-92
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    297   6e-92
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   297   8e-92
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   291   1e-90
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                293   4e-90
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   286   6e-88
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   283   6e-87
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   280   2e-85
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   278   3e-84
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   276   4e-84
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   275   6e-84
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   275   1e-83
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   275   7e-83
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   273   1e-82
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   271   1e-81
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   271   1e-81
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   270   1e-81
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   270   2e-81
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   270   2e-81
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   270   3e-81
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   268   3e-81
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   268   4e-81
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   268   8e-81
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   268   2e-80
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   267   4e-80
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              266   9e-80
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   265   9e-80
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            265   1e-79
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   266   1e-79
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   264   2e-79
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   264   4e-79
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   263   5e-79
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   262   1e-78
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                263   1e-78
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   263   3e-78
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   261   3e-78
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   259   2e-77
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   258   3e-77
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   258   4e-77
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   256   1e-76
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   255   3e-76
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   256   6e-76
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   254   6e-76
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   254   2e-75
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   252   3e-75
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   252   1e-74
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            249   3e-74
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   249   1e-73
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   246   3e-73
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             249   4e-73
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   247   5e-73
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   246   1e-72
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   246   2e-72
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            244   8e-72
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   244   9e-72
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              242   4e-71
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   242   4e-71
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   242   9e-71
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   242   9e-71
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             240   2e-70
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   239   4e-70
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   239   5e-70
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   239   7e-70
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   238   1e-69
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   238   1e-69
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   238   2e-69
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     238   3e-69
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   238   3e-69
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   236   7e-69
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   236   8e-69
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   236   1e-68
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   236   1e-68
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   237   2e-68
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   234   3e-68
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   232   5e-67
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   232   7e-67
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   230   1e-66
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   230   2e-66
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   229   2e-66
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              229   3e-66
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   228   9e-66
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   228   9e-66
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   228   1e-65
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         219   3e-65
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   222   1e-63
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   221   1e-63
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   221   3e-63
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   220   4e-63
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   216   1e-61
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   216   1e-61
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   217   2e-61
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   214   2e-60
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      211   6e-60
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     212   1e-59
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   209   1e-58
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   207   2e-58
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   204   3e-57
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   204   4e-57
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   202   6e-57
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   203   7e-57
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   201   5e-56
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   201   5e-56
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            199   1e-55
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   199   2e-55
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   199   2e-55
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   198   3e-55
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   197   1e-54
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     197   2e-54
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   196   2e-54
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   195   4e-54
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              194   9e-54
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     187   3e-53
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     187   3e-53
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   193   4e-53
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      192   6e-53
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   191   1e-52
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              190   5e-52
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   188   2e-51
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   186   1e-50
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             173   3e-50
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   185   3e-50
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   185   4e-50
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   185   5e-50
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   184   5e-50
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   184   7e-50
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   184   9e-50
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   184   9e-50
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   184   1e-49
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   181   4e-49
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    181   6e-49
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   179   1e-48
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   181   2e-48
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   180   2e-48
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                179   4e-48
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   177   7e-48
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   178   1e-47
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            176   2e-47
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   176   6e-47
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   173   5e-46
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   173   7e-46
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   172   1e-45
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   170   3e-45
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   162   3e-45
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   171   4e-45
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   156   9e-44
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   166   1e-43
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   166   1e-43
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   166   3e-43
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   166   3e-43
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   164   9e-43
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   162   2e-42
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   161   7e-42
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   159   4e-41
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   158   1e-40
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   157   2e-40
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   154   4e-39
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   145   4e-39
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   154   1e-38
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   152   1e-38
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   144   3e-36
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   146   5e-36
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     128   5e-34
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   131   3e-31
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   131   5e-31
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   129   8e-31
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   125   2e-29
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   124   9e-29
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   122   2e-28
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   121   6e-28
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    112   3e-26
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   116   3e-26
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   115   6e-26
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   115   8e-26
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   114   1e-25
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   113   3e-25
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   112   5e-25
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   111   9e-25
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     106   1e-24
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         103   2e-24
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   110   2e-24
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   109   3e-24
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      99   5e-24
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   108   9e-24
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   107   2e-23
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   106   5e-23
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          88   2e-19
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    65   2e-10
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              55   1e-08
Smik_12.301 Chr12 (561707..564052) [2346 bp, 781 aa] {ON} YLR241...    39   0.030
Skud_12.316 Chr12 (564758..567103) [2346 bp, 781 aa] {ON} YLR241...    39   0.049
YLR241W Chr12 (620473..622821) [2349 bp, 782 aa] {ON} Putative p...    39   0.055
NCAS0C02840 Chr3 (537144..539483) [2340 bp, 779 aa] {ON} Anc_8.4...    35   0.61 
NDAI0G02170 Chr7 (490315..492723) [2409 bp, 802 aa] {ON} Anc_8.4...    35   0.63 
Suva_10.336 Chr10 (587056..589398) [2343 bp, 780 aa] {ON} YLR241...    35   0.83 
TPHA0L00950 Chr12 complement(191426..193861) [2436 bp, 811 aa] {...    34   1.5  
Smik_5.149 Chr5 complement(212558..213388) [831 bp, 276 aa] {ON}...    33   1.7  
AGL114C Chr7 complement(490370..492730) [2361 bp, 786 aa] {ON} S...    33   2.2  
Kpol_340.1 s340 complement(378..2753) [2376 bp, 791 aa] {ON} com...    33   3.1  
KLLA0D18623g Chr4 complement(1568498..1570837) [2340 bp, 779 aa]...    32   5.2  
ZYRO0D00924g Chr4 complement(69563..71716) [2154 bp, 717 aa] {ON...    32   7.3  
TBLA0B03460 Chr2 complement(801699..808766) [7068 bp, 2355 aa] {...    32   7.8  
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     31   9.1  

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score = 1205 bits (3117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/648 (91%), Positives = 590/648 (91%)

Query: 1   MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60
           MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD
Sbjct: 1   MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60

Query: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQF 120
           FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQF
Sbjct: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQF 120

Query: 121 APHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCL 180
           APHAEEKDDHLQKTIKPRHV                  SALHKAGPGGLVIGYAIMGSCL
Sbjct: 121 APHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCL 180

Query: 181 YCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTI 240
           YCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTI
Sbjct: 181 YCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTI 240

Query: 241 QYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGG 300
           QYWTTTVNAD                GAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGG
Sbjct: 241 QYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGG 300

Query: 301 AGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRA 360
           AGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMS         GASEFIAIGASEQSNPRRA
Sbjct: 301 AGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRA 360

Query: 361 IPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVP 420
           IPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVP
Sbjct: 361 IPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVP 420

Query: 421 HFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSV 480
           HFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSV
Sbjct: 421 HFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSV 480

Query: 481 IAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVG 540
           IAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVG
Sbjct: 481 IAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVG 540

Query: 541 VWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW 600
           VWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW
Sbjct: 541 VWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW 600

Query: 601 KLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           KLFIRAKDIDLVSHRKIYDG               NGPFWKKVVAFWC
Sbjct: 601 KLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNGPFWKKVVAFWC 648

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  918 bits (2372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/645 (72%), Positives = 505/645 (78%), Gaps = 11/645 (1%)

Query: 6   NQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNG 65
           +Q + D   +  +SK+EM +I K  + K+ EQDNIVE+F  T+   A    S   +  + 
Sbjct: 2   SQSNKDHHDYVPDSKFEMVDIVKKPEIKNSEQDNIVEFF--TSSNTAHSASSSESYSRSP 59

Query: 66  KKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAE 125
            K   P F I +PH+RK +DSFRRAED D  T  D+ENEL +TLSP   +K  Q      
Sbjct: 60  DK---PLFGITKPHVRKFVDSFRRAED-DEETAEDLENELVSTLSP---SKSKQLHGQKN 112

Query: 126 EKDD-HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
             DD HLQK+I+PRHV                  SAL KAGPG LVIGY IMGSCLYCII
Sbjct: 113 GDDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCII 172

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           QACGEMAV YSGLPGNFNAYPSFLVDE   F VAWVYCLQWLCVMPLELVTASMTI YWT
Sbjct: 173 QACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWT 232

Query: 245 TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304
           T VN+D                GAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND
Sbjct: 233 TKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 292

Query: 305 GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 364
           GYIGAKYWHNPGAFRGDKSIDRFKDVMS         GASEFIAIGASEQSNPRRAIPSA
Sbjct: 293 GYIGAKYWHNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSA 352

Query: 365 AKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS-PYVIAVASHGVRVVPHFI 423
           AKTMIYRILFIFLTSITLVGFLVPY+STEL+GSG +A+  + PYVIAVASHGVRVVPHFI
Sbjct: 353 AKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFI 412

Query: 424 NAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAF 483
           NAVILLSVLSVANSA+YSSCRILYSL+QQGYAP WF YIDREGRPARAM+++ +F VIAF
Sbjct: 413 NAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAF 472

Query: 484 CACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWG 543
           C+CS KEEDVF WLL+I+GLSQLFTW AIC+SHIRFRRAMKVQGRSVDEIGFKSQVGVWG
Sbjct: 473 CSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWG 532

Query: 544 SSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF 603
           S YAAIMM LALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI K+DWKLF
Sbjct: 533 SGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLF 592

Query: 604 IRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           IRAKDIDL+SHR I+DG               NGP WK+VVAFWC
Sbjct: 593 IRAKDIDLISHRTIFDGELVRQEEEEYKEKLRNGPKWKRVVAFWC 637

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/649 (67%), Positives = 507/649 (78%), Gaps = 9/649 (1%)

Query: 3   SSSNQKDSDRISFSTESKYEMKEITK--NSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60
           SSSN  D D    ++  +YE+K+ +K         E +NIVEYF  +T      + S+ D
Sbjct: 2   SSSNNADKDDFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTD----QSSSNED 57

Query: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT-KDPQ 119
             Y G+KK      +K+PHL++ IDSF+RAE+    T + +E ELTTTLSPLSA  K+  
Sbjct: 58  LSYAGRKKWY-ELGVKEPHLKRFIDSFKRAEEGTEET-KHMETELTTTLSPLSAAIKEHD 115

Query: 120 FAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSC 179
            A  ++E+D HL+K+I+PRHV                  SALHKAGP GLVIGYAIMG+C
Sbjct: 116 VAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTC 175

Query: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239
           LYCIIQACGEMAV+YS LPGNFNAYP+FLVDE FGF+VAWVYC+QWLCVMPLELVTASMT
Sbjct: 176 LYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMT 235

Query: 240 IQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299
           I YWTT VN D                GAKGYAEA+FFFN+CKVLM+ GFFILAI+IN G
Sbjct: 236 IDYWTTKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAG 295

Query: 300 GAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRR 359
           GAG  GYIGAKYWH+PGAFRGD+SIDRFKDVM+         GASEFIAIGASEQSNPRR
Sbjct: 296 GAGTSGYIGAKYWHDPGAFRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRR 355

Query: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVV 419
           AIPSAAK MIYRILFIFL+SI LVGFLVPY+S+ELMGSGS  TKASPYV+A++SHGVRVV
Sbjct: 356 AIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVV 415

Query: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479
           PHFINAVILL+VLSV+NSAFYSSCRIL+SLSQQGYAP WFNYIDREGRPARAMI+S LF 
Sbjct: 416 PHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFG 475

Query: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539
           +IAFCACSSKEE+VFTWLLAISGLSQ+FTW+AIC+SHIRFRRAM VQGRS+ E+GF+SQ+
Sbjct: 476 IIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL 535

Query: 540 GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD 599
           GVWGS YAA M+ LALIAEFWVSIAPIGEDHLDA++FFENYLAMPILIV YFGYKI  RD
Sbjct: 536 GVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRD 595

Query: 600 WKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           WKLFIRAK+IDL++HR I+D                NGP WK++V FWC
Sbjct: 596 WKLFIRAKNIDLITHRNIFDAEIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/647 (60%), Positives = 463/647 (71%), Gaps = 28/647 (4%)

Query: 17  TESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIK 76
           T++ YE+K++   S   +   D  VEY ++       +N+S  +     +K    +F   
Sbjct: 4   TKAPYELKDLKSGSAVITSTTDREVEYLDDQ------INNSYDESSVRNRKTKEGTF--- 54

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLS---ATKDPQF------------A 121
              +R  IDSF+RA+    P + D++N++TT++S  S   A    +F             
Sbjct: 55  ---VRSFIDSFKRADRNSNPLH-DLDNDITTSISRTSMDAALNKTKFDDAISSSISETNK 110

Query: 122 PHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLY 181
            H  EK + L+KTIKPRHV                    L KAGP  LVIGYAIMG+CLY
Sbjct: 111 GHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLY 170

Query: 182 CIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQ 241
           CIIQA GE+AV YS L G FNAYPSFLVD A GFSVAWVYCLQWLCV PLELVTASMTI+
Sbjct: 171 CIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIK 230

Query: 242 YWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301
           YWTT V+ D                GA+GYAEAEFFFN CKVLMM GFFIL I+I  GGA
Sbjct: 231 YWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGA 290

Query: 302 GNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAI 361
           GNDGY+GAKYWH+PGAF GDKSIDRFK VM          GA+EFIA+ A+EQSNPR+AI
Sbjct: 291 GNDGYLGAKYWHDPGAFNGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAI 350

Query: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421
           PSAAK ++YRI+ IFL SITL+GFLVPYNS +L+GSG +  KASPYVIAV+SHGVRVVPH
Sbjct: 351 PSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPH 410

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
           FINAVILLSVLSV NSAFYSS R+L SL+QQGYAP WF+Y+DREGRP RAM+MSALF VI
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           AFCA S KE +VF+WLLAISGLSQLFTWI ICVSHIRFRRAM+VQGRS+ E+G+ SQ GV
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
           +GS+YAAIM+ LALIA+FWV+IAPIGE  LDA+NFF+NYLAMPILI  YFGY++ KRDWK
Sbjct: 531 YGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWK 590

Query: 602 LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           LFIRAKDIDL +HR+I+D                NGP W++ +AFWC
Sbjct: 591 LFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/653 (59%), Positives = 455/653 (69%), Gaps = 42/653 (6%)

Query: 16  STESKYEMKEITKNS-DAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFN 74
           S+ S YE+K++  +S +  + EQ+N +EYFE  +      ND  S               
Sbjct: 3   SSTSPYELKDLKNSSTEVHAAEQENEIEYFETDS------NDRPS--------------- 41

Query: 75  IKQPHL----------RKLIDSFRRA-EDIDAPTNRDIENELTTTLSPLSAT-----KDP 118
            +QPHL          R+ +DSF+RA +D +        N+LT+ +SP S       KD 
Sbjct: 42  -QQPHLDYEQHNTSAVRRFLDSFKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDE 100

Query: 119 ---QFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
              + APH   K D L+KTI+PRHV                  +AL  AGP GL+IGYAI
Sbjct: 101 TTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAI 160

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MGS LYCIIQACGEMA+ YS L G +NAYPSFLVD+ FGF+VAWVYCLQWLCV PLELVT
Sbjct: 161 MGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVT 220

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           ASMTI+YWTT+VN D                GA+GYAEAEFFFN CK+LMM GFFIL I+
Sbjct: 221 ASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGII 280

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           I+ GGAGNDGYIG KYWH PGAF G  +IDRFK V++         G SEFIAI  +EQS
Sbjct: 281 IDVGGAGNDGYIGGKYWHEPGAFNGVHAIDRFKGVVATLVTAAFAFGGSEFIAITTAEQS 340

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR+AIP AAK MIYRILF+FL +I +VGFLVPYNS +L+GS    TKASPYVIA+ASHG
Sbjct: 341 NPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHG 400

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           VRV PHF+NAVILLSVLS+ANS+FYSS R+  +LS+QGYAP  F+YIDR GRP  AM +S
Sbjct: 401 VRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVS 460

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
           ALF+VIAFCA S KE+ VFTWLLAISGLSQLFTW AIC+SHIRFRRAMKVQGRS+ E+GF
Sbjct: 461 ALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGF 520

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595
           KSQ GVWGS Y+ IMM L LI +FWV+IAPIGE  LDAQ FFENYLAMPILIVLY GYK+
Sbjct: 521 KSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKM 580

Query: 596 CKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             +DWKLFIRA  IDL SHR+I+D                 GP+W++V+AFWC
Sbjct: 581 WNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDEYRERLRTGPYWRRVLAFWC 633

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/653 (59%), Positives = 453/653 (69%), Gaps = 42/653 (6%)

Query: 16  STESKYEMKEITKNS-DAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFN 74
           S++S YE K++  +S +  + EQDN +EYFE  +      ND  S               
Sbjct: 3   SSKSPYEQKDLKNSSTEIHATEQDNEIEYFETDS------NDRPSS-------------- 42

Query: 75  IKQPHL----------RKLIDSFRRAEDIDAPTNRDIE-NELTTTLSPLSATKD------ 117
             QPHL          R+  DSF+RA+      +  ++ N+LT+ +SP S          
Sbjct: 43  --QPHLDYEQHNTSAVRRFFDSFKRADQGGQDESEAVQMNDLTSAISPSSRNAQGLEKND 100

Query: 118 --PQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
              +  P A  K   L+KTI+PRHV                  +AL  AGP GL+IGYAI
Sbjct: 101 STDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAI 160

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MGS LYCIIQACGE+A+ YS L G +NAYPSFLVD+ FGF+VAWVYCLQWLCV PLELVT
Sbjct: 161 MGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVT 220

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           ASMTI+YWTT+VN D                GA+GYAEAEFFFN CK+LMM GFFIL+I+
Sbjct: 221 ASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSII 280

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           I+ GGAGNDG+IG KYWH+PGAF G  SIDRFK V++         G SEFIAI  +EQS
Sbjct: 281 IDVGGAGNDGFIGGKYWHDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQS 340

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR+AIP AAK MIYRILF+FL +I ++GFLVPYNS +L+GSG   TKASPYVIA+ASHG
Sbjct: 341 NPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHG 400

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           VRVVPHF+NAVILLSVLS+ANS+FYSS R+  +LS+QGYAP +F+YIDR GRP  AM +S
Sbjct: 401 VRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVS 460

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
           ALF+VIAFCA S KEE VFTWLLAISGLSQLFTW AIC SHIRFRRAMKVQGRS+ E+GF
Sbjct: 461 ALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGF 520

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595
           KSQ GVWGS YA IMM L LI +FWV+IAPIGE  LDAQ FFENYLAMPILI LY GYKI
Sbjct: 521 KSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKI 580

Query: 596 CKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             +DWKLFIRA  IDL SHR+I+D                NGP+WK+V AFWC
Sbjct: 581 WTKDWKLFIRADKIDLESHRQIFDEELIKQEDEEYRERLRNGPYWKRVAAFWC 633

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/646 (59%), Positives = 450/646 (69%), Gaps = 28/646 (4%)

Query: 16  STESKYEMKEITKNS-DAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFN 74
           S++S YE+K++  +S +  + EQDN VEYFE  +  P++        ++N          
Sbjct: 3   SSKSPYELKDLKNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHN---------- 52

Query: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIE----NELTTTLSPLSATKDP--------QFAP 122
                LR+  DSF++A   D      +E    N+L + +SP S  +              
Sbjct: 53  --TSALRRFFDSFKKA---DQSAEERVETAQMNDLASAISPSSRQRQELEKNESSDNIGA 107

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
               K D L+KTI+PRHV                  +AL  AGP GL+IGY IMGS LYC
Sbjct: 108 RTGNKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYC 167

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           IIQACGEMA+ YS L G +NAYPSFLVD+ FGF+VAWVYCLQWLCV PLELVTASMTI+Y
Sbjct: 168 IIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WTT+VN D                GA+GYAEAEFFFN CK+LMM GFFIL I+I+ GGAG
Sbjct: 228 WTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAG 287

Query: 303 NDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           NDG+IG KYWH+PGAF G  SIDRFK V++         G SEFIAI  +EQ+NPR+A+P
Sbjct: 288 NDGFIGGKYWHDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVP 347

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            AAK MIYRILF+FL +I L+GFLVPYNS +L+GS    TKASPYVIAVASHGVRVVPHF
Sbjct: 348 GAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHF 407

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
           INAVILLSVLS+ANS+FYSS RIL +LS+QGYAP  F YID+ GRP  AM +SALF VIA
Sbjct: 408 INAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIA 467

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           FCA S KE+ VFTWLLAISGLSQLFTW AIC+SHIRFRRAMKVQGRS+ E+GF+SQ GVW
Sbjct: 468 FCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVW 527

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
           GS+YA IMM L LI +FWV+IAPIGE  LDAQ FFENYLAMPILI LY GYKI K+DWKL
Sbjct: 528 GSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKL 587

Query: 603 FIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           FIRA  IDL+SHR+I+D                NGP WK+VVAFWC
Sbjct: 588 FIRADKIDLISHRQIFDEELIKQEDEEFRERLKNGPCWKRVVAFWC 633

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/667 (58%), Positives = 462/667 (69%), Gaps = 38/667 (5%)

Query: 2   SSSSNQKDSDRISFSTESKYEMKEIT-KNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60
           SS+ N  D+D       S YEMKEI  K  +  S E++N VEYFENT      +  +  +
Sbjct: 15  SSNMNMNDND---LDDVSHYEMKEIQPKEKENASIERENEVEYFENT------MEKTMEN 65

Query: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRD------------------IE 102
            EY G  +        + +  + IDSFRRAE    P + D                  ++
Sbjct: 66  MEYKGDHQ--------RSYFHRFIDSFRRAEG-SHPNSPDSTNLNGSTPISTKDSSSRLD 116

Query: 103 NELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALH 162
           NEL    S ++     Q +   E K ++L+K+IKPRH                     L+
Sbjct: 117 NELNPKSSYITVDGIKQSSQEQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLN 176

Query: 163 KAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYC 222
            AGPGGL+IGYAIMGSC+YCIIQACGE+AV YS L G FN YPSFLVD A GFSVAW++C
Sbjct: 177 NAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFC 236

Query: 223 LQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCK 282
           LQWLCV PLELVTASMTI+YWT  VNAD                GAKGYAEA+FFFN CK
Sbjct: 237 LQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCK 296

Query: 283 VLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXG 342
           +LM+ GFFILAI+I+ GGAG DGYIG++YW +PGAFRGD SI RFK V++         G
Sbjct: 297 ILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAFRGDTSIQRFKGVVATFVTAAFAFG 356

Query: 343 ASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAAT 402
            SE +A+ ASEQSNPR+AIPSAAK MIYRILF+FL S+ LVGFLVPY S +L+G+  +AT
Sbjct: 357 MSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSAT 416

Query: 403 KASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYI 462
           KASPYVIAV+SHGVRVVPHFINAVILLSVLSVANSAFY+S RIL SL++QG AP  F+YI
Sbjct: 417 KASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYI 476

Query: 463 DREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRA 522
           DREGRPA AMI+SA+F VIAFCA S KEEDVFTWLLAISGLSQLFTWI IC+SHIRFR+ 
Sbjct: 477 DREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKG 536

Query: 523 MKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYL 581
           MKVQGRS+ E+G+KSQVGVWGS+YA ++M LALI +FWV+I+PIG D  L AQ+FFENYL
Sbjct: 537 MKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYL 596

Query: 582 AMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWK 641
           AMPILI LY  YK+ KRDW LFI A  IDLVSHR I+D                NGPFWK
Sbjct: 597 AMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWK 656

Query: 642 KVVAFWC 648
           +V+ FWC
Sbjct: 657 RVLDFWC 663

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/646 (59%), Positives = 454/646 (70%), Gaps = 28/646 (4%)

Query: 16  STESKYEMKEITKNS-DAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFN 74
           S++S YE+K++  +S +  +  QDN +EYFE  +      ND  S   + G ++   S  
Sbjct: 3   SSKSLYELKDLKNSSTEIHATGQDNEIEYFETGS------NDRPSSQPHLGYEQHNTS-- 54

Query: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIE----NELTTTLSPLSATKDP--------QFAP 122
                +R+  DSF+RA   D     ++E    N+LT+ +SP S                 
Sbjct: 55  ----AVRRFFDSFKRA---DQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGA 107

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
           +   K D L+KTI+PRHV                  +AL  AGP GL+IGYAIMGS LYC
Sbjct: 108 NTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYC 167

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           IIQACGEMA+ YS L G +NAYPSFLVD+ FGF+VAWVYCLQWLCV PLELVTASMTI+Y
Sbjct: 168 IIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WTT+VN D                GA+GYAEAEFFFN CK+LMM GFFIL I+I+ GGAG
Sbjct: 228 WTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAG 287

Query: 303 NDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           NDG+IG KYWH+PGAF G  +IDRFK V +         G SEFIAI  +EQSNPR+AIP
Sbjct: 288 NDGFIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIP 347

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            AAK MIYRILF+FL +I L+GFLVPYNS +L+GS    TKASPYVIAVASHGVRVVPHF
Sbjct: 348 GAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHF 407

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
           INAVILLSVLS+ANS+FYSS R+  +LS+QGYAP  F+YIDR GRP  AM +SALF+VIA
Sbjct: 408 INAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIA 467

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           FCA S KEE VFTWLLAISGLSQLFTW AIC+SH+RFRRAMKVQGRS+ E+GFKSQ GVW
Sbjct: 468 FCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVW 527

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
           GS+YA IMM L LIA+FWV+IAPIGE  LDAQ FFENYLAMPILI LY GYK+  +DWKL
Sbjct: 528 GSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKL 587

Query: 603 FIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           FIRA  IDL SHR+I+D                NGP+WK+VVAFWC
Sbjct: 588 FIRADKIDLDSHRQIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC 633

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/666 (58%), Positives = 458/666 (68%), Gaps = 33/666 (4%)

Query: 2   SSSSNQKDSDRISFSTESKYEMKEIT-KNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60
           +  S+  + +R      S YEMKEI  K     S E +N VEYFE T      V  +  +
Sbjct: 12  NEGSSNMNMNRNDLDDVSHYEMKEIQPKEKQIGSIEPENEVEYFEKT------VEKTIEN 65

Query: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDA-----------------PTNRDIEN 103
            EY G+            +LR+ IDSFRRAE   A                  ++  ++N
Sbjct: 66  MEYEGEHH--------ASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDN 117

Query: 104 ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHK 163
           EL    S ++     Q     E+K ++L+K+IKPRH                     L+ 
Sbjct: 118 ELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNN 177

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
           AGPGGL+IGYAIMGSC+YCIIQACGE+AV YS L G FN YP FLVD A GFSVAW++CL
Sbjct: 178 AGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCL 237

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
           QWLCV PLELVTASMTI+YWTT+VN D                GAKGYAEA+FFFN CK+
Sbjct: 238 QWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKI 297

Query: 284 LMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGA 343
           LM+ GFFILAI+I+ GGAG DGYIG+KYW +PGAFRGD  I RFK V++         G 
Sbjct: 298 LMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGM 357

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATK 403
           SE +A+ ASEQSNPR+AIPSAAK MIYRILF+FL S+TLVGFLVPY S +L+G+  +ATK
Sbjct: 358 SEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATK 417

Query: 404 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
           ASPYVIAV+SHGVRVVPHFINAVILLSVLSVAN AFY+S RIL SL++QG AP  F+YID
Sbjct: 418 ASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYID 477

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           REGRPA AM++SALF VIAFCA S KEEDVFTWLLAISGLSQLFTWI IC+SHIRFRRAM
Sbjct: 478 REGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAM 537

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI-GEDHLDAQNFFENYLA 582
           KVQGRS+ E+G+KSQVGVWGS+YA +MM LALIA+FWV+IAPI G   L AQ+FFENYLA
Sbjct: 538 KVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLA 597

Query: 583 MPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKK 642
           MPI I LY  YK+ K+DW LFI A  +DLVSHR I+D                NGP+WK+
Sbjct: 598 MPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKR 657

Query: 643 VVAFWC 648
           V+ FWC
Sbjct: 658 VLDFWC 663

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/667 (58%), Positives = 462/667 (69%), Gaps = 42/667 (6%)

Query: 4   SSNQKDSDRISFSTESKYEMKEI-TKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFE 62
           SSN  +SD +S      YEMKEI  K  +  S   +N VEYFENT      +  +  + E
Sbjct: 15  SSNTNNSDGVS-----HYEMKEIQAKEREINSIAPENEVEYFENT------MEKTMENLE 63

Query: 63  YNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATK-----D 117
           Y G +K          HLR+ IDSF+RAE    P + D  N +    +P+S        D
Sbjct: 64  YEGDRK--------ASHLRRFIDSFKRAEG-SHPNSPDSSNSIGGGATPISTNDSSSQLD 114

Query: 118 PQFAPH------------AEEKD---DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALH 162
            +  P             ++E+D   ++L+KTIKPRH+                    L+
Sbjct: 115 NELNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLN 174

Query: 163 KAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYC 222
            AGP GLVIGYAIMGSC+YCIIQACGE+AV YS L G FN YPSFLVD A GFSVAWVYC
Sbjct: 175 NAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYC 234

Query: 223 LQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCK 282
           LQWLCV PLELVTASMTI+YWT  V+ D                GAKGYAEA+FFFN CK
Sbjct: 235 LQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCK 294

Query: 283 VLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXG 342
           +LM+ GFFILAI+I+ GGAG DGYIG++YWHNPGAFRG+  I RFK V++         G
Sbjct: 295 ILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFRGNTGIQRFKGVVATFVTAAFAFG 354

Query: 343 ASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAAT 402
            SE +A+ ASEQSNPR+AIPSAAK MIYRILF+FL S+ LVGFLVPY S +L+G+  +AT
Sbjct: 355 MSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSAT 414

Query: 403 KASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYI 462
           KASPYVIAVASHGVRVVPHFINAVILLSVLSVAN AFYSS RIL SL++QG AP  F+YI
Sbjct: 415 KASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYI 474

Query: 463 DREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRA 522
           DREGRPA AM++S++F +IAFCA S KEEDVFTWLLAISGLSQLFTWI IC+SHIRFRRA
Sbjct: 475 DREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRA 534

Query: 523 MKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI-GEDHLDAQNFFENYL 581
           MKVQGRS+ E+G+KSQVG+WGS YA +MM LALIA+FWV+I+PI G   L AQ+FFENYL
Sbjct: 535 MKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYL 594

Query: 582 AMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWK 641
           AMPILI LY  YK+ K+DW LFI A  IDLV+ R+I+D                NGP+WK
Sbjct: 595 AMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEEYQEKLRNGPYWK 654

Query: 642 KVVAFWC 648
           +VV FWC
Sbjct: 655 RVVDFWC 661

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/666 (57%), Positives = 456/666 (68%), Gaps = 36/666 (5%)

Query: 2   SSSSNQKDSDRISFSTESKYEMKEIT-KNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSD 60
           SS+ N    D       S YEMKEI  K  +  S E +N +EYFE T      V  +   
Sbjct: 15  SSNMNMNGDD---LDNVSHYEMKEIQPKEKEIGSIEPENEIEYFEET------VEKNIES 65

Query: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDA-----------------PTNRDIEN 103
            EY G+            +LR+ IDSF+RAE   A                  ++  ++N
Sbjct: 66  MEYQGENH--------ASYLRRFIDSFKRAEGSHANSSDSSNSNTTTPIFTNDSSSQLDN 117

Query: 104 ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHK 163
           EL    S ++     Q     E+K ++L+K+IKPRH                     L+ 
Sbjct: 118 ELNRKSSYITVDGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNN 177

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
           AGPGGL+IGYAIMGSC+YCIIQACGE+AV YS L G FN YP FLVD A GFSVAW++CL
Sbjct: 178 AGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCL 237

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
           QWLCV PLELVTASMTI+YWT  V+ D                GAKGYAEA+FFFN CK+
Sbjct: 238 QWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKI 297

Query: 284 LMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGA 343
           LM+ GFFILAI+I+ GGAG DGYIG+KYW +PGAFRGD  I RFK +++         G 
Sbjct: 298 LMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGIVATFVTAAFAFGM 357

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATK 403
           SE +A+ ASEQSNPR+AIPSAAK MIYRILF+FL S+TLVGFLVPY S +L+G+  +ATK
Sbjct: 358 SEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATK 417

Query: 404 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
           ASPYVIAV+SHGVRVVPHFINAVILLSVLSVANSAFY+S RIL SL++QG AP  F+YID
Sbjct: 418 ASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYID 477

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           REGRPA AM++SALF VIAFCA S KEEDVFTWLLAISGLSQLFTWI IC+SHIRFRRAM
Sbjct: 478 REGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAM 537

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI-GEDHLDAQNFFENYLA 582
           KVQGRS+ E+G+KSQVGVWGS+YA +MM LALIA+FWV+IAPI G   L AQ+FFENYLA
Sbjct: 538 KVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLA 597

Query: 583 MPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKK 642
           MPILI LY  +K+ K DW LFI A  +DLVSHR I+D                NGP+WK+
Sbjct: 598 MPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKR 657

Query: 643 VVAFWC 648
           +V FWC
Sbjct: 658 IVDFWC 663

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/662 (57%), Positives = 459/662 (69%), Gaps = 25/662 (3%)

Query: 2   SSSSNQKDSDRISFSTESKYEMKEITKNSD----AKSPEQDNIVEYF--ENTTGIPAAVN 55
           +  S   DS+    S    + + +  K  D           + VEYF  EN  G+     
Sbjct: 9   NERSQSPDSEEADVSNYELHNIDDSKKGYDNLGSGSRGATTSAVEYFDKENVDGVNID-E 67

Query: 56  DSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNR-----DIENELTTTLS 110
              S  E+ G +  +P  NI     R+ IDSF+RAE    P  +     D+EN+LTT +S
Sbjct: 68  KLQSTTEFGGDE--MPRGNI-----RRFIDSFKRAEQ--QPNQQHNLAEDLENDLTTAIS 118

Query: 111 PLSATK---DPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPG 167
             S  +    P      + +++ L+K+IKPRHV                   ALH AGP 
Sbjct: 119 MNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPA 178

Query: 168 GLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLC 227
           GLVIGYAIMGSC+YCIIQA GEMAV YS L G FN YPS LVD  FGF+VAWVYCLQWLC
Sbjct: 179 GLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLC 238

Query: 228 VMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMA 287
           V PLELVT S+TI+YWTTTVN D                GA+GYAEAEFFFN CK+LM+ 
Sbjct: 239 VCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMII 298

Query: 288 GFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFI 347
           GF+IL I+IN GGAGNDGY+GAKYWH+PGAFRG   I RFK +M+         GA+EFI
Sbjct: 299 GFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFI 358

Query: 348 AIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPY 407
           A+ A+EQSNPR+AIPSAAK ++YR++ IF+ +I L+GFLVP++S +LMG+G +ATKASPY
Sbjct: 359 ALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPY 418

Query: 408 VIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGR 467
           V+A++ HGVRVVPHFINAVIL+SV SVANSAFYSS R+L  L+QQGYAP +F+Y+DR+GR
Sbjct: 419 VLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGR 478

Query: 468 PARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQG 527
           P RAM  +ALF VIAFCA S KE+ VFTWLLAISGLSQLFTWIAICVSHIRFRRAM VQG
Sbjct: 479 PFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQG 538

Query: 528 RSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPIL 586
           RS+ EIGFK+Q+GV+GS YA IMM LALIA+FWV+IAPIG +  LDA+ FFENYLAMPIL
Sbjct: 539 RSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPIL 598

Query: 587 IVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAF 646
           I  YFGYK+ KRDW+LFIRAKDIDL S+R+++D                NGP WK+VV F
Sbjct: 599 IAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDF 658

Query: 647 WC 648
           WC
Sbjct: 659 WC 660

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/615 (59%), Positives = 441/615 (71%), Gaps = 18/615 (2%)

Query: 52  AAVND--SDSDFEYNGKKKIL------PSFNIKQP-HLRKLIDSFRRAE-----DIDAPT 97
           A  ND  SD + EY   +++        + N   P   R+ +DSF+RAE     +I +  
Sbjct: 9   ADFNDKVSDKEVEYMSPREVSVTPETSATPNTPAPSQFRRFVDSFKRAEQQNNSEITSAA 68

Query: 98  NRDIENELT----TTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXX 153
           + D  +E        ++ L   ++      + +K+  L++TIKPRHV             
Sbjct: 69  SCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGL 128

Query: 154 XXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAF 213
                 ALH AGP GL+IGY+IMG+CLYCIIQA GE+AV+YS L G FN YPSFLVD AF
Sbjct: 129 LVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAF 188

Query: 214 GFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAE 273
           GFSVAWVYC+QWLCV PLELVTASMTI+YWTTTVNAD                GA+GYAE
Sbjct: 189 GFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAE 248

Query: 274 AEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSX 333
           AEFFFN CK+LMM GFFIL IVINTGGAGNDGYIG +YWH PGAF GD+ ID FK +M+ 
Sbjct: 249 AEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMAT 308

Query: 334 XXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTE 393
                   GA+EFIA+ A+EQSNPR+AIPSAAK ++YRILFIFL SITLVGFLVPY+S +
Sbjct: 309 MVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQ 368

Query: 394 LMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQG 453
           LMGSG +ATKASPYV+AV++HGV+VVPHFINAVILLSVLSV NSAFYSS R+LYSL+QQG
Sbjct: 369 LMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQG 428

Query: 454 YAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAIC 513
            AP +F+Y+DREGRP RAM+ + +F++I+FCA S KEE VFTWLLAISGLSQ+FTW AIC
Sbjct: 429 NAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAIC 488

Query: 514 VSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDA 573
           +SHIRFR+AM VQ RS+ EIGFK+Q GVWGS Y   M+ + LIA+FWV+IAPIGE  LDA
Sbjct: 489 LSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDA 548

Query: 574 QNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXX 633
           Q FFENYLAMPILI+ Y GYKI K+DW LFIRA +IDL  HR+I+D              
Sbjct: 549 QGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREK 608

Query: 634 XXNGPFWKKVVAFWC 648
             NG + K++ AFWC
Sbjct: 609 LKNGGYLKRIAAFWC 623

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/645 (59%), Positives = 452/645 (70%), Gaps = 26/645 (4%)

Query: 19  SKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSD----SDFEYNGKKKILPSFN 74
           ++YEMK +       S EQ+N VEYFENT      ++DS     +D+E N          
Sbjct: 34  TRYEMKNLKPKEKEISTEQENEVEYFENTKIQEGGIDDSTITQTNDYEQN---------- 83

Query: 75  IKQP--HLRKLIDSFRRAEDIDAP--------TNRDIENELTTTLSPLSATKDPQFAPHA 124
           I +P   +R  IDSF+ AE  ++P        +N  + +E   +LS L   + P      
Sbjct: 84  ITKPTSRVRNFIDSFKPAEVKNSPEKDTASITSNEMMIDEEILSLSNLDGQRVPP-PRKI 142

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
           E K D L+KTIKPRHV                  S+L  AGP GL++G+ IMG+CLYCII
Sbjct: 143 ENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           QA GEMAVAYS L G FNAYPSFLVD AFGFSVAWVY LQWLCV PLELVTASMTI+YWT
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 245 TTVNADXXXXX-XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 303
           T V+ D                 GA GYAEAEF FNSCK+LMM GFFIL I+I  GGAGN
Sbjct: 263 TKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGN 322

Query: 304 DGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPS 363
           DGYIG KYWH PGAFRG+ +IDRFK VM+         G SEFI + ASEQSNPR+AIPS
Sbjct: 323 DGYIGGKYWHEPGAFRGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 382

Query: 364 AAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFI 423
           AAK M+YRI+ +FL SIT+VGFLVPY+S +L+GS     KASPYV+AV++HGV+VVPHFI
Sbjct: 383 AAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFI 442

Query: 424 NAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAF 483
           NAVIL+SVLSVANSAFYSS R+L SL++QGYAP  F YIDREGRP   M M++LF VIAF
Sbjct: 443 NAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAF 502

Query: 484 CACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWG 543
           CA S KE++VF WLLAISGLSQLFTWIAICVSH+RFRRAM VQG+S+ E+GF+SQVG WG
Sbjct: 503 CATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWG 562

Query: 544 SSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF 603
           SSYAAIMM   LIA+FWV+IAPIGE  LDA+NFFENYLAMPIL+ LYFGYKI  ++W +F
Sbjct: 563 SSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIF 622

Query: 604 IRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           IRAKDIDLVSHR I+D                NGP W++V  FWC
Sbjct: 623 IRAKDIDLVSHRNIFDEEIIKQEEEEYREKLRNGPMWRRVYDFWC 667

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/624 (59%), Positives = 446/624 (71%), Gaps = 27/624 (4%)

Query: 2   SSSSNQKDSDRISFSTESKYEMK--EITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDS 59
           +SSSN K  DR   S++S  ++    +T NS+    E+ +  ++ E+++       D  +
Sbjct: 3   TSSSNSKQLDRQQSSSDSVSDVSYARVTTNSER---EETDYFQFQESSSAKKETKTDESN 59

Query: 60  DF----EYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT 115
           +     E   ++ I  S    +    K +DSF+R ++    T  D+E+ L          
Sbjct: 60  NAVLIQEKTQEETIHNSDGSSRSPFGKFVDSFKRVDE--KQTTSDLESGLG--------- 108

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
                      ++  L++TIK RHV                    L  AGPGGLVIGY+I
Sbjct: 109 -------EVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSI 161

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MGSCLYCIIQACGE+AV YS LP NFN YP+FLVD+AFGF+VAWVYCLQWLCV PLELVT
Sbjct: 162 MGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVT 221

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           ASMTI+YWTT+VN D                GA+GYAEAEFFFNSCKVLMMAGFFIL I+
Sbjct: 222 ASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGII 281

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           I  GGAG  GYIGAKYWH+PGAF G++ ID FK VM+         GASEFI++ A+EQS
Sbjct: 282 ITCGGAGTSGYIGAKYWHSPGAFNGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQS 341

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR+AIP AAK MIYRILF+FL+SITL+GFLVPYNS  L+GSGS ATKASPYV+AVASHG
Sbjct: 342 NPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHG 401

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           VRVVPHFINAVILLSVLSV NSAFYSS R+L SL+QQGYAP  F YID+ GRP  AM+ S
Sbjct: 402 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCS 461

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
            LF  IAFCA S KEE VFTWLLAISGLSQLFTW+AIC+SH+RFRRA+KVQG S+ EIGF
Sbjct: 462 TLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGF 521

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595
           KSQVG++GS YAA M+ LALIA+FWV++APIG + LDA+NFF+NYLAMPIL+VLYFGYKI
Sbjct: 522 KSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKI 581

Query: 596 CKRDWKLFIRAKDIDLVSHRKIYD 619
            KRDWK +I A  IDLVSHRK++D
Sbjct: 582 RKRDWKFWIPAHRIDLVSHRKVFD 605

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/664 (55%), Positives = 456/664 (68%), Gaps = 33/664 (4%)

Query: 1   MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSP-----EQDNIVEYFENTTGIPAAVN 55
           MS+S N   ++ I        E+++   NS+  S        +N VEY  +         
Sbjct: 1   MSNSRNGSSNEHI--------ELQDYKGNSEKNSTTVYIDSNENEVEYLSDKDA------ 46

Query: 56  DSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRR-----AEDIDAPT---NRDIENELTT 107
            + +D+ Y   K + PS   K+ ++++ IDSF++     ++ IDA      + +EN +TT
Sbjct: 47  STSADYTY---KDLNPSDKKKKSNIKRFIDSFKQPIRPNSDYIDAAELDYEQALENGITT 103

Query: 108 TLSPLSAT--KDPQFAPHAEEKDDH-LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKA 164
           ++SP +    K  Q     +  D+  L++TI+PRHV                  +AL  A
Sbjct: 104 SVSPSAPNLRKLNQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNA 163

Query: 165 GPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQ 224
           GP GLVIGY+IMGS +YCIIQA GEMA+AYS LPG +N YPSFLV++ FGF++AWVYC+Q
Sbjct: 164 GPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQ 223

Query: 225 WLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVL 284
           WL V PLELVTAS+TI+YWTT+VN+D                GAKGYAEAEFF N CKVL
Sbjct: 224 WLTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVL 283

Query: 285 MMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGAS 344
           MM GFFIL+I I  GGAGNDGY+G  YWH PGAFRGD SID FK +           G +
Sbjct: 284 MMIGFFILSITITAGGAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGT 343

Query: 345 EFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA 404
           EF+A+ A+EQSNPR AIPSAAK ++YRI+ ++L SI ++GFLVP++ST L+GS  +AT A
Sbjct: 344 EFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSA 403

Query: 405 SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDR 464
           SPYV+A + HGVRVVPHFINAVIL+SVLSV NSAFYSS R+L SL++QGYAP WF+YIDR
Sbjct: 404 SPYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDR 463

Query: 465 EGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMK 524
           EGRPARAM+MSALF VIAFCA S KE +VFTWLLAISGLSQLFTW AIC+SHIRFR AMK
Sbjct: 464 EGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMK 523

Query: 525 VQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMP 584
           VQGRS+ E+G+ +Q GVWGS YA  MM L  IA+FWV+IAPIG   L AQNFFENYLAMP
Sbjct: 524 VQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMP 583

Query: 585 ILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVV 644
           ILIVLY GYKI  +DW L I+A+DIDL SHR+I+D                NGPFW++VV
Sbjct: 584 ILIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVV 643

Query: 645 AFWC 648
            FWC
Sbjct: 644 DFWC 647

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/637 (60%), Positives = 452/637 (70%), Gaps = 18/637 (2%)

Query: 21  YEMKEITKNSDA--KSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQP 78
           YE++++ K       + E +N VEYF   +G P   N+S+      G+       NI   
Sbjct: 15  YELQDVKKVEQPAISNQELENEVEYF---SGEPQGTNESEPHGN-TGRNDGSAKGNI--- 67

Query: 79  HLRKLIDSFRRAEDIDAPTNRDIENELTTTLSP--LSATKDPQFAPHAEE-----KDDHL 131
                ID FRR  + ++    D+ENELTT +SP  LS  K    +   +E     K++HL
Sbjct: 68  -FVNFIDGFRRQTNHNSAA-EDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHL 125

Query: 132 QKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMA 191
           +K+IKPRHV                   AL+ AGP GL IGYAIMGSC+YCIIQA GEMA
Sbjct: 126 KKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMA 185

Query: 192 VAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADX 251
           V YS L G FNAYPSFLV    GF+VAWVY LQW CV PLELVTASMTI+YWTT VN D 
Sbjct: 186 VTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDV 245

Query: 252 XXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKY 311
                          GA+GYAEAEFFFN CKVLM+ GFFIL I+IN GGAGNDGYIG KY
Sbjct: 246 FVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKY 305

Query: 312 WHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYR 371
           WH+PGAFRGDK+IDRFK V +         G SEFIA+ ASEQSNPR+AIP+AAK ++YR
Sbjct: 306 WHDPGAFRGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYR 365

Query: 372 ILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSV 431
           I+ IFL SI +VGFLVP+NS +LMGS S+ TKASPYVIA++SHGVRVVPHF+NAVILLSV
Sbjct: 366 IIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSV 425

Query: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491
           LSV NSAFYSS RIL SLSQQGYAP +FNYIDREGRPARAM++ ALF+VIAFCA SSKEE
Sbjct: 426 LSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEE 485

Query: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551
           DVFTWLLAISGLSQ+FTW AIC+SHIRFRRAM VQGRS+ EIGFKS++GVWGS YAA MM
Sbjct: 486 DVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMM 545

Query: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDL 611
            L LIA+FWV +APIG + LDAQ+FFE+YLAM +LI  Y GY   K+DW LFIRAKDIDL
Sbjct: 546 FLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDL 605

Query: 612 VSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             HR+I+D                NGP WK+++ FWC
Sbjct: 606 DHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNFWC 642

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/655 (57%), Positives = 451/655 (68%), Gaps = 40/655 (6%)

Query: 21  YEMKEITKNS----DAKSPEQDNIVEYF-----ENTTGIPAAVN-DSDSDFEYNGKKKIL 70
           +EMK++         A   EQ+NI+EYF     ++T+  P      S +DFE +  K   
Sbjct: 38  FEMKDVKPKEREIGTASITEQENIIEYFGEKSNDDTSSSPVTRQYVSGADFEEHTTK--- 94

Query: 71  PSFNIKQPHLRKLIDSFRRAEDIDAPTN---------RDIENELT----TTLSPLSATKD 117
           PS       +R  +DSF+RAE    PTN          D+EN +      T  PL    D
Sbjct: 95  PS------RIRNFMDSFKRAEQ--HPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHD 146

Query: 118 PQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMG 177
            Q   ++  K D L+KTIKPRHV                  S+L +AGP GL+IG+ IMG
Sbjct: 147 AQINDNS--KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMG 204

Query: 178 SCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTAS 237
           SCLYCIIQA GE+AVAYS L G FNAYPSFLVDEAF F+VAW+Y +QWLCV PLELVTAS
Sbjct: 205 SCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTAS 264

Query: 238 MTIQYWTTTVNADX-XXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVI 296
           MTI+YWTT V+ D                 GA GYAEAEF FNSCK++MM GFFIL I +
Sbjct: 265 MTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITV 324

Query: 297 NTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
             GGAG DGYIGAKYWH+PGA RGD SI RFK  M+         G SEFI + ASEQSN
Sbjct: 325 ICGGAGTDGYIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSN 384

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGV 416
           PR+AIPSAAK MIYRIL +FL+SIT+VGFLVPYNS +L+GS  +  KASPYV+A+++HGV
Sbjct: 385 PRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGV 444

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
           RVVPHFINAVIL+SVLSVANSA+YSS R+L SL++QGYAP  ++YIDREGRP   M  +A
Sbjct: 445 RVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAA 504

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
           +F VIAFCA S KE++VF WLLAISGLSQLFTW+AIC+SHIRFRRAM VQGRS+ E+GF+
Sbjct: 505 IFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFR 564

Query: 537 SQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED---HLDAQNFFENYLAMPILIVLYFGY 593
           SQVG +GS+YAAIMM + LIA+FWV++ PI  D    LDA+NFFENYLAMPIL+  YFGY
Sbjct: 565 SQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGY 624

Query: 594 KICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           KI K+DWKLFIRAK+IDL+SHR I+D                 GP W++V  FWC
Sbjct: 625 KIWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/652 (56%), Positives = 448/652 (68%), Gaps = 15/652 (2%)

Query: 1   MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQ-DNIVEYFENT-TGIPAAVNDSD 58
           MSSS + ++         S+YEM ++ K S     E  +N VEYF  T + +P++     
Sbjct: 1   MSSSGSNENVGH------SRYEMNDLKKKSKTSEFETTENEVEYFAQTDSQLPSST--LS 52

Query: 59  SDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTL-SPLSATKD 117
           +DFE   + +   S +  +   +  IDSF+RA D + P+   +E++LT T    L  ++D
Sbjct: 53  NDFEPISQDQNTTSHSRTRAKFQNFIDSFKRA-DKEQPST--LEHDLTKTFEGTLEPSED 109

Query: 118 PQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMG 177
                    K + L+ +IKPRHV                  ++L  +GP GLVIGYAIMG
Sbjct: 110 GTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMG 169

Query: 178 SCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTAS 237
           SC+YCIIQA GEMAV YS L G FN+YPSFL++ A GFSVAWVYC+QWLCV PLELVTAS
Sbjct: 170 SCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTAS 229

Query: 238 MTIQYWTTTVNADXXXXX-XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVI 296
           MTI+YWTT V+ D                 GA GYAEAEFFFNSCK+LM+ GFFIL I++
Sbjct: 230 MTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIIL 289

Query: 297 NTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
             GGAG+DGYIG +YWH+PGAFRG+ +IDRFK V+S         G SE I + ASEQSN
Sbjct: 290 ICGGAGDDGYIGGRYWHDPGAFRGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSN 349

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGV 416
           PR+AIPSAAK MIYRI+ I+L S+ +VGFLVP+NS +L+GS     KASPYV+AV++HGV
Sbjct: 350 PRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGV 409

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
           RVVPHFINAVILLSVLSVANSAFYSS R+L  L++QGYAP  F Y+DREGRP   M ++A
Sbjct: 410 RVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAA 469

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
           L +VI+FCA S KE+ VF WLLAISGLSQLFTW AIC+SHIRFRRAM VQGRS+ EIGFK
Sbjct: 470 LVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFK 529

Query: 537 SQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIC 596
           SQ GVWGS YA IMM L LIA+FWV+IAPIGE  LD Q FFENYLA PILI LYFGYKI 
Sbjct: 530 SQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIY 589

Query: 597 KRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +DW+LFIRAKDIDL  +R ++D                N P W+K+  FWC
Sbjct: 590 TKDWRLFIRAKDIDLDINRDVFDEELIRQEEEEYKEKMRNAPIWQKIYEFWC 641

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/647 (58%), Positives = 450/647 (69%), Gaps = 28/647 (4%)

Query: 18  ESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQ 77
           +S YEM + TK        Q+N VEY ++     ++ N+S  +    G K          
Sbjct: 5   KSGYEMSD-TKAEAHVFSSQENEVEYLDSQLNGDSSSNNSIKEPTSTGAKG--------- 54

Query: 78  PHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLS-------ATKDPQF------APHA 124
            H +  +DSFRR +      + D+EN++TT++S  S       A +D +       A H 
Sbjct: 55  -HFKSFVDSFRRGDHAKNALH-DLENDITTSISHASLVHAVSKAREDDEIMQSVASAEHR 112

Query: 125 E---EKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLY 181
           +    + D LQKTIKPRHV                  S L  AGP  LVIGY+IMGSCLY
Sbjct: 113 KVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLY 172

Query: 182 CIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQ 241
           CIIQA GEMAV YS L G FN YPSFL+D A GFSVAWVYCLQWLCV PLELVTAS+TI+
Sbjct: 173 CIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIK 232

Query: 242 YWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301
           YWTT V+ D                GA+GYAEAEFFFN CKVLMM GFFIL I+I  GGA
Sbjct: 233 YWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGA 292

Query: 302 GNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAI 361
           GNDGY+GAKYWH PGAFRG+ ++DRFK VM          GA+EFIA+ A+EQSNPR+AI
Sbjct: 293 GNDGYLGAKYWHEPGAFRGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAI 352

Query: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421
           PSAAK ++YRI+ IFL SI ++GFLVPY+S +L+GS  +  KASPYV+AV+ HGVRVVPH
Sbjct: 353 PSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPH 412

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
           FINAVILLSVLSV NSAFYSS R+L SLSQQGYAP WF+Y+DR+GRPARAM+MSALF VI
Sbjct: 413 FINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVI 472

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           AFCA S KE DVF WLLAISGLSQLFTW AIC+SH+RFR AMKVQGRS+ E+GF SQ GV
Sbjct: 473 AFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGV 532

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
           +GS YAA MM LAL+A+FWV+IAP+ E  LDAQNFF++YLAMPILI LYFGYK+  RDWK
Sbjct: 533 YGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWK 592

Query: 602 LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           L+I+A  IDL+SHR+I+D                NGP W+++  FWC
Sbjct: 593 LYIKADKIDLISHRQIFDENILKQEDEEYKEKLRNGPAWRRIADFWC 639

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/628 (57%), Positives = 432/628 (68%), Gaps = 36/628 (5%)

Query: 22  EMKEITKNSDAKSPE-QDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHL 80
           E+K++   +   S +  +N  +Y E T+         +SDFEY   +  L          
Sbjct: 21  ELKDVKSGAVVGSSDFTNNETDYLEKTS-------VQNSDFEYLENEGNL---------F 64

Query: 81  RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140
           R+  +SF+RA   + P   D  +                     ++ D+ L+KTIK RHV
Sbjct: 65  RRFANSFKRAPGSNNPDKEDGSDA-------------------GDKGDNKLKKTIKSRHV 105

Query: 141 XXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200
                              AL   GP GLVIGYAIMGSCLYCIIQA GE+AV Y+ L G 
Sbjct: 106 VMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGG 165

Query: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXX 260
           FNAYPS L+D A GFSVAWVYCLQWLCVMPLELVTAS+TI+YWTT+VN D          
Sbjct: 166 FNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVLT 225

Query: 261 XXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG 320
                 GA+GYAEAEFFFN+CKVLM+ GFFIL I++N GGAGNDGYIG KYW++PG+F G
Sbjct: 226 IAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSFSG 285

Query: 321 DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380
           DK ID FK V+S         GA+EFIA+ A+EQ+NPR++IPSAAK ++YRI+ IFL SI
Sbjct: 286 DKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSI 345

Query: 381 TLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
           TLVGFLVP+NS ELMGSG +AT ASPYVIA+ASHGV+VVPHFINAVILLSVLSV NSAFY
Sbjct: 346 TLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFY 405

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
           SS R+L SL++QGYAPS+  Y+DREGRP  AMI+SA+F +I+F A S KEE VFTWLLAI
Sbjct: 406 SSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAI 465

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           SGLSQLFTW AIC+SHIRFRRAMKVQGRS+ E+GFKSQVGVWGS YA  MM L LI +FW
Sbjct: 466 SGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFW 525

Query: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDG 620
            +IAPIGE  LDA+ FFENYLAMPILI LYFGYK+ KRDW L+I A  IDL+S+R+I+D 
Sbjct: 526 TAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDE 585

Query: 621 XXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                          N  + ++   FWC
Sbjct: 586 DVLKQEDAEFREKLRNSGWLRRAAEFWC 613

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/636 (55%), Positives = 432/636 (67%), Gaps = 28/636 (4%)

Query: 16  STESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNI 75
           S++  YE  +ITK+S AK  + D I             ++ ++ ++E       LP+ + 
Sbjct: 7   SSKESYEKNDITKSS-AKFNDVDVI------------DIDSAERNYE-------LPTSST 46

Query: 76  KQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDP--QFAPHAEEKDDHLQK 133
                R  IDSF+  E     T   IE ++   LS  S   D   + +   +E ++ L+K
Sbjct: 47  THSRFRNFIDSFKPPE-----TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKK 101

Query: 134 TIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVA 193
           TI+PRHV                  + L  AGP GLVIGYAIM SC+YCIIQA GEMAV 
Sbjct: 102 TIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161

Query: 194 YSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXX 253
           Y  L G FNAYP FLVD A  FS+AW+YC+QW CV PLELVTASMTIQYWTT VNAD   
Sbjct: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFV 221

Query: 254 XXXXXXXXXXXX-XGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYW 312
                         GA+GYAE EF  NSCK+LMM GFFIL IVI  GGAGNDG+IG KYW
Sbjct: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281

Query: 313 HNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRI 372
            +PGAFRG    +RFK V+S         G +EF+AI ASEQSNPR+AIPSAAK +IYR 
Sbjct: 282 RDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 341

Query: 373 LFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVL 432
           L I+L SI +VG LVPY+S+EL+GS SAATKASPYV+AV++HGVRVVPHFINAVIL+SV 
Sbjct: 342 LLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVF 401

Query: 433 SVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEED 492
           SVA+SAFYSS R+L +L++QGYAP  F ++DR GRP+   ++ A+ +V+AFCACSSKE +
Sbjct: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461

Query: 493 VFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMT 552
           VF WLLAISGLSQ+FTW  IC+SHIRFRRAMKVQGRS+DEIG+KSQVGVWGS+YA +MM 
Sbjct: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521

Query: 553 LALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLV 612
           L +I + WV I P+GE   D Q FF++YLAMP+ IVLY GYKI KRDW+LFIRAKDIDL+
Sbjct: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581

Query: 613 SHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           SHR I+D                NGP W++V  FWC
Sbjct: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/593 (58%), Positives = 417/593 (70%), Gaps = 10/593 (1%)

Query: 58  DSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKD 117
           D   EY G  +    +    P    L D  +   DI      D+EN+    L   +  +D
Sbjct: 92  DEPTEYPGNNQ----YQRSSPFSNGLEDDQKVGPDIYID---DLENKQQVELIG-TTIQD 143

Query: 118 PQFAPHAEEKDDH--LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
            +  P  +++D +  L++TIKPRHV                    L  AGP  LVIGY I
Sbjct: 144 EELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGI 203

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MG+C+YCIIQACGEMAVAY  L G+FN +PSFLVD  F F+VAWVYC+QWLCV PLELVT
Sbjct: 204 MGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 263

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           ASMTIQYWTT V+ D                GAKGYAEAEF FN+CKVLM+ GFFILAI 
Sbjct: 264 ASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAIC 323

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           I+TG AG DGYIGAKYW++PGAFRG   I+RFK VM          GA+EFIA+ A+EQS
Sbjct: 324 IDTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQS 383

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR+AIPSAAK +IYR+L IFL +I L+GFLVPY+S +L+GSG +ATKASPYV+A++ HG
Sbjct: 384 NPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHG 443

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           VRV  HF+NAVIL+SV+SV NSAFYSS R+L SL+QQG AP  F+Y+DREGRP  AM  S
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
           A+ +VIAFCA S KE +VFTWL+AI+GLSQLFTW AIC+SH+RFRRAMKVQGRS+ E+G+
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595
            SQ G+ GS YAAIMM LALIA+FWV++ P+G    DA +FF NYLAMPILIV YFGYKI
Sbjct: 564 LSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKI 623

Query: 596 CKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            KRDW+LFIRAKDIDL+SHR IYD                NGP WK+V AFWC
Sbjct: 624 WKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEEYREKLRNGPKWKRVAAFWC 676

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/628 (55%), Positives = 427/628 (67%), Gaps = 36/628 (5%)

Query: 22  EMKEITKNSDAKSPE-QDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHL 80
           E+KE    +   S +  +N  +Y E T+         +S FEY   +  L          
Sbjct: 21  ELKENNPGAVVGSSDFTNNETDYLEKTS-------VQNSGFEYLENEGNL---------F 64

Query: 81  RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140
           R+  +SF+RA   + P   D  +                     ++ D+ L+KTIK RHV
Sbjct: 65  RRFANSFKRAPGSNNPDKEDGSDA-------------------GDKGDNKLKKTIKSRHV 105

Query: 141 XXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200
                              AL   GP GLVIGYAIMGSCLYCIIQA GE+AV Y+ L G 
Sbjct: 106 VMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGG 165

Query: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXX 260
           FNAYPS L+D A GFSVAWVYCLQWLCVMPLELVTAS+TI+YWTT+VN D          
Sbjct: 166 FNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVVI 225

Query: 261 XXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG 320
                 GA+GYAEAEFFFN+ KVLM++GF IL I++N GGAGNDGYIG KYW++PG+F G
Sbjct: 226 ITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSFSG 285

Query: 321 DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380
           DK ID FK V+S         GA+EFIA+ A+EQ+NPR++IPSAAK ++YRIL +++ SI
Sbjct: 286 DKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSI 345

Query: 381 TLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
            L+GFLVP+NS ELMGSG +AT ASPYVIA+ASHGV+VVPH INAVILLSV+S+ NSAFY
Sbjct: 346 ILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHLINAVILLSVISMGNSAFY 405

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
           SS R+L +L++QGYAPS+  Y+DREGRP  AM++S++F +I+F A S KEE VFTWLLAI
Sbjct: 406 SSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAI 465

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           SGLSQLFTW AIC+SHIRFRRAMKVQGRS+ E+GFKSQVGVWGS YA  MM L LI +FW
Sbjct: 466 SGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFW 525

Query: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDG 620
            +IAPIGE  LDA+ FFENYLAMPILI LYFGYK+ KRDW L+I A  IDL+S+R+I+D 
Sbjct: 526 TAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDE 585

Query: 621 XXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                          N  + ++   FWC
Sbjct: 586 DVLKQEDAEYREKLRNSGWLRRAAEFWC 613

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/616 (58%), Positives = 434/616 (70%), Gaps = 24/616 (3%)

Query: 38  DNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPT 97
           DN V YFEN       V    S+  Y+ +     + N +    R+ IDSF++AE    P 
Sbjct: 31  DNEVTYFEN-------VKQGSSNSTYSLESDHHAASNTR---FRRFIDSFKKAE---GPQ 77

Query: 98  NRDIENELTTTLSPLSATKDPQFAPHAE-EKDD---HLQKTIKPRHVXXXXXXXXXXXXX 153
              +++++      L+   D +  P  E EKDD    L+KTIKPRHV             
Sbjct: 78  PGSLDHDV------LAGDSDIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGM 131

Query: 154 XXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAF 213
                ++L  +GP GLVIGYAIMGSC+YCIIQA GE+AV Y+ L G FNAYPS L+D AF
Sbjct: 132 LVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAF 191

Query: 214 GFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXX-XXXXXGAKGYA 272
           GF+VAWVYC+QWLCV PLELVTASMTI+YWTT V+ D                 GA GYA
Sbjct: 192 GFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYA 251

Query: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMS 332
           EAEFFFNS K+LM+ GFFIL IV+  GGAGNDGYIG + WHNPG+FRGDK +DRFK V+S
Sbjct: 252 EAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFRGDKPVDRFKGVVS 311

Query: 333 XXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNST 392
                    G SEF+ + ASEQSNPR+AIPSAAK M+YRI+ I+L S+T+VGFLVPY+S 
Sbjct: 312 TLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSD 371

Query: 393 ELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQ 452
           +L+GS  AATKASPYV+A++ HGVRVVPHFINAVILLSVLSV NSAFYSS R L SLSQ 
Sbjct: 372 QLLGSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQL 431

Query: 453 GYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAI 512
           GYAPS+ NY+DR GRP +A  +SAL  VIAFCA S KE+ VF WLLAISGLSQLFTW +I
Sbjct: 432 GYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSI 491

Query: 513 CVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLD 572
           C+SH+RFRRAM+VQGRS+ E+GFKSQVG++GS Y+ +MM L LIA+FW ++ P+GE   D
Sbjct: 492 CLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPD 551

Query: 573 AQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXX 632
            Q FFENYLAMPI IVLYFG+KI K+DW+LFIRA+DIDLVSHR+I+D             
Sbjct: 552 VQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRR 611

Query: 633 XXXNGPFWKKVVAFWC 648
              +GP W++V  FWC
Sbjct: 612 KLRDGPMWRRVYDFWC 627

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/607 (57%), Positives = 428/607 (70%), Gaps = 25/607 (4%)

Query: 64  NGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTN------------RDIENELTTTLSP 111
           +G  K LP   +K    R  +DSF+RAE  +A ++            ++ +N+L    S 
Sbjct: 64  HGASKFLP--QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN 121

Query: 112 LS--------ATKDPQFAPHAEEKDDH--LQKTIKPRHVXXXXXXXXXXXXXXXXXXSAL 161
           L         AT +    P  E++D++  L++TIKPRHV                  + L
Sbjct: 122 LHIRDDELDYATVNVDSQP-VEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPL 180

Query: 162 HKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVY 221
            +AGP  LVIGY IMG+CLYCIIQACGE+AVAYS + G+FN +PSFLVD  F F+VAWVY
Sbjct: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240

Query: 222 CLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSC 281
           C+QWLCV PLELVT+SMTI+YWTT V+ D                GAKGYAEAEFFFN C
Sbjct: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCC 300

Query: 282 KVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXX 341
           KV+MM GFFI+AI INTG AG DGYIGAKYW++PGAFRG   I+RFK VM          
Sbjct: 301 KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAF 360

Query: 342 GASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAA 401
           GA+EFIA+ A+EQSNPR+AIPSAAK + YRIL IFLTSI L+GFLVPYNS +LMGS S  
Sbjct: 361 GATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGG 420

Query: 402 TKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNY 461
             ASPYV+A + HGV VV HFINAVILLSVLSVANSAFYSS R+L  L+Q GYAP WF+Y
Sbjct: 421 NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY 480

Query: 462 IDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRR 521
           +DR GRP R+M+ +A+ +VIAFCA S KE DVFTWLLAISGLSQ+FTW AICVSHIRFRR
Sbjct: 481 VDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR 540

Query: 522 AMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYL 581
            M+VQGRS+ E+GF++Q GV GS YAAIM+ LAL+A+FWV++ P+    LDA+NFF+NYL
Sbjct: 541 GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600

Query: 582 AMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWK 641
           AMPIL+ LY G+K+ +RD++LFIRAK+IDL+SHR I+D                NGP WK
Sbjct: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWK 660

Query: 642 KVVAFWC 648
           +VV FWC
Sbjct: 661 RVVDFWC 667

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/599 (56%), Positives = 416/599 (69%), Gaps = 9/599 (1%)

Query: 54  VNDSDSDFEYNGKKKILPSF-NIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPL 112
           +   DSD +     +    F N  +    + IDSFRRAED+     R + NE+   LS  
Sbjct: 24  IEQGDSDLQVTVLDEEKSEFSNGLRGRFDEFIDSFRRAEDV-----RILPNEMNPILSHE 78

Query: 113 SA--TKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLV 170
           S   T   + +    + ++ L+KTI+PRHV                  + L  AGP GL+
Sbjct: 79  SVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLI 138

Query: 171 IGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMP 230
           IGYAIM +C+YC++QA GEMAV Y  L G F+AYP FL+D    F+V+W+YC+QW CV P
Sbjct: 139 IGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCP 198

Query: 231 LELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXX-XGAKGYAEAEFFFNSCKVLMMAGF 289
           LELVTASMTIQYWTT VNAD                 GA+GYAEAEFF N CK+LMM GF
Sbjct: 199 LELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGF 258

Query: 290 FILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAI 349
           FIL I++  GGAGN G+IGA+YWH+PGAFRGD  I+RFK ++S         G +EF+AI
Sbjct: 259 FILGIILICGGAGNSGFIGARYWHSPGAFRGDNGINRFKGIVSTLVTAAFAFGGTEFLAI 318

Query: 350 GASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVI 409
            ASEQ+NPR+AIPSAAK +IYR L I++ SI +VGFLVPYNS+EL+GS   ATKASPYVI
Sbjct: 319 TASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVI 378

Query: 410 AVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPA 469
           AVASHG+RVVPHFINAVIL+SV SVA+SAFYSS R+L +L++QG+AP  F Y+D+ GRP 
Sbjct: 379 AVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPT 438

Query: 470 RAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRS 529
              ++ A+ ++I+FCACSSKE DVF WLL+ISGLS++FTW  I +SHIRFRRAMKVQGRS
Sbjct: 439 LGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRS 498

Query: 530 VDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589
           +DEIGFKSQ GVWGS YA +MM L LI +FWV I P+GED  DA +FF+ YLAMP+ IVL
Sbjct: 499 LDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVL 558

Query: 590 YFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           YFGYKI  RDW+LFIRAK+IDL++HR IYD                N P W+K+  FWC
Sbjct: 559 YFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYNFWC 617

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/590 (58%), Positives = 414/590 (70%), Gaps = 26/590 (4%)

Query: 59  SDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDP 118
           SD++Y+   ++L  F       ++L +SF+RA +     + D E +              
Sbjct: 33  SDYQYH-DGQVLSRF-------QRLTNSFKRAGEHGRGGDVDAEGQ-------------- 70

Query: 119 QFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGS 178
             AP    ++  L++TI  RH+                   ALH  GP GL IGYAIMGS
Sbjct: 71  PVAP----RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGS 126

Query: 179 CLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASM 238
           C+YCIIQA GEMAV+YS L GNFNAYPS L+D A GFSVAWVYCLQWLCV+PLELVTA++
Sbjct: 127 CIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATI 186

Query: 239 TIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINT 298
           TI+YWTT VN D                GA+GYAEAEFFFN+CKVLM+ GFFIL I++N 
Sbjct: 187 TIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNC 246

Query: 299 GGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPR 358
           GGAGNDGY+G KYWH+PGA  G K I  FK +++         GA+EFIA+ A+EQ+NPR
Sbjct: 247 GGAGNDGYLGGKYWHDPGALYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPR 306

Query: 359 RAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRV 418
           RAIPSAAK ++YR+L IFL  I L+GFLVPYNS ELMGSG +AT ASPYVIA+ASHGV+V
Sbjct: 307 RAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKV 366

Query: 419 VPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALF 478
           VPHFINAVILLSVLSV NSAFYSS R+L SLS+Q YAPSW NYIDREGRP RAM++S +F
Sbjct: 367 VPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIF 426

Query: 479 SVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQ 538
            +IAF A S KEE VFTWLLAISGLSQLFTWI ICVSHIRFR+A+ VQG+S+ E+G+KSQ
Sbjct: 427 GLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQ 486

Query: 539 VGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKR 598
            GV GS YA ++M   L  +FWV+IAP+G D LDA NFFENYLAMPILI LYFGY++ KR
Sbjct: 487 TGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKR 546

Query: 599 DWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           DWKL+I  + IDLVSHRK++D                N  +  +V  FWC
Sbjct: 547 DWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHFWC 596

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/654 (53%), Positives = 452/654 (69%), Gaps = 26/654 (3%)

Query: 1   MSSSSNQKDSDRISFSTESKYEMKEITKNSDAK-SPEQDNIVEYFENTTGIPAAVN-DSD 58
           M SSS+ ++S+         YE+KE+ K  D   S EQ+N +EYFE   G  AA   + +
Sbjct: 1   MPSSSDLENSN---------YELKEVNKKQDYNVSTEQENEIEYFETLKGKNAATTREEE 51

Query: 59  SDFEYN---GKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT 115
            DF  +   G+K+     +  + + R  IDSF+ AE+    TN D+E      L  +++ 
Sbjct: 52  YDFTTDSTSGRKR-----HGVKGYFRDFIDSFKPAENPQPHTNLDME------LVGVTSE 100

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
              Q      +  D L+KTI+PRHV                  + L +AGP GLVIGY I
Sbjct: 101 TIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGI 160

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MGS +YCIIQACGEMAV Y  L G FNAYP+FL+D  F F+ AWVYCLQWLCV PLELVT
Sbjct: 161 MGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVT 220

Query: 236 ASMTIQYWTTTVNADXXXXXXXX-XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAI 294
           ASMTI+YWTT V+ D                 GA+GYAEAEF FNSCK+LMM GFFIL I
Sbjct: 221 ASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGI 280

Query: 295 VINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQ 354
           +I  GGAG DGYIG +YWH+PGAFRG++++DRFK V++         G SEFIA+ ASEQ
Sbjct: 281 IIICGGAGTDGYIGGRYWHDPGAFRGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQ 340

Query: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASH 414
           SNPRRAIPSAAK +IYR L I+L SI L+GFLVPYNS++L+G+ S   KASPYV+AVA+H
Sbjct: 341 SNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANH 400

Query: 415 GVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIM 474
           GVRVVPHFINAVI++SVLSV+NSAFYSS R+L +LSQQG+AP  F+Y+DR GRP   +I+
Sbjct: 401 GVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIV 460

Query: 475 SALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIG 534
           ++LF+VIAFCA S KE+ VFTWLLA+SGLSQ+FTW++IC+SH+RFRRAM VQGRS+ E G
Sbjct: 461 ASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECG 520

Query: 535 FKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK 594
           F SQVG++GS+Y+  ++ L L+ +FWV++ P+G   +DA +FFENYLA PI I LY GYK
Sbjct: 521 FLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYK 580

Query: 595 ICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
              +DW+L+I+++DIDLV+HR+IYD                NGP+WK+  +FWC
Sbjct: 581 CYTKDWRLYIKSQDIDLVAHRQIYDEDILRQEREEETERLKNGPYWKRAYSFWC 634

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/640 (55%), Positives = 432/640 (67%), Gaps = 43/640 (6%)

Query: 21  YEMKEITKNSDAKS-----PEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNI 75
           YE+ ++ K     S        DN VEY      I   +ND        G   I  S   
Sbjct: 19  YELSDVKKPDGKNSYISDLETNDNEVEY------ISTDLNDK------YGSSSINESPAK 66

Query: 76  KQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAE--EKDDHLQK 133
           K+ +LR+ +DSF+RAE +  P +  I NE+TT              P AE    +D+L++
Sbjct: 67  KKSNLRRFVDSFKRAEHM-IPADDKI-NEMTTA------------EPEAEMASVEDNLKQ 112

Query: 134 TIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVA 193
           TIKPRHV                  SAL KAGP GLV GYAIMG+C+YCIIQ+ GEMAV 
Sbjct: 113 TIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVV 172

Query: 194 YSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASM-----TIQYWTTTVN 248
           YS L G FNAYP+ LV+  F     WV C   +    ++ ++  +       +YWTT V+
Sbjct: 173 YSKLNGGFNAYPTMLVEPGF-----WVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVD 227

Query: 249 ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIG 308
            D                GA+GYAEAEFFFN CKVLMMAGFFIL I+IN GGAGNDGY+G
Sbjct: 228 PDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLG 287

Query: 309 AKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTM 368
             YW NPGAFRGDK ID FK V++         G +EFIA+ A+EQSNPR+AIPSAAK +
Sbjct: 288 NIYWRNPGAFRGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKV 347

Query: 369 IYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVIL 428
           +YRI+ ++LTSI L+GFLVP+ S EL+GSGSAAT ASPYVIAVASHGVRVVPHFINAVIL
Sbjct: 348 LYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVIL 407

Query: 429 LSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSS 488
           LSVLSV NSAFYSS R+L SLS+QGYAP WF+Y+DREGRP+RAMI+SALF VIAFCA S 
Sbjct: 408 LSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSP 467

Query: 489 KEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA 548
           KE +VFTWLLAISGLSQ+FTWI+IC+SHIRFR AMK QGRS+ E+GFK+Q G+WGS Y+ 
Sbjct: 468 KETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSI 527

Query: 549 IMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKD 608
            +M L LI +FWV+IAPIG   L A+NFFENYLAMPILI  YFGYKI K+DW L+I+A+D
Sbjct: 528 FLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAED 587

Query: 609 IDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           IDL+SHR+I+D                NGP W+++VAFWC
Sbjct: 588 IDLISHRQIFDEELLKQEDYELKEKLKNGPVWRRIVAFWC 627

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/571 (57%), Positives = 403/571 (70%), Gaps = 12/571 (2%)

Query: 79  HLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           +L+  +DSF++ +D +        N+     + ++  K  QF    ++ ++ LQKTI+PR
Sbjct: 39  NLKDFVDSFKKIDDNN--------NQYEIEKNEINNIKSDQFN---DKLNNQLQKTIQPR 87

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           HV                  + LH AGP GL+IGY IM SC+YCIIQACGEMAV Y  L 
Sbjct: 88  HVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXX 258
           G FN YPSFLVD A+ F+VAWVYC+QWLCV PLELVTASMTI+YW   V+ D        
Sbjct: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207

Query: 259 XXXXXXXXG-AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                   G A+GYAEAEFFFN CK+LM+AGFFIL I++  GGAG  GYIG  YW+NPGA
Sbjct: 208 LIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGA 267

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           FRG     RFK ++S         G +EF+AI ASEQSNPR+AIPSAAK +IYR LFI++
Sbjct: 268 FRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYV 327

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            SI +VGFLVPYNS EL+GS S+ TKASPYVIAVASHG+R+ PHFINAVIL+SVLSVANS
Sbjct: 328 GSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANS 387

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           +FYSS R+L +L++QGYAP  F Y+DR+GRP   +I ++L + IAFCA S KE +VF+WL
Sbjct: 388 SFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWL 447

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           LAISGLSQ+FTW  IC+SHIRFRRAMK+QGRS++E+G+KSQVGVWGS YAA +M L LI 
Sbjct: 448 LAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG 507

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           +FWV++ P+  +  +  NFF+ YLAMPIL++ YFGYK  K+DW LFIRAKDIDL+SHR I
Sbjct: 508 QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHI 567

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           YD                NG  W K+ AFWC
Sbjct: 568 YDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/646 (52%), Positives = 427/646 (66%), Gaps = 41/646 (6%)

Query: 4   SSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEY 63
           S +   +D+     ++   M+E+  N+ ++S E+               ++   D  F  
Sbjct: 2   SKDAAHTDKALGELDTDIGMQELKSNTGSESVER--------------ISLPGDDYKFHE 47

Query: 64  NGKKKILPSFNIKQPHLRKLIDSFRRAEDI-DAPTNRDIENELTTTLSPLSATKDPQFAP 122
           +  K             R+   +F RA+ + D  +  D+E                  A 
Sbjct: 48  DDSKS----------RFRRFARTFHRADGLGDGASGNDVEFG----------------AE 81

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
            A + +  L++TI  RHV                   ALH  GP GLVIGYAIMGSCLYC
Sbjct: 82  VARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYC 141

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           IIQA GE+AV+YS L GNFNAYPS L+++AFGFSVAW+YCLQWLCV+PLELVTAS+TI+Y
Sbjct: 142 IIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKY 201

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WTT+VN D                GA+GYAEAEFFFN CKVLM+ GFFIL I++N GGAG
Sbjct: 202 WTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAG 261

Query: 303 NDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           NDGYIG +YW+NPGAF G K I  FK ++S         GA+EFIA+ A+EQ+NPRRAIP
Sbjct: 262 NDGYIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
           SAAK ++YRIL IFL  I L+GFLVP+NS ELMGSGS+AT ASPYVIAVASHGVRVVPHF
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHF 381

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
           INAVILLSVLSV NSAFYSS R+L +L+ Q YAP+W  +IDR GRP RAM++S +F +I+
Sbjct: 382 INAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLIS 441

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           F A S KEE VFTWLLAISGLSQLFTWI+ICVSHIRFR+A+ VQG+ + E+G+KSQ GV 
Sbjct: 442 FVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVA 501

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
           GS YA  +M   LI +FWV+IAP+G   LDA +FFENYLA+P+ +VLYFG+KI KRDW+L
Sbjct: 502 GSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRL 561

Query: 603 FIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           +I  + IDL SHRK +D                N  + +++  +WC
Sbjct: 562 YIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYWC 607

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/636 (52%), Positives = 437/636 (68%), Gaps = 16/636 (2%)

Query: 17  TESKYEMKEITKN--SDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGK-KKILPSF 73
           T + YE++++     S ++SP  DN VEYF+             S+ E  G   + +   
Sbjct: 6   TITPYELQDVKGEAVSASRSPP-DNEVEYFDKL----GDARQYTSNLEGEGTPTEGVSRH 60

Query: 74  NIKQPHLRKLIDSFRRAEDIDAPTNR--DIENELTTTLSP-LSATKDPQFAPHAEEKDDH 130
            IK P  R  IDSF+R E     T R  D+EN+LTT +SP LS       +     K + 
Sbjct: 61  RIKNPLFRNFIDSFKRGET----TARIADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEE 116

Query: 131 LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEM 190
           L++ I  RH+                  S L+ AGP GL+IGYA+MG+C+YC+IQA GE+
Sbjct: 117 LKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGEL 176

Query: 191 AVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNAD 250
            V Y+ L G FNAYP+ LV  +F FSV W+Y LQWLC+ PLELVTAS+TI+YWTT V+ D
Sbjct: 177 GVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPD 236

Query: 251 XXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAK 310
                           G+KGYAEA+FFFN  K+ M++GFFIL IV+  GGAG+DGY+G K
Sbjct: 237 VFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGK 296

Query: 311 YWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIY 370
           YWHNPGAFRG+K+ID FK V S         G SEF+A+ ASEQ+NPR++IPSAAK ++Y
Sbjct: 297 YWHNPGAFRGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILY 356

Query: 371 RILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLS 430
           RI++++LTSIT++GFLVP++S +L  S S   K SPYV+A+A HGV+VVPH INAVIL++
Sbjct: 357 RIIWVYLTSITILGFLVPWDSPQLQPS-SDGKKTSPYVVAIAMHGVKVVPHLINAVILMA 415

Query: 431 VLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKE 490
           VLSV+NSAF+ S R+L SLSQ+GYAP WF+Y+DR+GRP RAM++SALF VI FCA S KE
Sbjct: 416 VLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKE 475

Query: 491 EDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIM 550
            DVF+WLLAISGLS +FT+ +ICVSHIR R AMKVQGRS+ E+GF+SQVG +GS YA ++
Sbjct: 476 TDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLL 535

Query: 551 MTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDID 610
           + L+L+AEFWV++APIGE  LDA++FFENYLA PI IV YFGY I K+D+++FIR+KDID
Sbjct: 536 LVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDID 595

Query: 611 LVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAF 646
           L   R+++D                N P W+KV+AF
Sbjct: 596 LDFKRQVFDEDLIKQEDEEYAEQMRNAPRWRKVIAF 631

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/650 (51%), Positives = 418/650 (64%), Gaps = 32/650 (4%)

Query: 1   MSSSSNQKDSDRIS-FSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDS 59
           M+ ++   +SD IS   ++ K+  K  T       P  +   EY+E T         S S
Sbjct: 1   MTGATGSSNSDFISPVGSDVKHNDKSDTIIQSEGFPSIEGEAEYYEKTF--------SQS 52

Query: 60  DFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQ 119
           D EY  K  +   F           DSF+RA+ I+   + + E EL  + S L       
Sbjct: 53  DEEYAAKSSVWHRFK----------DSFKRADHINTNIHGNAELELNPSQSLL------- 95

Query: 120 FAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSC 179
                 EK   L++ IKPRHV                   AL   GP GL IGYAIMGSC
Sbjct: 96  -----PEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSC 150

Query: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239
           LY IIQA GE+AVAY  L GNFN YPSFLVD A  F+ A +YC+QWLCV PLE+++A++T
Sbjct: 151 LYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAIT 210

Query: 240 IQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299
           I+YW T++N +                G+ GYAEA+FFFN+CK+LM AGFFIL I+IN G
Sbjct: 211 IKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCG 270

Query: 300 GAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRR 359
           GAG+  YIG KYW++PGAF GD  I RFK ++S         GASE +A+ ASEQ+NPR+
Sbjct: 271 GAGDSVYIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRK 330

Query: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVV 419
           AIPSAAK ++YRI+ I+L SI LVGFLVPYNS ELMGSGS++  +SPYVIAVASHGV+VV
Sbjct: 331 AIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVV 390

Query: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479
           P FINAVIL+SVLSV N +FYSS RIL  LS+ GYAP +F Y+DR+GRP  AMI+ AL  
Sbjct: 391 PSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVG 450

Query: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539
            I F + SS EE VFTWL+A+SGLSQLFTW  IC+SH+RFR+AM+VQ RS+ E+GF+SQV
Sbjct: 451 CICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQV 510

Query: 540 GVWGSSYAAIMMTLALIAEFWVSIAPI-GEDHLDAQNFFENYLAMPILIVLYFGYKICKR 598
           GVWGS Y   MM L  I +FWV++ P+ G D  DA+NFF NYLAMP+ + LYFG+KI K+
Sbjct: 511 GVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKK 570

Query: 599 DWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           DW+L+I A +IDL+SHRKI+D                +   W K+  FWC
Sbjct: 571 DWRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC 620

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/628 (50%), Positives = 417/628 (66%), Gaps = 27/628 (4%)

Query: 21  YEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHL 80
           +EMK I      KSPE D +VE F++   +      S+                 +    
Sbjct: 4   FEMKNI------KSPE-DGVVESFDSVEVVKETSPRSEGS---------------RDGLF 41

Query: 81  RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140
            + +DSF+R E+       +  + + +T   +S     + AP    K   L++ IKPRHV
Sbjct: 42  HRFVDSFKRPEE-----EYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHV 96

Query: 141 XXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200
                              +LH  GP  L+IGYAI+ + LYC+IQ+  E+A+ Y+ L G 
Sbjct: 97  LMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGG 156

Query: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXX 260
           FNAYP+ LVD+AF FSV+WVYCLQWLC++PLELVTASMTI+YW  ++N D          
Sbjct: 157 FNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVL 216

Query: 261 XXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG 320
                 GA GYAEAEFFFN+CKVLM+ GFFIL I++N GGAGNDGY+G+ YWH+PGAFRG
Sbjct: 217 IVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRG 276

Query: 321 DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380
           +  I+RFK +++         G +EF  + A+EQ NP+++I SA+K ++YRI+ I+L + 
Sbjct: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336

Query: 381 TLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
            L+GFLVPYNS EL+GSGSAAT ASP+VIA+ASHGV+VVPH INAVILLSVLSVANSA Y
Sbjct: 337 ALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALY 396

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
           SS RIL SLS+QG+AP  FNY+DR GRP R +++S +F ++ F A S KEE VFTWLLAI
Sbjct: 397 SSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           SGLS+LFTW +I +SH+RFRR+M VQGRS+DE+G++S  GVWG+ YA IM+ L LI +FW
Sbjct: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFW 516

Query: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDG 620
           V+I+P+G + LDA NFFENYLAMPILI LY GYK+  RDW++ I A ++DLVSHRKI+D 
Sbjct: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576

Query: 621 XXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                          +  + K+   FWC
Sbjct: 577 EIMQSEQLEEKEQLRHASWTKRAAEFWC 604

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/610 (51%), Positives = 396/610 (64%), Gaps = 38/610 (6%)

Query: 39  NIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTN 98
           +  E+FE  +          SDFEY         F   +   R+ ++SF++A     P  
Sbjct: 35  DTTEFFEKAS-------VQKSDFEY---------FEGDETKFRRFVNSFKKA-----PGR 73

Query: 99  RDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXX 158
            + +  L                     K + L++TI+PRHV                  
Sbjct: 74  ENDQESL-----------------QDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTG 116

Query: 159 SALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVA 218
            AL+  GPGGL +G+ +MG+C+YC+IQA GEMAV Y  L G FNAYPSFLVD  FGF+ A
Sbjct: 117 KALYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATA 176

Query: 219 WVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFF 278
           W+YC+QWLCV PLELVTAS+TI+YWTT +N D                GA+GYAEAEFFF
Sbjct: 177 WLYCIQWLCVFPLELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFF 236

Query: 279 NSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXX 338
           N+CKVLM+ GFFI+ I++NTG AGNDGYIGAKYW  PG+F G  +ID FK V+S      
Sbjct: 237 NTCKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGGHTAIDHFKGVVSTLVNAA 296

Query: 339 XXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG 398
              G SEF+A+ A+EQ+NPR+++PSAAK M+Y++  +FL S+TL+GFLVP NS+ELMGS 
Sbjct: 297 FSLGCSEFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGST 356

Query: 399 SAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSW 458
            ++   SPYVIAVASHGVRVVPHFINAVILLSVLSV NSAFYSS R+L SL++QGYAP  
Sbjct: 357 DSSVHVSPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPV 416

Query: 459 FNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIR 518
           F YIDR+GRP  AM++S     + F A S KEE VF WLLAISGLSQLFTW +IC+SHIR
Sbjct: 417 FKYIDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIR 476

Query: 519 FRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFE 578
           FR+A+ VQGR  D +GFK+Q GVWGS Y+A++M L  IA+FW  + P+G    +A++FFE
Sbjct: 477 FRKALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFE 536

Query: 579 NYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGP 638
            YLA PI + LYFGYKI  ++W+LFI A+ IDL  HRKI+D                +  
Sbjct: 537 GYLAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYRAKLRDSS 596

Query: 639 FWKKVVAFWC 648
            W ++ A WC
Sbjct: 597 MWHRIAALWC 606

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/629 (49%), Positives = 390/629 (62%), Gaps = 42/629 (6%)

Query: 22  EMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLR 81
           E+K+I K+    + E     E+FE T+          SDFEY                 +
Sbjct: 21  ELKDI-KSGKVVTTET---TEFFEKTSA-------QKSDFEY---------LEGDDTRFK 60

Query: 82  KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVX 141
           + + SF+RA             +                      K ++L++TIK RH+ 
Sbjct: 61  RFLSSFKRAHGSGGTDTEGGGGQ--------------------NAKHENLKQTIKSRHMI 100

Query: 142 XXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNF 201
                            +ALH  GP G  IG+ IMG C+YC+IQA GE+AV Y+ L G F
Sbjct: 101 MISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGF 160

Query: 202 NAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW--TTTVNADXXXXXXXXX 259
           NAYPSFL+D A GF+ AWVYCLQWLCV PLELVTAS+TI++W  + +VN D         
Sbjct: 161 NAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVL 220

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  GA+GYAEAEFFFNSCKVLMM GFFI+ I+INTG  G  GYIG KYW +PG+  
Sbjct: 221 IIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLG 280

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           G    D FK +++         G SEF+A+ A+EQ+NPR++IP+AAK MIY+I  +FL S
Sbjct: 281 GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGS 340

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GFLVP +S ELMGS  +    SPYVIAV  HGV VVP FINAVILLSVLSV NSAF
Sbjct: 341 VILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAF 400

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           YSS R+L+SL++Q YAP  F YIDR GRP  AMI+S LF  I F A S KEE+VF WLLA
Sbjct: 401 YSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLA 460

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           ISGLSQLFTW  IC+SHIRFRRA+ VQG S DE+GFK+Q G+ GS  +AIMM LALI +F
Sbjct: 461 ISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQF 520

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           WVS+ P+G    DA++FF  YLAMP+ ++ YFGYKI  +DW+LFIRA  IDLVSHR+I+D
Sbjct: 521 WVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFD 580

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           N   W ++  FWC
Sbjct: 581 ADVLKQEDIEYRAKLRNSSIWHRIANFWC 609

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/569 (54%), Positives = 393/569 (69%), Gaps = 11/569 (1%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
            R+  DSFRR E  +     D ++E    L+P+ +            K   L++ I+PRH
Sbjct: 41  FRRFADSFRRHEAHNG-GGGDGDDEDHEGLTPIESAS----------KHKTLKQNIRPRH 89

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                   +LH  GP  LVIGYAI+ S LYC+IQ+  E+A+ Y+ L G
Sbjct: 90  VLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAG 149

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
            FNAYPS LVD+AFGFSV+WVYCLQWLCV+PLELVTASMTI+YW  T+N D         
Sbjct: 150 GFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVV 209

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  GA GYAEAEFFFN CKVLM+ GFFIL I+IN GGAGNDGY+GA+YWH+PGAFR
Sbjct: 210 LVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFR 269

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           G  SI+RFK +++         G +EF  + A+EQ NP+++I SA+K ++YRIL I++ +
Sbjct: 270 GSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMT 329

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
             L+GFLVP+NS EL+GSG +AT ASP+VIAVASHGVRVVPHFINAVILLSVLSVANSA 
Sbjct: 330 AILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFINAVILLSVLSVANSAL 389

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           YSS RIL SLS+QG+AP + NY+DR GRP   +++S +F +++F A S KEE VFTWLLA
Sbjct: 390 YSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLA 449

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           ISGLS+LFTW +I +SH+R RRAM VQGRS DE+G+ +  GVWG+ YA  M+   L+ +F
Sbjct: 450 ISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQF 509

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           WV+I+P+G + LDA NFFENYLAMPILI LY GYKI  RDW+L I + ++DLV+HRKI+D
Sbjct: 510 WVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFD 569

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           + P+  ++  FWC
Sbjct: 570 AEVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/579 (51%), Positives = 373/579 (64%), Gaps = 13/579 (2%)

Query: 72  SFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHL 131
           S + +   +R  +DSF+RAE    P  + I  E          T D     +A +K   +
Sbjct: 27  SVHSQHGFVRNFMDSFKRAE----PQGQTIREEKLENGLETVRTNDY----NATQKK--M 76

Query: 132 QKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMA 191
           ++T+K RH+                   ALH  GPGGLVIGY    + LYC+IQAC E+ 
Sbjct: 77  KQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELG 136

Query: 192 VAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADX 251
           V+Y+ LPGN+N+YPSFLVD  F F+VAWVY LQW  V+PLELVT+SMTI+YW  ++N D 
Sbjct: 137 VSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDV 196

Query: 252 XXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKY 311
                          G++GYAE+EF FNSCKVLMM GF I+ I +N G A   GYIG KY
Sbjct: 197 FVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCG-ASKSGYIGGKY 255

Query: 312 WHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYR 371
           WH PGAF G+K+ID FK + S         G SEFIA+ A+EQ+NPR+++P A K  +YR
Sbjct: 256 WHTPGAFVGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYR 315

Query: 372 ILFIFLTSITLVGFLVPYNSTELMGS-GSAATKASPYVIAVASHGVRVVPHFINAVILLS 430
           +L +FLT I LVGFLVPY+S  L+GS G AA+ ASP+VIA ASHGV+VVPH INAVIL+S
Sbjct: 316 VLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILIS 375

Query: 431 VLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKE 490
           V+SV NSAFYS+ RIL SL++QG  P  F Y+DR+GRP   M+  A+F +I+F A S  E
Sbjct: 376 VISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNE 435

Query: 491 EDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIM 550
           E VFTWL AI  LSQLFTW AI +SHIRFR AMK QGRS+ E+G+K+  G WGS YA   
Sbjct: 436 ETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAF 495

Query: 551 MTLALIAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDI 609
             + L A+FWV+IAPIG    LD  NFF+NYLA P+L+  YFGYK+  RDWKLFI A  +
Sbjct: 496 NIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKV 555

Query: 610 DLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           DL SHRKI+D                N  FW + + FWC
Sbjct: 556 DLESHRKIFDADLIKQEDFEHKERIRNSSFWVRALDFWC 594

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/570 (48%), Positives = 357/570 (62%), Gaps = 12/570 (2%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + +  DSF+RAE     T +  EN           T D +    +   D  L+K++K RH
Sbjct: 51  IHRFADSFKRAEGSTTRTKQINEN-----------TSDLEDGVESITSDSKLKKSMKSRH 99

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    LH  GP  L+IGY ++    Y +IQA GEMAV Y  LP 
Sbjct: 100 VVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPA 159

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  + ++FGF+  W+YC QWL V+PLEL+TASMTIQ+W   +N D         
Sbjct: 160 NFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVF 219

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF FN CK+LM+AGF IL+IVIN GGAGNDGYIGA YWHNPGAF 
Sbjct: 220 LVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFA 279

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           GD SI RFK+V           G  E  A+   EQSNPR++ P AAK  IYRI+ I+L +
Sbjct: 280 GDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLT 339

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VPYN  +LMG+G +AT ASPYV+A + HGV++VPH INAVIL+SV+SVANS+ 
Sbjct: 340 MILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSL 399

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y+  R++ SL+QQGYAP + +Y+DREGRP RA+I+  +F VIAF A SSKEE VFTWL A
Sbjct: 400 YAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAA 459

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS+LFTW +I +SH+RFR+AMKVQGRS+DE+G+K+  G+WGS Y      L  +A+F
Sbjct: 460 IAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQF 519

Query: 560 WVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV++AP+G     DA++FF+NYLA PI +  YFGY +  RD+ L      IDL  HR+IY
Sbjct: 520 WVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIY 579

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N    +K   FWC
Sbjct: 580 DPELMRQEDEENKEKLRNMSLMRKAYHFWC 609

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/570 (50%), Positives = 369/570 (64%), Gaps = 31/570 (5%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
            R  +DSF++ +D D        +E T T S                    ++KTIK RH
Sbjct: 36  FRDFVDSFKKKQDDDVVG----YDEETGTSS-------------------KMKKTIKSRH 72

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                  +AL KAGPGGL+IGY +  + LYCIIQA GE+ + YSG+ G
Sbjct: 73  LLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGELGICYSGMTG 132

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           N+ AY S LVD A GFSV+WVYC+QW+ V PL+LVTA++TI+YWT T N D         
Sbjct: 133 NYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDT-NPDIFVAILYFL 191

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  GAKGYAEAEF FN+CKVLMM GF IL I+IN GGAGNDGYIGA+YWH PGAF 
Sbjct: 192 IVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIGARYWHTPGAFS 251

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
                  FK V           G  E + + ASEQ NPR++IPSA K +IYRIL I++ +
Sbjct: 252 -----TGFKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLT 306

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
             +V FLVPY++ EL  +GSA ++ASP+VIA+ASHG+ VVPH INAVIL++V+SV NS+ 
Sbjct: 307 TLIVCFLVPYDAPELTSTGSA-SRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSL 365

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           YS+ R+L SLS+QGYAP  FNY+DR+GRP    +++    ++AF A S  EEDVF+WLLA
Sbjct: 366 YSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLA 425

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           ISGLSQLF WI+IC+SH+RFR AMK QGRS+ E+G+KSQ G WGS +A I+    L+A+F
Sbjct: 426 ISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQF 485

Query: 560 WVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV+IAPIG    L A++FF++YLA P+LI +YFGYKI  +DW+L I A ++DL SHRKI+
Sbjct: 486 WVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIF 545

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                    W K+  FWC
Sbjct: 546 DEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  567 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/594 (48%), Positives = 367/594 (61%), Gaps = 17/594 (2%)

Query: 59  SDFEYNGKKKIL---PSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT 115
           +DF+ + ++K     PS + K  H  +L +SF+RAE     T +  EN           T
Sbjct: 29  NDFQISSREKAYSGQPSKSEKLIH--RLANSFKRAEGSITKTRQINEN-----------T 75

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
            D +    +   D  L+K++K RHV                    LH  GP  LVIGY +
Sbjct: 76  SDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           +    Y +IQA GEMAV Y  LP NFNAY S  + + FGF+  W+YC QWL V+PLEL+T
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELIT 195

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           ASMTIQYW   +N D                G K Y E EF FN CK+LM+AGF IL++V
Sbjct: 196 ASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVV 255

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           IN GGAG+DGYIG  YWHNPGAF GD SI RFK+V           G  E  A+   EQS
Sbjct: 256 INCGGAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQS 315

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR++ P AAK  IYRI+ I+L ++ L+GF VPYN  +LMG+G +AT ASPYV+A + HG
Sbjct: 316 NPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           V++VPH INAVIL+SV+SVANS+ Y+  R++ SLSQQGYAP + +Y+DREGRP RA+I+ 
Sbjct: 376 VKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVC 435

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
            +F VIAF A SSKEE VFTWL AI+GLS+LFTW +I +SH+RFR+AMKVQGRS+DE+G+
Sbjct: 436 CIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYK 594
           K+  G+WGS Y      L  IA+FWV++AP+G D     ++FFE+YLA PI +  +FGY 
Sbjct: 496 KATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYM 555

Query: 595 ICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           I  RD+ L      IDL  HR+IYD                N    +K   FWC
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLMRKAYHFWC 609

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/572 (48%), Positives = 373/572 (65%), Gaps = 26/572 (4%)

Query: 82  KLIDSFRRAEDIDAPTN---RDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           +  DSF+RA+ +D   +   +D +N L  T                      L+  IK R
Sbjct: 36  RFTDSFKRAQ-VDTAVDLEGKDADNGLNKT-------------------QQTLKHNIKTR 75

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                   ALH  GP GLVIGY    + LYC++QAC E+ VAY+ LP
Sbjct: 76  HLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLP 135

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXX 258
           GN+NAYP+FLVD+ FGF+VA VY LQW  V+PLELVTASMT++YWT++VN D        
Sbjct: 136 GNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYV 195

Query: 259 XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318
                   G++GYAEAEF FNS KVL+MAGF I+AI + T GA   GYIG +YWH+PGAF
Sbjct: 196 FLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGYIGGQYWHDPGAF 254

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
            GD++IDRFK + S         G SEFIA+ A+EQ+NPR ++P A K  +YR++ +FL 
Sbjct: 255 GGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLL 314

Query: 379 SITLVGFLVPYNSTELMGS-GSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            + L+GFLVP+NS +L+ + G + ++ASP+VIA A HGVRVVPH IN +IL SV+SV NS
Sbjct: 315 PVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNS 374

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           A YS+ RIL SL++ G  P  F Y+DR+GRP   +I  +LF +IAF A S++EE+VFTWL
Sbjct: 375 AMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWL 434

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
            AI+GLSQLFTW AI VSH+RFRRAM+VQGRS+ E+G+++  G  GS YA     + LIA
Sbjct: 435 SAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIA 494

Query: 558 EFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRK 616
           +FW++IAPI +   LD + FF+NYLA P+L+V Y GYK+ KRD++L I + ++DL+SHR+
Sbjct: 495 QFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQ 554

Query: 617 IYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           I+D                N   +K+++ FWC
Sbjct: 555 IFDEEVLLQEEAERKERLRNSTLFKRLLDFWC 586

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/572 (50%), Positives = 367/572 (64%), Gaps = 27/572 (4%)

Query: 79  HLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
            + + I+SFRR  + +       ENE        +ATK              ++K+IK R
Sbjct: 37  QVNRFINSFRRKGESEDVKELKGENEECG-----AATK--------------MKKSIKSR 77

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                   AL KAGP GLVIGYA+    LYCIIQA GE+ + YSG+ 
Sbjct: 78  HLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMA 137

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXX 258
           GN+ AY S LVD A GFSV+WVYC+QW+ V+PL+LVTA+MT++YWT   N D        
Sbjct: 138 GNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNA-NPDIFVAVFFV 196

Query: 259 XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318
                   GAKGYAEAEF FN CKVLM+AGF IL I IN GGAG  GYIGAKYWH+PG+F
Sbjct: 197 VIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSF 256

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
                   FK V           G  E + + ASEQ NPR++IP+A K +IYRIL I++ 
Sbjct: 257 AAG-----FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYML 311

Query: 379 SITLVGFLVPYNSTELMGS-GSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
           +  +V FLVPYNS+ELMGS G +A+ ASP VIAVASHGV++VPH INAVIL+SV+SV NS
Sbjct: 312 TTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHIINAVILISVISVGNS 371

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           + YS+ R+L SLS+QGYAP + NY+DR+GRP     ++ L ++IAF A S  EED+F WL
Sbjct: 372 SMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWL 431

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           LAISGLSQ+F W +IC+SH+RFR AM  QG S+ +IG+KSQ G WGS +A ++  L LIA
Sbjct: 432 LAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLVLIA 491

Query: 558 EFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRK 616
           +FWV+IAPIGE+  L+A+ FF+NYLA PIL+  YFGYK+  +DW+L I A ++DL SHR 
Sbjct: 492 QFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRN 551

Query: 617 IYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           I D                N   W ++  FWC
Sbjct: 552 ISDEEILRQEDYEWNEKMSNSSIWVRLCHFWC 583

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/623 (45%), Positives = 378/623 (60%), Gaps = 30/623 (4%)

Query: 27  TKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDS 86
           + + +  SPE    ++ F+++  +      S   F  +   K       ++ H  K +DS
Sbjct: 3   SSSKEGGSPE----IKTFDSSVKLSEITEKSTPVFPLDSTLK-------RRTHFTKFVDS 51

Query: 87  FRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXX 146
           FRRAED  A  + D+E+         S T D          DDH++K +K RHV      
Sbjct: 52  FRRAEDKHA--DSDLED------GSKSITSD----------DDHMKKAMKSRHVIMMTLG 93

Query: 147 XXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPS 206
                         L  AGP  LV+GY ++    Y +IQA GEMAV Y  +P +FN Y S
Sbjct: 94  TGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYAS 153

Query: 207 FLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXX 266
             V + FGF+  W++C+QWL V+PLEL+TASMTI+YW  T+N D                
Sbjct: 154 IFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFF 213

Query: 267 GAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDR 326
           G K Y E EF FNSCK+LM+AGF IL+IVIN GGAG DGYIG KYW NPGAF  +    R
Sbjct: 214 GVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPAAR 273

Query: 327 FKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFL 386
           FK V           G +E  ++  +EQ NPR++ P+AAK  IYRIL I+L ++ L+GF 
Sbjct: 274 FKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFN 333

Query: 387 VPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRIL 446
           VP++S +LMG+G +AT ASPYV+A + HGV+VVPHFINAVIL+SV+SVANSA Y+S R++
Sbjct: 334 VPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLM 393

Query: 447 YSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQL 506
            SL++QGYAP WFNY+DREGRP RA+ +  LF VI F ACS +EE  FTWL AI+GLS+L
Sbjct: 394 RSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSEL 453

Query: 507 FTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI 566
           FTW +I +SHIRFR AMKVQG+S++E+G+++  G+WGS Y+     L  IA+FWV+++P 
Sbjct: 454 FTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPP 513

Query: 567 GED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXX 625
             +   DA+ FFE+YLA P+ +V YFGY I  RD+        IDL  HR+IYD      
Sbjct: 514 KSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQ 573

Query: 626 XXXXXXXXXXNGPFWKKVVAFWC 648
                     N  +  ++ +FWC
Sbjct: 574 EDAETKERLRNSGWLARLRSFWC 596

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/569 (46%), Positives = 353/569 (62%), Gaps = 17/569 (2%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + + ++SF+RAE      + D+E +  T ++                 D  L+KT+K RH
Sbjct: 41  IHRFVNSFKRAEQPPLKQDSDLEEDTDTIVT-----------------DTQLKKTMKSRH 83

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    LHKAGP  LVI Y ++    Y +IQA GEMAV Y  LPG
Sbjct: 84  VVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPG 143

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  + + FGF+  W++ +QWL V+PLEL+TA+MT+QYW  ++NAD         
Sbjct: 144 NFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVF 203

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF FN CK+L + GF I +IV+N GGAGN GYIGAKYWH+PGAF 
Sbjct: 204 LLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFT 263

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
            D +  RFK V           G  E  A+  +EQ NPRR+ P+AAK  IYRI+ I+L +
Sbjct: 264 SDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLT 323

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + LVGF VP NS ELMGSG + T ASPYV+A + HGV+VVPH +NAVIL+S++SV NSA 
Sbjct: 324 MILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSAL 383

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R++ +L+QQG+AP + +Y+DREGRP  A+I+ ++F VI F ACSSKEE VF WL A
Sbjct: 384 YAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAA 443

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GL++LFTW  I +SHIRFR+AMK+Q +S+DE+G+KS  GV+GS +      L  +A+F
Sbjct: 444 IAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQF 503

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           WV++AP     + A  FFE+YLA PI    YFGY I KRD+ LF   + +DL  HR+IYD
Sbjct: 504 WVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYD 563

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           N P WK++  FWC
Sbjct: 564 PELVKQEDEEKKEMLKNSPMWKRMYYFWC 592

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/573 (47%), Positives = 361/573 (63%), Gaps = 20/573 (3%)

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136
           + H  + +DSF+RAE      N +                D +   ++ + DD+L+K +K
Sbjct: 42  RTHFNRFVDSFKRAE-----VNHN--------------GIDLEDGTNSIQSDDNLKKAMK 82

Query: 137 PRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196
            RHV                    L+ AGP  LVIGY ++    Y +IQA GEMAV Y  
Sbjct: 83  SRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPT 142

Query: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXX 256
           LPG FN Y S  V + FGF+  W++C+QWL V+PLEL+TASMTI+YW   +NAD      
Sbjct: 143 LPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADVFVVIL 202

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316
                     G + Y EAEF FNSCK+LM+ GF IL+IV+N GGAG DGYIG KYW +PG
Sbjct: 203 YVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPG 262

Query: 317 AFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIF 376
           AF  D +  RFK V           G  E  A+  +EQ NPRR+ P+AAK  IYRIL I+
Sbjct: 263 AFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIY 322

Query: 377 LTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVAN 436
           L ++ L+GF VP+NS +LMG+G +AT ASPYV+AV+ HGV+VVPH INAVIL+SV SVAN
Sbjct: 323 LLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVAN 382

Query: 437 SAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTW 496
           SA Y+S R+L SL++QGYAP +FNY+DREGRP RA+I+ ++F VIAFCACS +EE +FTW
Sbjct: 383 SALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTW 442

Query: 497 LLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALI 556
           L AI+GLS+LFTW +I +SH+RFR AMK QG+S++E+G+ S  G+WGS Y      L  I
Sbjct: 443 LAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFI 502

Query: 557 AEFWVSIAPIGEDHL-DAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHR 615
           A+FWV+++P G   +  A+ FFE+YLA P+ +  Y GY +  RD+      K IDL +HR
Sbjct: 503 AQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHR 562

Query: 616 KIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           ++YD                NG + +K++ FWC
Sbjct: 563 RLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/585 (47%), Positives = 365/585 (62%), Gaps = 27/585 (4%)

Query: 71  PSFNI------KQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHA 124
           PSFN+      +   + + +DSF+RA+D         EN+L     PL            
Sbjct: 29  PSFNLDATEESRSGLVHRFVDSFKRAQD-------STENDLEDGTKPLGDA--------- 72

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
                HL+K +K RHV                  S L   GPG LVIGY ++    Y +I
Sbjct: 73  ----SHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMI 128

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           QA GEMAVAY  LPGNFN+Y S  + + FGF+  W++ +QWL V PLEL+TAS+TI+YW 
Sbjct: 129 QAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWN 188

Query: 245 TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304
             +NAD                G K Y EAEF FNSCKVLM+AGF IL+IVIN GGAG D
Sbjct: 189 DKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKD 248

Query: 305 GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 364
           GYIGAKYW +PG+F    S+++FK +           G +E  ++  +EQ NPR++ P A
Sbjct: 249 GYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQA 308

Query: 365 AKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFIN 424
           AK  IYRIL I+L ++ L+GF VP+N+ +LMGSG +AT ASPYV+A + HGV+VVPHFIN
Sbjct: 309 AKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFIN 368

Query: 425 AVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFC 484
           AVIL+SV+SVANSA Y+S R++ SL++QGYAP + +Y+DREGRP RA+I+ A+F VI F 
Sbjct: 369 AVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFV 428

Query: 485 ACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGS 544
           + SSKEE+VFTWL AI+GLS+LFTW  I +SH+RFR+ MK+ GRS +EIGF++  G+WGS
Sbjct: 429 SASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGS 488

Query: 545 SYAAIMMTLALIAEFWVSIAPIG-EDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF 603
            Y      L  IA+FWV++AP      +DA++FF++YLA PI +  YFGY + KRD+   
Sbjct: 489 MYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFL 548

Query: 604 IRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           +    IDL  HR+IYD                N   W ++  FWC
Sbjct: 549 VPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNSSVWVRMFHFWC 593

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/569 (47%), Positives = 355/569 (62%), Gaps = 14/569 (2%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
            R+ +DSF+ AED          N+ +   S +    D   A ++   D HL+K +K RH
Sbjct: 53  FRRFVDSFKPAED----------NKHSEVDSDVERNGD---AAYSVNTDTHLKKAMKTRH 99

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    LH  GP  LVIGY ++    Y +IQA GEMAVAY  LPG
Sbjct: 100 VIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPG 159

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFN Y S  V + FGF+  W++C+QWL V+PLEL+TAS+ I+YWT  VNAD         
Sbjct: 160 NFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVF 219

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF FN CK+LM+AGF I +IV+N GGAG+DGYIG KYWH+PGAF 
Sbjct: 220 LLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFA 279

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           G  + +RFK V           G +E   +  +EQ NPR++ P AAK  IYRIL I+L +
Sbjct: 280 GTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLT 339

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VP+N  +LMG+G +AT ASPYV+A + HGVRVVPH INAVIL++V+SVANS+ 
Sbjct: 340 MILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSL 399

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R+L SL++QGYAP +  Y+DREGRP  A++  A+F VIAF ACS +EE VFTWL A
Sbjct: 400 YAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAA 459

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS+LFTW +I +SH+RFR+AMK+QGR ++E+G+ +  G WGS Y  +   L  IA+F
Sbjct: 460 IAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQF 519

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           WV++AP  +  + AQ+FFE+YLA PI I  YFGY I  +D+        IDL  HR+IYD
Sbjct: 520 WVALAP-PKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYD 578

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           NG  W K+  FWC
Sbjct: 579 PEVLKQEDMENKERVRNGNIWTKLKWFWC 607

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/594 (46%), Positives = 364/594 (61%), Gaps = 15/594 (2%)

Query: 58  DSDFEYNGKKKILPSFNIKQPHL-RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSA-T 115
           +++F+ +  +KI      K+  L  +  DSF+RAE              TT + P++  T
Sbjct: 28  ENNFQLSSNEKIYSEQKPKRNRLIHRFTDSFKRAEG------------STTKIKPINENT 75

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
            D +    +   D  L+K++K RHV                    LH  GP  LVIGY +
Sbjct: 76  SDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           +    Y +IQA GEMAV Y  LP NFNAY S  + + FGF+  W+YC QW  V+PLEL+T
Sbjct: 136 VSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELIT 195

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           ASMTIQ+W   +N D                G K Y E EF FN CK+LM+AGF +L++V
Sbjct: 196 ASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVV 255

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           IN GGAGNDGYIG  YWH PGAF GD SI RFK+V           G  E   +   EQ+
Sbjct: 256 INCGGAGNDGYIGGAYWHKPGAFAGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQT 315

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR++ P AAK  IYRI+ I+L ++ L+GF VPYN  +L+G+G +AT ASPYV+A + HG
Sbjct: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHG 375

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           VR+VPH INAVIL+SV+SVANS+ Y+  R++ SL+QQGYAP + +Y+DREGRP RA+I+ 
Sbjct: 376 VRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVC 435

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
            +  VIAF A SSKEE VFTWL AI+GLS+LFTW +I +SH+RFR+AMKVQGRS++E+G+
Sbjct: 436 CVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGY 495

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYK 594
           K+  G+WGS Y +    L  IA+FWV++AP+G     +A+ FFE+YLA PI ++ Y GY 
Sbjct: 496 KATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYM 555

Query: 595 ICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           I  RD+ L      IDL  HR++YD                N  F  K   FWC
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENKEKIKNMSFLSKAHHFWC 609

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/574 (47%), Positives = 361/574 (62%), Gaps = 19/574 (3%)

Query: 76  KQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTI 135
           K   + + +DSFRRAE  +   N D+E+   + ++                   HL+K +
Sbjct: 16  KSNLVHRFVDSFRRAESPELEEN-DLEDGTRSIVT-----------------KTHLKKAM 57

Query: 136 KPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYS 195
           K RHV                    L+ +GP  L+IGY ++    Y +IQA GEMAVAY 
Sbjct: 58  KSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYP 117

Query: 196 GLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXX 255
            LPG+FN+Y S  + + FGF+  W++ +QWL V PLEL+TAS+T++YW   +NAD     
Sbjct: 118 TLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIII 177

Query: 256 XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNP 315
                      G K Y E EF FNSCKVLM+AGF IL+IVIN GGAG DGYIGAKYWH+P
Sbjct: 178 FYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDP 237

Query: 316 GAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFI 375
           G+F     I RFK V           G +E  ++  +EQ NPR++ P+AAK  IYRIL I
Sbjct: 238 GSFADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILII 297

Query: 376 FLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVA 435
           +L ++ L+GF VP+NS ELMG+GSAAT ASPYV+A + H V+VVPHFINAVIL+SV+SVA
Sbjct: 298 YLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVISVA 357

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NSA Y++ R++ SL++QGYAP + NY+DREGRP R +I+ ALF VI F + SSKEE+VFT
Sbjct: 358 NSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFT 417

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL AI+GLS+LFTW  I +SHIRFR+AMK  G+S DEIGFK+  G+WGS Y      L  
Sbjct: 418 WLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVF 477

Query: 556 IAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSH 614
           IA+FWV+++P G     DA+ FF++YLA PI +V YFGY I KRD+ +    + IDL  H
Sbjct: 478 IAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFH 537

Query: 615 RKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           R+IYD                N   W ++  +WC
Sbjct: 538 RRIYDPDFIKQEDEENKERLKNSSIWARIYHWWC 571

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/570 (46%), Positives = 357/570 (62%), Gaps = 18/570 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + + +DSFRRAE      + D+E+           TK       + + ++HL+K++K RH
Sbjct: 52  VHRFVDSFRRAESQRLEEDNDLED----------GTK-------SMKSNNHLKKSMKSRH 94

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    L  AGPG LVIGY ++    Y ++QA GEM V Y  LPG
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPG 154

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  + ++FGF+  W++C+QWL V+PLEL+T+SMT++YW  T+NAD         
Sbjct: 155 NFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVF 214

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF FNSCK+LM+AGF IL++VIN GGAG DGYIG KYW +PG+F 
Sbjct: 215 LLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA 274

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
                 RFK +           G  E   +  +EQSNPR++ P AAK  +YRIL I+L +
Sbjct: 275 EGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLT 334

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VP+N+ +LMGSG +AT ASPYV+A + H VRV+PH INAVIL+SV+SVANSA 
Sbjct: 335 MILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSAL 394

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R++ SL+QQGYAP + NYIDREGRP RA+++ +L  V+ F ACS +EE  FTWL A
Sbjct: 395 YAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAA 454

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS+LFTW  I +SHIRFR+AMKVQGRS+DE+G+K+  G+WGS Y      L  +A+F
Sbjct: 455 IAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQF 514

Query: 560 WVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV+++PIG     DAQ FFE+YLA P+ I +Y GY + KRD+        IDL  HR++Y
Sbjct: 515 WVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVY 574

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N   + +V  FWC
Sbjct: 575 DPEIMRQEDEENKERLKNSSIFVRVYKFWC 604

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/601 (46%), Positives = 365/601 (60%), Gaps = 21/601 (3%)

Query: 52  AAVND---SDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTT 108
           +AVN+   S S+  Y+G+     + N K  H  + +DSF+RAE     T +  EN     
Sbjct: 26  SAVNNLQSSSSEKNYSGQT----TRNNKLIH--RFVDSFKRAEGSTTHTKQINEN----- 74

Query: 109 LSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGG 168
                 T D +   ++   D  L+K++K RHV                    LH  GP  
Sbjct: 75  ------TSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAA 128

Query: 169 LVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCV 228
           LVIGY ++    Y +IQA GEMAV Y  LP NFNAY S  + + FGF+  WVYC QWL V
Sbjct: 129 LVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTV 188

Query: 229 MPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAG 288
           +PLEL+TA+MTI++W  T+N D                G KGY E EF FN CK+LM+AG
Sbjct: 189 LPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAG 248

Query: 289 FFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIA 348
           F IL++VIN GGAGNDGYIG KYW NPGAF GD S  RFK+V           G  E  A
Sbjct: 249 FIILSVVINCGGAGNDGYIGGKYWRNPGAFAGDTSAGRFKNVCYILVTAYFSFGGMELFA 308

Query: 349 IGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYV 408
           +   EQ+NPR+  P AAK  IYRIL I+L ++ L+GF VPYN  +LMG+G +AT ASPYV
Sbjct: 309 LSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYV 368

Query: 409 IAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRP 468
           +A + HGV+VVPH INAVIL+SV+SVANS+ Y+  R++ SL+QQGY P + +Y+DREGRP
Sbjct: 369 LAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRP 428

Query: 469 ARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGR 528
             A+I+ ++F VI F A SSKEE VF WL AI+GLS+LFTW +I +SH+RFR+AMKVQGR
Sbjct: 429 LIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGR 488

Query: 529 SVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGE-DHLDAQNFFENYLAMPILI 587
           S+DE+G+K+  G+WGS+Y      L  IA+FWV++AP+       A++FF++YLA PI I
Sbjct: 489 SLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWI 548

Query: 588 VLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFW 647
             Y GY I  RD+        IDL  HR IYD                +    +K   FW
Sbjct: 549 AFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKRDMSLMRKTYHFW 608

Query: 648 C 648
           C
Sbjct: 609 C 609

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/570 (45%), Positives = 357/570 (62%), Gaps = 18/570 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + + +DSFRRAE      + D+E+                    +   ++HL+K++K RH
Sbjct: 52  VHRFVDSFRRAESQRLEDDNDLED-----------------GTRSMRSNNHLKKSMKSRH 94

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    L  AGPG LVIGY ++    Y ++QA GEM V Y  LPG
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPG 154

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  V ++FGF+  W++C+QWL V+PLEL+T+SMTI+YW  T+NAD         
Sbjct: 155 NFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVF 214

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF FNSCK+LM+AGF IL+++IN GGAG DGYIG +YW NPG+F 
Sbjct: 215 LLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFA 274

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
              S  RFK +           G  E   +  +EQ+NPR++ P AAK  IYRIL I+L +
Sbjct: 275 DGSSATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLT 334

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VP+++ +LMGSGS+AT ASPYV+A + HGV+V+PH INAVIL+SV+SVANSA 
Sbjct: 335 MILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSAL 394

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R++ SL+QQGYAP + NYIDREGRP RA+++ +   ++ F ACSS+EE  FTWL A
Sbjct: 395 YAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAA 454

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS++FTW  I +SHIRFR+AMKVQGRS+DE+G+KS  G+WGS Y  I   L  +A+F
Sbjct: 455 IAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQF 514

Query: 560 WVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV+++P G D   D ++FF++YLA P+ I +Y GY I  +D+ L      IDL  HR++Y
Sbjct: 515 WVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVY 574

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N   + ++   WC
Sbjct: 575 DPEIMRQEDEENKERLRNSSVFFRMYNMWC 604

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/570 (46%), Positives = 353/570 (61%), Gaps = 18/570 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + + +DSFRRAE      N D+E+                      + ++HL+K++K RH
Sbjct: 52  VHRFVDSFRRAESQCLEENNDLED-----------------GTRPMKSNNHLKKSMKSRH 94

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    L  AGPG LVIGY ++    Y ++QA GEM VAY+ LPG
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPG 154

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  + ++FGF+  W++C+QWL V+PLEL+T+SMTI+YW  ++NAD         
Sbjct: 155 NFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSINADVFIVIFYVF 214

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF FNSCK+LM+AGF IL++VIN GGAG DGYIG KYW +PG+F 
Sbjct: 215 LLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA 274

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
              +  RFK +           G  E   +  +EQSN R++ P AAK  +YRIL I+L +
Sbjct: 275 DGSNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLT 334

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VP+N+ +LMGSGSAAT ASPYV+A + H VRV+PH INAVIL+SV+SVANSA 
Sbjct: 335 MILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPHIINAVILISVISVANSAL 394

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R++ SL+QQGYAP + NYIDREGRP RA+ + AL  V+ F ACS +EE  FTWL A
Sbjct: 395 YAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAA 454

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS++FTW  I +SHIRFR+AMKVQGRS+ E+G+K+  G+WGS Y      L  +A+F
Sbjct: 455 IAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQF 514

Query: 560 WVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV+++PIG     D Q FFE YLA P+ I +Y GY +  +D+ L      IDL  HR++Y
Sbjct: 515 WVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVY 574

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N   + ++  FWC
Sbjct: 575 DPEIMRQEDEENKEKLRNSSIFFRMYNFWC 604

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/570 (45%), Positives = 353/570 (61%), Gaps = 18/570 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + + +DSF+RAE      + D+E+                    + + ++ L+K++K RH
Sbjct: 52  VHRFVDSFKRAESQHLEDDNDLED-----------------GTRSMKSNNRLKKSMKSRH 94

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    L  AGPG LVIGY ++    Y ++QA GEM V Y  LPG
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPG 154

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  + ++FGF+  W++C+QWL V+PLEL+T+SMTI+YW   +N+D         
Sbjct: 155 NFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVF 214

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y E EF F+SCK+LM+AGF IL++VIN GGAG DGYIG KYW +PG+F 
Sbjct: 215 LLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA 274

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
                 RFK +           G  E   +  +EQSNPR++ P AAK  +YRIL I+L +
Sbjct: 275 EGNGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLT 334

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VP+N+ +LMGSGSAAT ASPYV+A + H VRVVPH INAVIL+SV+SVANSA 
Sbjct: 335 MILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSAL 394

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R++ SL+QQGYAP + +YIDREGRP RA+ +  L  VI F ACS +EE  FTWL A
Sbjct: 395 YAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAA 454

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS+LFTW  I +SHIRFR+AMKVQGRS+DE+G+K+  G+WGS Y      L  +A+F
Sbjct: 455 IAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQF 514

Query: 560 WVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV+++PIG     +AQ FFE+YLA P+ + +Y GY + +RD+        IDL  HR++Y
Sbjct: 515 WVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVY 574

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N  F+ ++  FWC
Sbjct: 575 DPEIIRQENEENKERLKNSSFFFRIYNFWC 604

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/569 (46%), Positives = 357/569 (62%), Gaps = 31/569 (5%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           +R  IDSFRR  D+D     D E+  T                        ++KTIK RH
Sbjct: 36  MRGFIDSFRRGRDVDLMCKADAEDGTTA----------------------KMKKTIKTRH 73

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                  SAL KAGP GL++GY +  + LY I++A GE+ + YSG+ G
Sbjct: 74  LLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSGMTG 133

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           N+ AY S LVD A GFSV+WVYC+QW+ V PL+LVTA+M IQYWT  +N D         
Sbjct: 134 NYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD-INPDIFVAIIYAV 192

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  GAKGYAEAEFFFN CKVLM+ GF IL +VIN GGAG  GYIG KYWH P  F 
Sbjct: 193 IVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPF- 251

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
               ++ FK +           G  E + + ASEQ NPR++I SA K +IYRI+ I+L +
Sbjct: 252 ----MNGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLT 307

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
             +V FLVP +   L   GS   +ASP VIAV+ HGV++VPH INAVIL++V+SV NS+ 
Sbjct: 308 TVIVCFLVPADHPSLASEGS---RASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSL 364

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           YS+ R+L SL++QGYAP  F YIDR+GRP  A  ++ +F ++AF A S  ++DVF WLLA
Sbjct: 365 YSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLA 424

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           ISGLSQ+F W++IC+SHIRFR AMK QGRS+ E+G+K++ G WGS  A +   L LIA+F
Sbjct: 425 ISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQF 484

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           WV+I+P+    +DA++FF++YLA PIL++ YFGYKI  +DW++ I A ++DL+SHR+++D
Sbjct: 485 WVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFD 544

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           + P W ++  FWC
Sbjct: 545 EDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/574 (45%), Positives = 357/574 (62%), Gaps = 21/574 (3%)

Query: 79  HLRKLIDSFRRAE--DIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136
           + R  IDS++RA+   +    + D+E+ + +  S                 D   +K++ 
Sbjct: 40  YFRNFIDSYKRADPSQLHNARSEDVEDGIASIRS-----------------DTQFKKSLS 82

Query: 137 PRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196
            RHV                    L+  GPG L+IGY ++    Y +IQA GEMAVAY  
Sbjct: 83  SRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPT 142

Query: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXX 256
           LPGNFNAY S  + +++GF+  W++C+QWL V+PLEL+T+S+TI+YW   +NAD      
Sbjct: 143 LPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYWNDKINADIFVMIF 202

Query: 257 XXXXXXXXXXGA-KGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNP 315
                     G  + Y E EF FNSCK+LM+ GF IL+IVIN GGAGNDGYIG KYWH P
Sbjct: 203 YVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEP 262

Query: 316 GAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFI 375
           G+F    +  RFK +           G +E   +  +EQ+ PR+A P+AAK  IYRIL I
Sbjct: 263 GSFAEGDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILII 322

Query: 376 FLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVA 435
           +L ++ L+GF VP+N+ +LMG+G +AT ASPYV+A   HGV++VPHFINAVIL+SV+SVA
Sbjct: 323 YLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAATIHGVKIVPHFINAVILISVISVA 382

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS+ ++  R+L SL+ QGYAP   +Y+DREGRP  A+ +S L  +IAF +C+S EE+VFT
Sbjct: 383 NSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFT 442

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL AI+GLS++FTW  I  SH+RFR AMKVQG+ ++E+G+K+  GVWGS+Y A    L L
Sbjct: 443 WLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVL 502

Query: 556 IAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSH 614
           IA+FWV++APIG     DA+ FFE+YLA PI +  YFGY I  +D+ L      IDL S+
Sbjct: 503 IAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSY 562

Query: 615 RKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           R+IYD                + P + K+  FWC
Sbjct: 563 RRIYDPELIKQEDEENKENLKSRPLYYKIYRFWC 596

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/569 (47%), Positives = 357/569 (62%), Gaps = 18/569 (3%)

Query: 82  KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVX 141
           + ++SF+RAE    P+N D+E+  T                H+      L+++IKPRHV 
Sbjct: 50  RFVNSFKRAEKHSTPSNGDLEHATT----------------HSVASSSPLKRSIKPRHVA 93

Query: 142 XXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNF 201
                             +L   GP GL+IGYA +    Y ++QA GEMAVAY  LPGNF
Sbjct: 94  MMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNF 153

Query: 202 NAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXX 261
           NAY S L+   FGF+  W+YC+QWL V+PLEL+TAS+TI+YW  ++NAD           
Sbjct: 154 NAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFIL 213

Query: 262 XXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD 321
                G++GY E+EF F  CKVLM+ GF IL+IVIN GGAG+  YIGAKYW++PGAF   
Sbjct: 214 FIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG 273

Query: 322 KSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSIT 381
               +FK V           G +E  A+  +EQSNPRRAI S  K  IYRIL I++ ++ 
Sbjct: 274 SGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMI 333

Query: 382 LVGFLVPYNSTELMGS-GSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
           L+GFLVP+ S+ELMGS G +AT ASPYV+AV+ HGV++VPH INAVIL++V+SV NSA Y
Sbjct: 334 LIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMY 393

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
           S  RIL +L++QGYAP +  Y+DR GRP  A+I  ++F ++AF A S  EEDVFTWL AI
Sbjct: 394 SGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAI 453

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           +GLS+LFTW AI +SH+RFR+AM+   R + E+G+K+  GV GS        L  IA+FW
Sbjct: 454 AGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFW 513

Query: 561 VSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           VSIAP G+D  LD  +FF++YLA P+ +VL+FGY I  R+W++    KDIDL  +R IYD
Sbjct: 514 VSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYD 573

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           N  + +K+  FWC
Sbjct: 574 QDRLYQEDLEHKILIQNSSWARKLHNFWC 602

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/643 (42%), Positives = 380/643 (59%), Gaps = 34/643 (5%)

Query: 8   KDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKK 67
             +D +S    S  E  +I   S+    EQ++I+E   +     ++ ++  S F+     
Sbjct: 2   NSNDLLSEVKVSSSEDSQILSKSNDYVHEQNHIIEGDYDDDDKSSSSHNLRSRFD----- 56

Query: 68  KILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEK 127
                  +K  HL+  IDSF+RA+D  +P + D+E   TTT              H E+K
Sbjct: 57  -----VQVKNRHLQGFIDSFKRADD--SPDHNDLEK--TTT-------------AHQEQK 94

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
                KT+K RHV                    L  AGP  LVI Y ++    Y +IQA 
Sbjct: 95  -----KTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAA 149

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GEMAV Y  LPG+FNAY SF + + FGF+  W++C+QWL V+PLEL+TA+MTI+YW T++
Sbjct: 150 GEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
           + D                G + Y E EF FN+CK+LM+ GF I AIV+N GGAG DGYI
Sbjct: 210 DPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYI 269

Query: 308 GAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKT 367
           G KYWH+PGAF       RFK +           G +E   +  ++Q NPR++ P+AAK+
Sbjct: 270 GGKYWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKS 329

Query: 368 MIYRILFIFLTSITLVGFLVPYNSTELMG-SGSAATKASPYVIAVASHGVRVVPHFINAV 426
            +YRI+ I+L ++ L+GF+VP+NS+EL+G SG     ASPYV+A + HG++VVPH INAV
Sbjct: 330 NVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAV 389

Query: 427 ILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCAC 486
           IL++++SVANS+ Y+  R+L SL+QQGYAP + +Y+DR GRP  A+++SAL  VI F A 
Sbjct: 390 ILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAAT 449

Query: 487 SSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSY 546
           S +EE+VFTWL AISGLS+LFTW +I  SHIRFRRAMK+Q +S+D +G+K+  G+WGS +
Sbjct: 450 SPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYF 509

Query: 547 AAIMMTLALIAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIR 605
                 L   A+FWV+++P       DA +FF +YLAMPI +V YFGY    +D+ +   
Sbjct: 510 GVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTD 569

Query: 606 AKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
              +DL +HRK+YD                N  F  K+  FWC
Sbjct: 570 LNQVDLDNHRKVYDPEFLRQEDLENKERLRNSSFLVKIYEFWC 612

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/571 (47%), Positives = 360/571 (63%), Gaps = 18/571 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           L    +SF+RA       ++D+E     ++                  +   ++++K RH
Sbjct: 47  LHNFCNSFKRANSDTFDASQDLEGASINSV----------------RSNSKFKQSMKSRH 90

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                   +LH  GP GL+IGY+++    Y ++QA GEMAVAY  LPG
Sbjct: 91  VVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPG 150

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFN Y S  + ++FGF+  W+YCLQWL V+PLEL+TAS+TI+YW +++N D         
Sbjct: 151 NFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAV 210

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  GA GY EAEF F++CKV M+AGF IL+IVIN GGAG  GYIG +YW NPGAF 
Sbjct: 211 IVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFA 270

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           G   I  FK +           G  E  A+  +EQ+NPR+A+PSA K  IYRIL I++ +
Sbjct: 271 GGSPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLT 330

Query: 380 ITLVGFLVPYNSTELMGS-GSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSA 438
           + L+GFLVPYNS ELMGS G +AT ASPYVIAVASHGV+VVPH INAVIL+SV+SV NSA
Sbjct: 331 MILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSA 390

Query: 439 FYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLL 498
            YS+ R+L SL++QGYAP  F+Y+DR GRP  A++  ++F +++F A S KEE VFTWL 
Sbjct: 391 MYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLA 450

Query: 499 AISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAE 558
           AI+GLS+LFTW AIC+SH+RFR AMK QG S+ E+G+KS+ G WGS YA     +  +A+
Sbjct: 451 AIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQ 510

Query: 559 FWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           FWV++APIG     DA+ FF++YLA PI I  Y GYKI  ++WKL +   +IDL SHR I
Sbjct: 511 FWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHI 570

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           +D                N  +W K+  FWC
Sbjct: 571 FDKHILQQEDDEHKEKLKNSGWWVKMANFWC 601

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/570 (45%), Positives = 352/570 (61%), Gaps = 19/570 (3%)

Query: 80  LRKLIDSFRRAEDIDAP-TNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           + + +DSF+RA+   A   + D+E+   + +S                 + HL+K++K R
Sbjct: 66  VHRFMDSFKRADGQRAGFDDNDLESGTRSFIS-----------------ESHLKKSMKSR 108

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           HV                  S LH +GP  LV+ Y ++    Y +IQA GEMAV Y  LP
Sbjct: 109 HVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLP 168

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXX 258
           GNFN+Y S  V + FGF+  W++ LQWL V+PLEL+T+S+TI+YW   +N+D        
Sbjct: 169 GNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDKINSDVFVVIFYV 228

Query: 259 XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318
                   G + Y E EF FNSCK+LM+AGF I +IV+N GGAG+DGYIG KYWH+PGAF
Sbjct: 229 FLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAF 288

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
               +I RFK +           G +E   +  +EQ NPR++ P AAK  IYRI+ I+L 
Sbjct: 289 TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLL 348

Query: 379 SITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSA 438
           ++ L+GF VP+++ +LMGS  +AT ASPYV+A + HGVR+VPHFINAVIL+SV+SVANS+
Sbjct: 349 TMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVPHFINAVILISVISVANSS 408

Query: 439 FYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLL 498
            Y+S R+L SL+QQGYAP +  YIDR+GRP  A+   +LF VI F A S++EE VFTWL 
Sbjct: 409 LYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLA 468

Query: 499 AISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAE 558
           AI+GLS+LFTW  I +SH+RFR+AMKVQGR ++E+G+K+  GVWGS Y      L   A+
Sbjct: 469 AIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQ 528

Query: 559 FWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           FWV++AP G     A +FFE+YLA PI    YFGY +  +D+   I  + IDL  HR++Y
Sbjct: 529 FWVALAPPGSKP-TALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVY 587

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N   W ++  FWC
Sbjct: 588 DPEFIRQEREEKKIKLKNSSIWTRMYYFWC 617

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/636 (43%), Positives = 374/636 (58%), Gaps = 14/636 (2%)

Query: 22  EMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLR 81
           ++K    +S  +S  ++  +  +    G   A N +D     +    I      K  H  
Sbjct: 4   KVKNYGSSSKKESTAEEFTIPEYSRDDGEKYAGNSNDYSQRDSDNTSIESEPRTKLVH-- 61

Query: 82  KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDD-------HLQKT 134
           + +DSF+RA+D+  PT R    E+       +     + +   E  D        HL+K 
Sbjct: 62  RFVDSFKRAQDV--PTGRK-SKEIGNNGGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKA 118

Query: 135 IKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAY 194
           +K RHV                    LH  GP  LVIGY ++    Y +IQA GEMAV Y
Sbjct: 119 MKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTY 178

Query: 195 SGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXX 254
             LPGNFNAY S  V  AFGF+  W++C+QWL V+PLEL+TAS+TI+YW   +NAD    
Sbjct: 179 PTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDKINADVFIV 238

Query: 255 XXXXXXXXXXXXGAK-GYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWH 313
                       G    Y E EF FN CK+LM+ GF I++IVIN GGAGN  YIG K+WH
Sbjct: 239 IFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWH 298

Query: 314 NPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRIL 373
           +PGAF G  +  RFK +           G +E  A+  +EQSNPRR+ P A+K+ +YRIL
Sbjct: 299 DPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRIL 358

Query: 374 FIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLS 433
            I+L ++ L+GF VPY+S ELMGSG +AT ASPYV+A + +GV++ PHFINAVIL+SV+S
Sbjct: 359 IIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVIS 418

Query: 434 VANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDV 493
           VANS+ Y++ R++ SL+QQGYAP + +Y+DR+GRP  A+I   L  VI F A S KEE+V
Sbjct: 419 VANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEV 478

Query: 494 FTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL 553
           FTWL AI+GLS+LFTW +I +SH+RFR AMK+Q RS++E+G+K+  G++GS Y      L
Sbjct: 479 FTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLL 538

Query: 554 ALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLV 612
              A+FW ++ P G D   +A +FF NYLAMPI +V YFGY +  RD++L      IDL 
Sbjct: 539 VFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLD 598

Query: 613 SHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            HR+IYD                NG F  ++  FWC
Sbjct: 599 FHRRIYDPELMRQEDEESKERLRNGSFMMRMYHFWC 634

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/598 (44%), Positives = 363/598 (60%), Gaps = 20/598 (3%)

Query: 52  AAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSP 111
           A+ ND D     +  + +  S      + R  IDSF+RAE  +        NE +  L  
Sbjct: 29  ASTNDDDISIASSQNRSL--SHRKNTSYYRNFIDSFKRAEHGNL-------NEKSADLED 79

Query: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVI 171
            +A+          +   +++K++K RHV                   +L   GP  L+I
Sbjct: 80  GTASI---------QSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLII 130

Query: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231
           GY I+   +Y +IQA GEMAV Y  LPGNFN Y S  + +++GF+  W++C+QW+ V+PL
Sbjct: 131 GYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPL 190

Query: 232 ELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFI 291
           EL+T+S+TIQYWT  +N D                G K Y E EF FN CK+LM++GF I
Sbjct: 191 ELITSSLTIQYWTD-LNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFII 249

Query: 292 LAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGA 351
            +IV+N GGAGNDGYIG KYWH PG+F       RFK +           G +E   +  
Sbjct: 250 FSIVVNCGGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGICYVLVAGYFSYGGTELYVLSV 309

Query: 352 SEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAV 411
           +EQ+ PR+A P+AAK  IYRIL I+L ++ L+GF VP+NS +LMG+G ++T ASPYV+A 
Sbjct: 310 NEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAA 369

Query: 412 ASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARA 471
           + HGV+VVPH INAVIL+SV+SVANS+ Y+S R+L SL++QGYAP    YIDREGRP  A
Sbjct: 370 SIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVA 429

Query: 472 MIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVD 531
           +++ A+F  IAF A S KEE VFTWL AI+GLS++FTW  I  SH+RFR AMKVQ + +D
Sbjct: 430 LLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDID 489

Query: 532 EIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLY 590
           E+G+K+  G++GS + +I   L LIA+FWV+++P G    + A++FFENYLAMPI +  Y
Sbjct: 490 EVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFY 549

Query: 591 FGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             Y +  ++W +      IDL +HR+IYD                N PFW +V  FWC
Sbjct: 550 IVYSVYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYNFWC 607

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  525 bits (1352), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 264/566 (46%), Positives = 348/566 (61%), Gaps = 18/566 (3%)

Query: 85  DSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXX 144
           DSF+RA+    P   D+E     T                +  D  L+++I+PRHV    
Sbjct: 49  DSFKRAQKRSVPQGGDLETASVQT----------------DLTDGRLRRSIRPRHVAMMS 92

Query: 145 XXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAY 204
                          +L   GPGGL+IGYA +    Y ++QA GEMAVAY  +PGNFNAY
Sbjct: 93  VCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAY 152

Query: 205 PSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXX 264
            S  + + FGF+  W+YCLQWL V PLEL+TAS+TI+YWT +VNAD              
Sbjct: 153 SSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIH 212

Query: 265 XXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSI 324
             G++GY E+EF F  CKVLM+AGF ILAIVIN GGAGN GYIGA+YWH+PGAF      
Sbjct: 213 FFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPA 272

Query: 325 DRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVG 384
            +FK             G +E  A+  +EQS+PRRAI SA K  IYRIL I++ ++ L+G
Sbjct: 273 SKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIG 332

Query: 385 FLVPYNSTELMGSGS-AATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSC 443
           FLVP+ S ELMGSG  +AT ASPYV+AV+ HGV+VVPH +NAVIL++V+SV NSA YS  
Sbjct: 333 FLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGP 392

Query: 444 RILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGL 503
           R+L +L++QGYAP +  YIDR GRP  A+I  ++  ++AF A S  EEDVFTWL AI+GL
Sbjct: 393 RVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGL 452

Query: 504 SQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSI 563
           S+LFTW AI +SHIRFR+AMK  G S+ ++G+KS  G+WGS Y      L  +A+FWV++
Sbjct: 453 SELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVAL 512

Query: 564 APIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXX 622
           APIG +   D  +FF++YLA P+  V + GY +   +W +    KDID+   R +YD   
Sbjct: 513 APIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEER 572

Query: 623 XXXXXXXXXXXXXNGPFWKKVVAFWC 648
                        N  +  ++  FWC
Sbjct: 573 IEQEKLEHKTMLQNSNWLGRLKHFWC 598

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  520 bits (1339), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 262/571 (45%), Positives = 354/571 (61%), Gaps = 18/571 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
            ++  DSF+RA+ ++    ++ + E  T L+               +    L+  IK RH
Sbjct: 35  FQRFKDSFKRADVVEDVHEKEGQEEYATGLN---------------KTQQKLKHNIKTRH 79

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                   ALH  GPGGL+IGY    + LYC++QAC E+ VAY+ LPG
Sbjct: 80  LTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPG 139

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           N+NAYP+FLVD  FGF+VA VY LQW  V+PLELVTASMTI+YWT +VN D         
Sbjct: 140 NYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLF 199

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G++GYAE+EF FN+ KVL+MAGF I+ I +N G A   GYIGAKYW NPG F 
Sbjct: 200 IVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCG-ASKLGYIGAKYWSNPGTFA 258

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           G++SI+  K + S         G SEFIA+ A+EQ+NPR ++PSA K  +YR++ +FL  
Sbjct: 259 GERSINHLKGICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIP 318

Query: 380 ITLVGFLVPYNSTELMGSGSAATKAS-PYVIAVASHGVRVVPHFINAVILLSVLSVANSA 438
           I L+ FLVPY S +L+ S  A+   + P+VIA A HGV++VPH INA+IL SV+SV NS 
Sbjct: 319 IALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSG 378

Query: 439 FYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLL 498
            YS+ RIL SL++ G  P  F Y+DR GRP   ++   +F +++F A S  +E VFTWL 
Sbjct: 379 MYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLT 438

Query: 499 AISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAE 558
           AI+GLSQLFTW +I +SHIRFR AMKVQGRS+ E+G+ S  G  GS YA     + L+A+
Sbjct: 439 AIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQ 498

Query: 559 FWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           FW++IAPI +   LDA++FF+NYLA  +L++ Y GYKI  R+ +L I    IDL +HR+I
Sbjct: 499 FWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQI 558

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           +D                   F ++ +AFWC
Sbjct: 559 FDEEVLQQEELERKERMKTASFKQRFIAFWC 589

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  518 bits (1333), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 247/570 (43%), Positives = 349/570 (61%), Gaps = 22/570 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIEN-ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
            R+ +DSFRR    D   + D+E+ E+ +T      TK              LQ+ ++ R
Sbjct: 32  FRRFVDSFRRE---DTSRSGDLEDGEINST----DTTK--------------LQQRMRTR 70

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           HV                  ++LH  GP GL+IGY ++    Y ++ A GEMAVAY  LP
Sbjct: 71  HVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLP 130

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXX 258
           GNFNAY S  + + FGF+  W++CLQWL V PLEL+TA++ I+YW  +VNA+        
Sbjct: 131 GNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYL 190

Query: 259 XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318
                   GA+GY E EF FN CKVLM+ GF I+ I+IN G  G+ GYIG +YW NPG+F
Sbjct: 191 FIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF 250

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
                +D+ K             G  E  A+  +E  NP+ AIPSA K  +YRIL ++L 
Sbjct: 251 VSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLL 310

Query: 379 SITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSA 438
           ++ ++GFLVP++S  LMGSGS     SPYV+A+  HGV+V+PH +NAVIL+SV+SV NSA
Sbjct: 311 TMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSA 370

Query: 439 FYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLL 498
            YS+ R+L +L+QQGYAP   +YIDREGRP  ++I+ A+F +IAF A S  +E +F WL 
Sbjct: 371 MYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLA 430

Query: 499 AISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAE 558
           AI+GLS+LFTW +IC+SH RFR+AMK+QGRS++ +G+++  G WGS YA     L  IA+
Sbjct: 431 AIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQ 490

Query: 559 FWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           FWV++ PI +  +D  +FF+NY+A P+ ++++ GY +  R+W L      +DL +HR++Y
Sbjct: 491 FWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVY 550

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                N P++ KV+ FWC
Sbjct: 551 DVEVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  514 bits (1324), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 327/524 (62%), Gaps = 1/524 (0%)

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
           E  D HL+K +K RHV                    L   GPG LVIGY ++    Y +I
Sbjct: 60  ESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMI 119

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           QA GEMAV Y  LPG+FN Y S  + +  GF+  W++ +QWL V+PLEL+T +MTIQYW 
Sbjct: 120 QAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWN 179

Query: 245 TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304
            ++NAD                G K Y E EF FN+CK+L + GF I +IV+N GGAG D
Sbjct: 180 DSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTD 239

Query: 305 GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 364
           GYIGAKYW NPG+F    S  RFKDV           G +E   +  +EQ+NPRR+ P A
Sbjct: 240 GYIGAKYWKNPGSFASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKA 299

Query: 365 AKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFIN 424
           AK  IYRIL I+L ++ L+GF VP+++ +LMG+G ++T ASPYV+A + HGV+VVPH IN
Sbjct: 300 AKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHIIN 359

Query: 425 AVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFC 484
           AVIL+ V S+ NS+ Y++ R+  SL++QGYAP    YIDREGRP  A+   A+  VIAF 
Sbjct: 360 AVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFA 419

Query: 485 ACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGS 544
           A SS+EE VFTWL AI+ LS+LFTW  I +SHIRFR AMKVQG+ ++E+G+K+  GVWGS
Sbjct: 420 AASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGS 479

Query: 545 SYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFI 604
            +      L  IA+FWV+++P G   + A+ FFE+YLA P+ +  YF Y + KRD+    
Sbjct: 480 MWGFGFCVLVFIAQFWVALSPPG-GTISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLT 538

Query: 605 RAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           + +DIDL +HR+IYD                N  FW K+  FWC
Sbjct: 539 KLEDIDLDAHRRIYDPEFLRQEDEERKEKIRNSSFWIKMKYFWC 582

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  511 bits (1316), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 269/630 (42%), Positives = 366/630 (58%), Gaps = 27/630 (4%)

Query: 28  KNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYN---GKKKILPSFNIKQP-----H 79
           KNSD    E   I +   ++  +   ++ S ++   N   G  + + SF+  Q       
Sbjct: 4   KNSDINISETSLINKATSSSNNLTERIHTSTTNDYINEKLGSVEEVSSFDYVQEAAKTGR 63

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
            R+  DSF+RAE       +  E E   + S  +  +  +           L+K +K RH
Sbjct: 64  FRRWADSFKRAE-------KSTEAEDGESGSIYNGNESTE-----------LKKAMKSRH 105

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                    L  +GP  LVIGY ++    Y +IQA GE+ V Y+ LPG
Sbjct: 106 VVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQAAGELGVTYASLPG 165

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFN Y   LV   FGF+  W+  +QWL V+PLEL+T ++TI+YWT  VN D         
Sbjct: 166 NFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELITCAITIKYWTEKVNGDIFVLIIYVF 225

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G K Y EAEF FN+CK+LM+AGF IL+IVIN GGAGNDGYIG  YW+NPGAF 
Sbjct: 226 LLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSIVINVGGAGNDGYIGGSYWNNPGAFA 285

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
            D +  RFK +           G +E   +  +EQ NPR++ P AAK  IYRIL I+L +
Sbjct: 286 SDNAASRFKSICYILVTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRILVIYLLT 345

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + L+GF VP++S +LMGS  ++  ASPYV+A + HGV+VVPHFINAVIL++++SVANS+ 
Sbjct: 346 MILIGFNVPHDSDQLMGSAGSSAHASPYVLAASLHGVKVVPHFINAVILIALISVANSSL 405

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R++ SL+QQG+AP +  Y+DREGRP   + + A+F VI F A S KEEDVFTWL A
Sbjct: 406 YAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAVCAVFGVIGFAASSDKEEDVFTWLAA 465

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           I+GLS+LFTW A  +SHIRFR+AMKVQG+++ E G+ S  G+WGS        L  IA+F
Sbjct: 466 IAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECGYLSVTGIWGSIIGLCFNILVFIAQF 525

Query: 560 WVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV+++PIG D   DAQ FF++YLA PI +  YFG     +D+ L    + IDL  HR+IY
Sbjct: 526 WVALSPIGNDGKCDAQAFFQSYLAFPIWLAFYFGCMFYYKDYTLLNPLESIDLDDHRRIY 585

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                   F  ++VAF+C
Sbjct: 586 DPEELKKEDLATKAELKRRGFHAQLVAFFC 615

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  509 bits (1310), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 242/541 (44%), Positives = 340/541 (62%), Gaps = 19/541 (3%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
            ++++DSF+R E  +   + D+E+   T+                      L++ +K RH
Sbjct: 38  FQRIVDSFKRVEG-EVRNSSDLEDGEVTS-----------------AHSTKLKQNMKTRH 79

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           V                  S+LH  GPGGL+IGY  +    Y ++QA GEMAVAY  LPG
Sbjct: 80  VVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPG 139

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           NFNAY S  + + FGF+  W++C+QW  ++PLEL+T+S+ ++YWTT +NAD         
Sbjct: 140 NFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLF 199

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  GA+GY E EF FNSCKVLM+AGF I+ I+IN G  G+DGYIG KYWH PGAF 
Sbjct: 200 ILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFA 259

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
               IDRFK +           G  E  A+  +E  NPR+AIPSA    +YRIL I++ +
Sbjct: 260 AGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLT 319

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + ++GFLVP++S +L+GSGS+    SPYV+A++ HG+++VPH INAVIL+SV+SV NSA 
Sbjct: 320 MVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAM 379

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           YS  R+L SL+QQGYAP   +Y+DR+GRP  A+I+ ++F +IAF A S  EED+F WL A
Sbjct: 380 YSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAA 439

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           ISGLS+LFTW AIC+SH RFRRAMK+QGRS++ +G++S  G WGS YA +     LIA+ 
Sbjct: 440 ISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQL 499

Query: 560 WVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           WV++ P+        ++ F++ LA+P+ + +  GY I  ++W +      I + SHR+ Y
Sbjct: 500 WVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSY 559

Query: 619 D 619
           D
Sbjct: 560 D 560

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  508 bits (1307), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 268/554 (48%), Positives = 356/554 (64%), Gaps = 36/554 (6%)

Query: 71  PSFNIKQPHLR----KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEE 126
           P    ++P LR    K  DSF+R      P++++ E E                   ++E
Sbjct: 50  PQKTDRKPKLRNEFRKFFDSFKR----QLPSDQNSELE-------------------SQE 86

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
           K++ L+K+IK RH+                    L  AGP GLV+GY I    LYCIIQA
Sbjct: 87  KNN-LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GE+ + Y+GL GN+  Y S LVD + GF+V+ VY +QWL V+PL+LVTA+MT++YWT  
Sbjct: 146 AGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN- 204

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           VNAD                G++GYAEAEF FN CK+LM+AGF ILAIVIN GGAG+  Y
Sbjct: 205 VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRY 264

Query: 307 IGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 366
           IG +YWHNPG F        FK V +         G  E + + A+EQ NP  +IP+A K
Sbjct: 265 IGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNACK 319

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAAT-KASPYVIAVASHGVRVVPHFINA 425
            ++YRIL I++ +  L+GFLVPYNS EL+GSGS++   ASP+VIAV+SHGV+VVPHFINA
Sbjct: 320 KVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFINA 379

Query: 426 VILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCA 485
           VIL+SV+SVANS+ YS  R+L SL++QG  P    Y+DR GRP    ++S  F  I F A
Sbjct: 380 VILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFVA 439

Query: 486 CSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSS 545
            S+ EE VFTWLLAIS LSQLF W+++C+SHIRFR AM  QGRS+DE+G+K+Q G WGS 
Sbjct: 440 TSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSW 499

Query: 546 YAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFI 604
            A ++    L+ +FWV+IAP+ E   LD + FF+NYLAMPI+++ YFG+K+  + W+ +I
Sbjct: 500 IAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFWI 559

Query: 605 RAKDIDLVSHRKIY 618
            A+ IDL SHR +Y
Sbjct: 560 PAEKIDLDSHRNVY 573

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  506 bits (1304), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 257/522 (49%), Positives = 341/522 (65%), Gaps = 11/522 (2%)

Query: 101 IENELTTTLSPLSATKDP-QFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXS 159
           ++NE    LS       P Q +    ++ ++L K+IK RH+                   
Sbjct: 59  LQNECKKILSSFKRQLPPSQNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQ 118

Query: 160 ALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAW 219
            L  AGP GLV+GY +    LYCIIQA GE+ + Y+GL GN+  YPS LVD + GF+V+ 
Sbjct: 119 VLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSV 178

Query: 220 VYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 279
           VY +QWL V+PL+LVTA+MT++YWT+ VN+D                G++GYAEAEF FN
Sbjct: 179 VYTIQWLTVLPLQLVTAAMTVKYWTS-VNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFN 237

Query: 280 SCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXX 339
            CK+LM+ GF ILAI+IN GGAG+  YIG +YWHNPG F        FK V +       
Sbjct: 238 ICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAF 292

Query: 340 XXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG- 398
             G  E + + A+EQ NP ++IP+A K ++YRIL I++ +  LV FLVPYNS EL+GS  
Sbjct: 293 SYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDD 352

Query: 399 SAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSW 458
           S+ + ASP+VIAVASHGV+VVPHFINAVIL+SV+SVANS+ YS  R+L SL++QG  P  
Sbjct: 353 SSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKC 412

Query: 459 FNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIR 518
             Y+DR GRP    ++S  F  I F A S  EE+VFTWLLAIS LSQLF W+++ +SHIR
Sbjct: 413 LAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIR 472

Query: 519 FRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDH--LDAQNF 576
           FR AM  QGRS++E+G+K+Q G WGS  A ++    L+ +FWV+IAP+  DH  L+ + F
Sbjct: 473 FRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFFLVCQFWVAIAPV-NDHGKLNVKVF 531

Query: 577 FENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           F+NYLAMPI++V YFG+KI  + W  +I A  IDL SHR I+
Sbjct: 532 FQNYLAMPIVLVAYFGHKIYFKSWSFWIPADKIDLNSHRNIF 573

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  506 bits (1303), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 274/589 (46%), Positives = 360/589 (61%), Gaps = 47/589 (7%)

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136
           Q   +K  DSF+R   + A  N ++E++                      + ++L ++IK
Sbjct: 60  QNECKKFFDSFKR--QLPADQNSELESQ----------------------ERNNLTRSIK 95

Query: 137 PRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196
            RH+                    L  AGP GLV+GY I    LYCIIQA GE+ + Y+G
Sbjct: 96  SRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAG 155

Query: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXX 256
           L GN+  Y S LVD + GF+V+ VY +QWL V+PL+LVTA+MTI+YWT  VNAD      
Sbjct: 156 LTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWTN-VNADIFVAAV 214

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316
                     G+KGYAEAEF FN CK+LM+ GF ILAIVIN GGAG+  +IG KYWHNPG
Sbjct: 215 FIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKFIGTKYWHNPG 274

Query: 317 AFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIF 376
            F        FK V +         G  E + + A+EQ NP ++IP+A K ++YRILFI+
Sbjct: 275 PFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILFIY 329

Query: 377 LTSITLVGFLVPYNSTELMGSGSAAT-KASPYVIAVASHGVRVVPHFINAVILLSVLSVA 435
           + +  L+ FLVPYNS EL+GSGS++   ASP+VIAVASHGV+VVPHFINAVIL+SV+SVA
Sbjct: 330 MLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVA 389

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS+ YS+ R+L SL++QG+ P    Y+DR GRP    ++S +F  I F A S  EE VFT
Sbjct: 390 NSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGCIGFVATSDAEEQVFT 449

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WLLAIS LSQLF W+++ +SHIRFR AM  QGRS+DE+G+K+Q G WGS  A ++    L
Sbjct: 450 WLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIALFFL 509

Query: 556 IAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSH 614
           + +FWV+IAP+ +   LDA  FF+NYLAMPI++  YFG+KI  + WK +I A+ IDL SH
Sbjct: 510 VCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHKIYTKSWKFWIPAEKIDLDSH 569

Query: 615 RKIY-----------DGXXXXXXXXXXXXXXXNG----PFWKKVVAFWC 648
           R IY           D                NG     F+K++  FWC
Sbjct: 570 RTIYVPPILMGTNKIDDDDLKEYETSESSENPNGSGSRKFFKRMANFWC 618

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  505 bits (1300), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 263/642 (40%), Positives = 369/642 (57%), Gaps = 56/642 (8%)

Query: 27  TKNSDAKSPEQDNIVEYFENTTGIPAA---VNDSDSDFEYNGKKKILPSFNIKQPHLRKL 83
           ++ S  K P+Q  I++   N + I  A     D+ SD      ++  P       + +  
Sbjct: 8   SRGSVEKEPDQFEILDQDTNVSDINLAERYARDTQSD------ERSKPRHRNVHSYYQNW 61

Query: 84  IDSFRRAEDIDAPTNRDIENELTTTL-----------------SPLSATKDPQFAPHAEE 126
           IDSF+RAE +     R  + +++TT                     S   D  +  ++ E
Sbjct: 62  IDSFKRAEPVGERRRRRAQQDISTTNINNMNKGDESDFYMGNGGEPSTNIDTAYDMNSNE 121

Query: 127 KDDHLQKT----------------------------IKPRHVXXXXXXXXXXXXXXXXXX 158
            D + +K                             +K RHV                  
Sbjct: 122 VDPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANA 181

Query: 159 SALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVA 218
            +LH +GP GLV+GY ++    Y ++QA GEMA+AY  LPG FN Y S  + + FGF+  
Sbjct: 182 KSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATV 241

Query: 219 WVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFF 278
           W++ L WL ++PLEL+T+S+T++YWTT++N D                G + YAEAEFFF
Sbjct: 242 WIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFF 301

Query: 279 NSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXX 338
           NSCK+LM+ GF I +IV+N GGAG+DGYIG KYWH+PG F  D    RFK+V        
Sbjct: 302 NSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPFASDNGAARFKEVCYVLINAY 361

Query: 339 XXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG 398
              G +E   +  +EQ NPR+A+P AAKT +YR+  I+L ++ L+GF VPYNS +LMG+ 
Sbjct: 362 FSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNA 421

Query: 399 SAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSW 458
           ++   ASPYV+A   HGV++VPHFINAVILLSV+SVANSA ++  R+L +L++QG+AP +
Sbjct: 422 NS-KDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKF 480

Query: 459 FNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIR 518
             Y+DR GRP  A+ + +LF VIAF A S KE++VFTWL AI+GLS+LF W  I +SHIR
Sbjct: 481 LTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIR 540

Query: 519 FRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSI-APIGEDHLDAQNFF 577
           FR AMK  G+S+DE+G+K+  G+WGS Y      L LIA+FWV++ AP     + A +FF
Sbjct: 541 FRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFF 600

Query: 578 ENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           E+YLA  I +  Y  Y I  +DW + I  KDID+   R+IYD
Sbjct: 601 ESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIYD 642

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 273/614 (44%), Positives = 368/614 (59%), Gaps = 49/614 (7%)

Query: 11  DRISF----STESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGK 66
           D +SF    ++ ++Y      +    K      I E  +  +G  A    +DS       
Sbjct: 3   DSVSFIAKEASPAQYSHSLHERTHSEKQKRDFTITEKQDEVSGQTAEPRRTDSK------ 56

Query: 67  KKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEE 126
                  +I Q   ++  DSF+R      P +R+ E E                   ++E
Sbjct: 57  -------SILQRKCKEFFDSFKR----QLPPDRNSELE-------------------SQE 86

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
           K++ L K+IK RH+                    L  AGP GLV+GY I    LYCIIQA
Sbjct: 87  KNN-LTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GE+ + Y+GL GN+  YPS LVD + GF+V+ VY +QWL V+PL+LVTA+MT++YWT+ 
Sbjct: 146 AGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS- 204

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           VNAD                G++GYAEAEF FNSCK+LM+ GF ILAI+IN GGAG+  Y
Sbjct: 205 VNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRY 264

Query: 307 IGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 366
           IGA+YWHNPG F        FK V +         G  E + + A+EQ NP ++IP+A K
Sbjct: 265 IGAEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACK 319

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS-PYVIAVASHGVRVVPHFINA 425
            ++YRIL I++ +  LV FLVPYNS EL+GS  ++   + P+VIAVASHGV+VVPHFINA
Sbjct: 320 KVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINA 379

Query: 426 VILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCA 485
           VIL+SV+SVANS+ YS  R+L SL++QG  P    Y+DR GRP     +S +F  I F A
Sbjct: 380 VILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVA 439

Query: 486 CSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSS 545
            S  EE VFTWLLAIS LSQLF W+++ +SHIRFR AM  QGRS++E+G+K+Q G WGS 
Sbjct: 440 TSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSW 499

Query: 546 YAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFI 604
            A ++    L+ +FWV+IAP+ E   L+ + FF+NYLAMPI++  YFG+KI  + W  +I
Sbjct: 500 LAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWI 559

Query: 605 RAKDIDLVSHRKIY 618
            A+ IDL SHR I+
Sbjct: 560 PAEKIDLDSHRNIF 573

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  498 bits (1282), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 262/605 (43%), Positives = 362/605 (59%), Gaps = 32/605 (5%)

Query: 26  ITKNSDAKSPEQ--DNIVEYFENTTG--IPA-AVNDSD----SDFEYNGKKKILPSFNIK 76
           + ++S   S E+  D IV     TTG   P+   NDS     +D + + +  +  S   +
Sbjct: 1   MKRHSIVSSEEKISDVIVSESTTTTGSNFPSNQRNDSGFKSFNDIDTSERTSVESSEVYR 60

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDD-HLQKTI 135
              +R+ IDS++RAE    P               +   +D       E KD  HL+K +
Sbjct: 61  SGRIRRWIDSYKRAEH---PREH------------IDGFED------GESKDGIHLKKQM 99

Query: 136 KPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYS 195
           K RHV                    LH AGP  LVIGY ++    Y +IQA GE+AVAY 
Sbjct: 100 KTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTYFMIQAAGELAVAYP 159

Query: 196 GLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXX 255
            LPGNFN+Y   L+ + FGF+  W+  +QWL V+PLE + AS+TI+YW   ++ D     
Sbjct: 160 TLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIKYWNDRISGDVFVVI 219

Query: 256 XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNP 315
                      G + Y E EF FN CKVLM+ GF IL+IVIN GGAGNDGYIG KYW++P
Sbjct: 220 FYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAGGAGNDGYIGGKYWNDP 279

Query: 316 GAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFI 375
           GAF G+ +  RFK V           G +E   +  +EQ NPR++ P AAK  IYRI+ I
Sbjct: 280 GAFAGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRIVII 339

Query: 376 FLTSITLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHGVRVVPHFINAVILLSVLSV 434
           +L ++ L+GF VPYN   LMG+  A+ + ASPYV+A + HGV++VPHFINAV+L++++SV
Sbjct: 340 YLLTMILIGFNVPYNDPRLMGADDASGSHASPYVLAASIHGVKIVPHFINAVVLIALISV 399

Query: 435 ANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVF 494
            NSA Y++ R++ SL++QG+AP    Y+DREGRP  ++ + ALF +I F A SSKEE VF
Sbjct: 400 GNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSLGICALFGLIGFAASSSKEEQVF 459

Query: 495 TWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLA 554
           TWL AI+GLS+LFTW A  +SHIRFR AMK+QG+ + E+GF +  G++GS Y      L 
Sbjct: 460 TWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILV 519

Query: 555 LIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSH 614
             A+FWV+++PIG   + A++FFE+YLA PI +  YFGY +  +D+      + IDL  H
Sbjct: 520 FAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDLDFH 579

Query: 615 RKIYD 619
           R+IYD
Sbjct: 580 RRIYD 584

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  499 bits (1285), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 257/578 (44%), Positives = 345/578 (59%), Gaps = 19/578 (3%)

Query: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKT 134
           IK   ++  IDSF+  E+        +E+EL      L++  +     H E+    L+KT
Sbjct: 102 IKNKRIKNWIDSFKPPEEC-------MESELE-----LNSIDENG---HREKPRAQLKKT 146

Query: 135 IKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAY 194
           +K RHV                  S L  +GP  LVIGY ++    Y +IQA GEM VAY
Sbjct: 147 MKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEMGVAY 206

Query: 195 SGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXX 254
             LPGNFN Y S  +    GF+  W+  +QWL V+PLEL+ ASMTI+YWTT+++ D    
Sbjct: 207 PTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTSISPDVFVV 266

Query: 255 XXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHN 314
                       G   Y E EF FN CK+LM+ GF IL+IVIN GGAG+DGYIG KYWH 
Sbjct: 267 IFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGKYWHT 326

Query: 315 PGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILF 374
           PGAF G  S  RFKDV           G +E   +  +EQ NPR++ P+AAKT IYRIL 
Sbjct: 327 PGAFVGKNSASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTTIYRILI 386

Query: 375 IFLTSITLVGFLVPYNSTELMGSGSA---ATKASPYVIAVASHGVRVVPHFINAVILLSV 431
           ++L ++ L+GF VPY++  L  + S+   +   SPYV+A + HGV+VVPHFINAV+L+++
Sbjct: 387 VYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINAVVLIAL 446

Query: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491
           +SVANSA Y++ R++ SL+QQG AP +  YIDREGRP   +++ +L  VI F A S KE+
Sbjct: 447 ISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAAASDKEQ 506

Query: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551
           +VF WL AI+GL+ LF W    +SHIRFR AMKVQG+ ++E+G+K+  G+WGS   A   
Sbjct: 507 EVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIGACFN 566

Query: 552 TLALIAEFWVSIAPIGE-DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDID 610
            L LIA FWVS+ P G+  ++ A+NFFE  LA+PI I    GY + K+DW ++   + ID
Sbjct: 567 VLVLIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPIESID 626

Query: 611 LVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           L   RKIYD                N  FW +  AFWC
Sbjct: 627 LDYCRKIYDPEQLKREDEENRERIRNAGFWARCRAFWC 664

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  497 bits (1280), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 251/519 (48%), Positives = 332/519 (63%), Gaps = 15/519 (2%)

Query: 99  RDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXX 158
           R++   +  +        D +FA    E +  L KT+KPRH+                  
Sbjct: 78  RNVFVRIVDSFKRQKVRNDGEFA----ETETQLNKTMKPRHIVMISLGTGIGTGLLVGNG 133

Query: 159 SALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVA 218
             L K+GP GLVIGY +    +YC++QA GE+ + YS L GN+  YP++L+D A GF+V+
Sbjct: 134 QVLSKSGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVS 193

Query: 219 WVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFF 278
            +Y LQWL V+PL+LVTA+MTI+YWTT VN D                GAKGYAEAEFF 
Sbjct: 194 MLYTLQWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFC 253

Query: 279 NSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXX 338
           N CK+LMMAGF IL IVIN GGAG+  YIG KYW  PGAF      + FK V +      
Sbjct: 254 NCCKLLMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFA-----NGFKGVAAVFCYAA 308

Query: 339 XXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG 398
              G  E + + A+EQ+NPR+AIP A + ++YR+LF+++ +  +V FLVPYNS  L+GS 
Sbjct: 309 FSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSN 368

Query: 399 S--AATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAP 456
           +  + + ASP+VIAVASHGV+VVPH INA IL+SV+SVANS+ YS  R+L SLSQQGYAP
Sbjct: 369 NDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAP 428

Query: 457 SWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSH 516
             FNYIDR GRP   +++S    +IAF A     E+VFTWLLA+SGLSQ+F W++I +SH
Sbjct: 429 KCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISH 488

Query: 517 IRFRRAMKVQ---GRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLD 572
           +RFR A++ Q    R+ D + + +Q G  GS  A  +    L+ +FWV+IAP+G +  LD
Sbjct: 489 LRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLD 548

Query: 573 AQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDL 611
            Q FFENYLA P+L+  Y  YKI  RDW+L I A +IDL
Sbjct: 549 VQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  492 bits (1267), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 261/523 (49%), Positives = 343/523 (65%), Gaps = 8/523 (1%)

Query: 98  NRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXX 157
           +  + + +T +    S   D +   + E+ ++ L ++IK RH+                 
Sbjct: 59  DTQVTSGITNSFESESLRDDSKPLENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGN 118

Query: 158 XSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSV 217
              L K+GP GLVIGY +    +Y I+QA GE+ + YSGL GN+  YPS LVD A GF++
Sbjct: 119 GQVLAKSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAI 178

Query: 218 AWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFF 277
           + +Y LQWL VMPL+LVTA+MTI YWT  +N +                GAKGY EAEF 
Sbjct: 179 SIIYTLQWLTVMPLQLVTAAMTIGYWTN-INPNIFVAIVLVIVVLTNCFGAKGYVEAEFL 237

Query: 278 FNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXX 337
            N  KVLMM GF +LAI+INTG  G DGYIG  YW NPGAF      + FK V S     
Sbjct: 238 CNIFKVLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPGAFA-----NGFKGVCSVFCYA 292

Query: 338 XXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGS 397
               G  E +A+ A+EQ NP +AIPSA K  +YRILF+++ +  L+GFLVPY+S +LMGS
Sbjct: 293 AFSYGGIEVLALTAAEQENPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGS 352

Query: 398 GSAATKAS-PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAP 456
            S     S P+VIA+ASHGV+VVPH INAVIL+S++SVANSAFYSS R+L SLS+QG  P
Sbjct: 353 TSGGGSHSSPFVIAIASHGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIP 412

Query: 457 SWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSH 516
             FNY+D+EGRP   ++ ++LF  I F A S  +E+VFTWLLAISGLSQ+F W++IC+SH
Sbjct: 413 KIFNYVDKEGRPWYCILFASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSH 472

Query: 517 IRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLDAQN 575
           IRFRRAM  QG+S+DEIG+K+  G WGS  A  +   +LI++FWV+IAPIG+D  LD   
Sbjct: 473 IRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLV 532

Query: 576 FFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           FF+NYLA PI+++ Y GYK   +DW+L+I +  IDL   R+IY
Sbjct: 533 FFQNYLAAPIVLIAYLGYKTYYKDWRLYIPSDKIDLSYGREIY 575

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  488 bits (1257), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 329/520 (63%), Gaps = 8/520 (1%)

Query: 102 ENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSAL 161
           + +L    S L + K  +        ++ L K I+ RH+                  S L
Sbjct: 55  QPQLGVVASFLDSFKRKEHDDSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVL 114

Query: 162 HKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVY 221
            ++GP GL+IGY +    ++ IIQA GE+ + YS + GNF  YP+ LVD AFGF+++++Y
Sbjct: 115 SQSGPLGLIIGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLY 174

Query: 222 CLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSC 281
            +QW+ V+PL+LVTA+MTIQ+W   VN D                GA+GY EAEFF N C
Sbjct: 175 TIQWMIVLPLQLVTAAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLC 234

Query: 282 KVLMMAGFFILAIVINTGGA--GNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXX 339
           K++M+ GF IL I+I  GG   G DGYIG KYW NPG F      + FK V S       
Sbjct: 235 KIVMLTGFVILGIIITAGGIPNGPDGYIGGKYWRNPGLFA-----NGFKGVCSVFCYAAF 289

Query: 340 XXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGS 399
             G  E + + A+EQ NP ++IPSA K ++YRILFI+L S+ +V FLVPY S +LMGS  
Sbjct: 290 SYGGVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSG 349

Query: 400 AATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
           + + +SP+VIA+ASHGV VVPH INAVIL+SVLSVANSA Y + R+L SL+Q G AP + 
Sbjct: 350 SGSHSSPFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFL 409

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
           NYID+ GRP    ++  LF +I F A S K E VFTWLL+ISGL Q+F WI+ICVSHIRF
Sbjct: 410 NYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRF 469

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG-EDHLDAQNFFE 578
           R AM+VQG  + EI +K+Q G WGS  A  +    L+ +FWV+IAP+G    LDA NFF+
Sbjct: 470 RDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQ 529

Query: 579 NYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           NYLA P+++  Y G+K+  + W+L I A  I+L ++R +Y
Sbjct: 530 NYLAFPVVLCAYLGFKVYYKQWQLLIPADKIELDNNRNVY 569

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  478 bits (1229), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 260/505 (51%), Positives = 331/505 (65%), Gaps = 9/505 (1%)

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
           KD       E +D  L KTIK RH+                    L KAGP GL+IGY +
Sbjct: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
               +YCII A GE+ + Y GL GNF  YPS L+D + GF+++ +Y LQWL V+PL+LVT
Sbjct: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           A++TI +WT  VN D                GA+GYAE EFF N CK+LM+ GF IL+IV
Sbjct: 206 AAITISFWTD-VNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIILSIV 264

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           I TGGAG DGYIGAKYW +PG F        FK V +         G  E + +   EQ 
Sbjct: 265 IITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQE 319

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           +P  A+P+A K ++YRIL I+L +  LV FLVPY+S  L+GS  + + ASP+VIA+ SHG
Sbjct: 320 DPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHG 379

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           V+VVPHFINAVIL+SV+SVANS+ YSS R+L SLS+QG  P W N+ID  GRP R  I+S
Sbjct: 380 VKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIIS 439

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
            LF +I F A S K EDVFTWLLAISGLSQLF W+++ +SHIR R AMK QG+S+DEIG+
Sbjct: 440 ILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGY 499

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDH--LDAQNFFENYLAMPILIVLYFGY 593
           K+Q G WGS  A  +   +L+ +FWV+IAP+ E H  LD  NFF+NYLA PI++V Y G+
Sbjct: 500 KAQTGYWGSWLAVFIGFFSLVTQFWVAIAPV-EKHGELDVVNFFQNYLAFPIVLVAYLGH 558

Query: 594 KICKRDWKLFIRAKDIDLVSHRKIY 618
           KI  ++W+L+I A  IDL SHR+IY
Sbjct: 559 KIYYKNWRLWIPADKIDLDSHRRIY 583

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  475 bits (1222), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 268/572 (46%), Positives = 357/572 (62%), Gaps = 21/572 (3%)

Query: 55  NDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELT---TTLSP 111
           N  D  F+ N ++ +    +I++     L       E  +A T +   N +T     L+ 
Sbjct: 18  NQEDDSFKENAEETV-KHISIEEASNETL------NEKPEAHTQKCEYNPITHFKNFLNG 70

Query: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVI 171
               K  +     E +D  L KTIK RH+                    L KAGPGGLVI
Sbjct: 71  FKRQKQNEEGADLEMQDTQLSKTIKARHLLMISLGTGIATGLLVGNGQVLSKAGPGGLVI 130

Query: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231
           GY I    +YC+IQ+ GE+ + Y GL GNF  Y S L+D + GF+++ +Y  QWL V+PL
Sbjct: 131 GYFISSVMIYCMIQSAGELGICYRGLVGNFTRYSSLLIDPSLGFALSILYTFQWLTVLPL 190

Query: 232 ELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFI 291
           +LVTA++TI++WT  +N D                GA+GYAEAEFF N CK+LM+ GF I
Sbjct: 191 QLVTAAITIEFWTD-LNPDIFVAIIFIVVIVVNLFGARGYAEAEFFCNLCKILMIIGFII 249

Query: 292 LAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGA 351
           L+I+I +GGAGNDGYIGAKYW NPGAF      + FK V +         G  E + +  
Sbjct: 250 LSIIIISGGAGNDGYIGAKYWKNPGAFA-----NGFKGVCTVFTYAAFSYGGIEVLVLSI 304

Query: 352 SEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGS----GSAATKASPY 407
            EQ NP + +P+  K + YRILFI+L +  LV FLVPY S +L+GS     ++ + ASP+
Sbjct: 305 DEQENPIKVVPNCCKKVAYRILFIYLLTTILVCFLVPYTSPQLLGSLNKGENSGSHASPF 364

Query: 408 VIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGR 467
           VIAV SHGV+VVPHFINAVIL+SV+SVANS+ YSS R+L SLS+QG  P + NYID+ GR
Sbjct: 365 VIAVESHGVKVVPHFINAVILISVISVANSSVYSSGRLLLSLSEQGTFPQFLNYIDQRGR 424

Query: 468 PARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQG 527
           P R  ++S  F +I F A S K +DVFTWLLAISGLSQLF W+AIC+SHIRFR AMK Q 
Sbjct: 425 PIRCFVISLTFGLIGFVASSEKRQDVFTWLLAISGLSQLFIWLAICLSHIRFRDAMKTQK 484

Query: 528 RSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPIL 586
           +S+DE+G+K+Q G WGS  A ++   +L+ +FWV+IAP+ ++  LD  +FF+NYLA PI+
Sbjct: 485 KSMDEVGYKAQTGYWGSWVAVLIGLFSLVTQFWVAIAPVDKNGKLDVMSFFQNYLAFPIV 544

Query: 587 IVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           +V YFG+K+   +W   I    IDL SHRKIY
Sbjct: 545 LVAYFGHKLYYGNWCPLIPLSKIDLDSHRKIY 576

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  471 bits (1212), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 246/642 (38%), Positives = 361/642 (56%), Gaps = 34/642 (5%)

Query: 14  SFSTESKYEMKEITKNSDAKSPEQDNIVEY---FENTTGIPAAVNDSDSDFEYNGKKKIL 70
           SF +E +    +    S+    E+  I +Y    EN +  P  V++  ++      K+  
Sbjct: 6   SFHSEKRSFDSKHRLGSNTPVSEETQINDYKGTVENLSDSPVEVSNIQTEGIDGPPKQGF 65

Query: 71  PSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDH 130
                ++  L +++DS+RRA   D P   D E ++ +                    +  
Sbjct: 66  ----FQRGILGRVVDSYRRA---DIPGQDDPEGDMVS--------------------NAG 98

Query: 131 LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEM 190
           L++ +K RHV                    L  AGP  L+IGY ++    Y ++QA GE+
Sbjct: 99  LKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGEL 158

Query: 191 AVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNAD 250
           AVA+  +PG+FNAY S LV   FGF+  W++ +QWL + P+EL+  +  +++WTT V+AD
Sbjct: 159 AVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTRVDAD 218

Query: 251 XXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAK 310
                           G + Y E EFF N  KVLM+ GF I AI +  GGAG+ GYIGAK
Sbjct: 219 VFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAK 278

Query: 311 YWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIY 370
           YWH+PGAF    +  RFK V           G +E   +  +EQ NPR+ IP+A KT IY
Sbjct: 279 YWHDPGAFVSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIY 338

Query: 371 RILFIFLTSITLVGFLVPYNSTELMGSGSA---ATKASPYVIAVASHGVRVVPHFINAVI 427
           RI+FI+L ++ LVGF VP N   LMGS  A       SPYV+A + H VRV+PHFINAV+
Sbjct: 339 RIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVV 398

Query: 428 LLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACS 487
           +L+++S++NSA Y++ R++ SL+QQGY P +F+YIDR GRP RA+++  +  VIAF + S
Sbjct: 399 MLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSS 458

Query: 488 SKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYA 547
            K E +F+WL AI+GLS+LFTW +I +SH+RFR A+KVQG+ ++E+G+KS  GVWGS+Y 
Sbjct: 459 EKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYG 518

Query: 548 AIMMTLALIAEFWVSI-APIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRA 606
                L   A+FWV++ AP       A +FF++YLA+PI +  Y G+ +  RD+   I  
Sbjct: 519 VFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPL 578

Query: 607 KDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             +DL S+R+ YD                +   W K+ +F+C
Sbjct: 579 NKVDLDSYRRYYDPELLRQEDEEHKQAMKSASIWIKLHSFFC 620

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  461 bits (1186), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 333/531 (62%), Gaps = 15/531 (2%)

Query: 91  EDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXX 150
           + + + ++ DI N+ TT  +            H   +++ L+++IKP HV          
Sbjct: 39  DTLISDSSEDITNDSTTGKTE---------KGHTGSENEKLKQSIKPYHVFMITMATGIG 89

Query: 151 XXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVD 210
                    ++  AG GG ++GY I+GS L C +Q+ GE+ VA+  L G FN+Y    VD
Sbjct: 90  TGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVD 149

Query: 211 EAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKG 270
            +FGF+VAW++CLQW  V+PLELVTASMTI+YW  ++N                  GA+G
Sbjct: 150 PSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFGARG 209

Query: 271 YAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDV 330
           YA+AEF FN  KVLM+ GF IL I+I+ G AG  GYIG KY   PGAF    + + FK +
Sbjct: 210 YADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAFN---TRNTFKSI 266

Query: 331 MSXXXXXXXXXGASEFIAIGASEQS--NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVP 388
            S         G  EF+A+ A+EQ+  N  ++I  A   ++ R+   ++ SI ++G LVP
Sbjct: 267 CSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVP 326

Query: 389 YNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYS 448
           YNS ELMGS S    +SPYVIAVASHGV+VVPH INAVIL++V+SVANSA YSS R L++
Sbjct: 327 YNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHA 386

Query: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508
           L++QG+APS+F  +D +GRP R +++S +F +++F A    +E VF WLL+ISGLS +FT
Sbjct: 387 LAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFT 446

Query: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI-G 567
           W  ICV+H+RFR AMK Q  S++E+G ++  G++GS Y   + +L L+ +FWVS+ P+ G
Sbjct: 447 WTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDG 506

Query: 568 EDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           +   D  NFF+NY+A+P  + LY G+KI  R W+  I A  ID+ + R IY
Sbjct: 507 DGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFIIPADKIDVDTSRDIY 557

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  437 bits (1123), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 215/491 (43%), Positives = 313/491 (63%), Gaps = 5/491 (1%)

Query: 131 LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEM 190
           L+++IKPRHV                   ++  AG GG +IGY I+G  + C +Q+ GE+
Sbjct: 25  LRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGEL 84

Query: 191 AVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNAD 250
            VA+  L G FN+Y    +D + GF V+W++CLQW+ V+PLELVTASMTI+YW + ++  
Sbjct: 85  VVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLSPS 144

Query: 251 XXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAK 310
                           G+ GYAEAEF FN  KV+++A F +L IVI TGG GN G IG +
Sbjct: 145 LFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIGFQ 204

Query: 311 YWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS--NPRRAIPSAAKTM 368
           Y   PGAF  + ++  FK             G  EF+A+ A+EQ+  N  ++I  A + +
Sbjct: 205 YLKTPGAFNTNYNV--FKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIRRACRQV 262

Query: 369 IYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVIL 428
             R+   +L SI++VG LVPY+S  LMGSGS  T  SPYV A+A HGVR+VPH INAVIL
Sbjct: 263 SIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHIINAVIL 322

Query: 429 LSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSS 488
           ++V+SVANSA YSS R L+SL++Q +AP +F  +++ G+P R +++SA+  +I+F A   
Sbjct: 323 IAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISFIAEYR 382

Query: 489 KEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA 548
            +E VF WLL+ISGLS +FTW  IC++HIRFR A+K+QG+S+D +G++S  GV GS  A 
Sbjct: 383 DQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGSYIAT 442

Query: 549 IMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAK 607
            +  + +I +FWVS+ P+  +   DA  FF+NY+A+P+ ++LY G+K+   DW  +IR  
Sbjct: 443 AINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPWIRTH 502

Query: 608 DIDLVSHRKIY 618
            +D+ + R +Y
Sbjct: 503 CVDINTDRDVY 513

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  437 bits (1123), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 223/519 (42%), Positives = 317/519 (61%), Gaps = 3/519 (0%)

Query: 131 LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEM 190
           LQ+ +K RH+                   AL   GP G++IG+ ++G  +YC++ + GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 191 AVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-A 249
           AV +  + G F  Y +  VDE+FGF++ + Y LQWL V+PLE+V AS+T+ +W T     
Sbjct: 137 AVTFP-VSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYR 195

Query: 250 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGA 309
           D                G +GY EAEF F+  KV+ + GF IL IV+  GG    GYIG 
Sbjct: 196 DGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 310 KYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMI 369
           KYWHNPGAF GD +  RFK V S           +E + + ++E +NPR+A+P AAK + 
Sbjct: 256 KYWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVF 315

Query: 370 YRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILL 429
           +RIL  ++ S+ L+G LVP+ S  L+G+ S    ASP+V+A+ +HG++ +P  IN VIL+
Sbjct: 316 WRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVVILI 375

Query: 430 SVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSK 489
           SVLSV NSA Y+  R + +L++QG  P  F YIDR+GRP  A+I + +F +++F A S K
Sbjct: 376 SVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEK 435

Query: 490 EEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAI 549
           E DVF WLLA+SGLS LF+W AIC+ HIRFRRA+  QGRS DE+ F S  G+ GS +  I
Sbjct: 436 EGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVI 495

Query: 550 MMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDI 609
           ++ L LIA+FWV++ PIG    +A++FF  YL+ P+L+  Y  +KI KR+WKLF RAKDI
Sbjct: 496 LVLLVLIAQFWVAVWPIGGSP-NAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDI 554

Query: 610 DLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D+ + R+  D                  P+W ++  FWC
Sbjct: 555 DIDTGRREMDTEALRQEIAEEKMLLSTRPWWYRLYFFWC 593

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  431 bits (1107), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/509 (41%), Positives = 319/509 (62%), Gaps = 5/509 (0%)

Query: 113 SATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIG 172
           S  +D +     + K + L+++I+PRHV                   ++  AG GG +IG
Sbjct: 23  SVAEDVEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIG 82

Query: 173 YAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLE 232
           Y I+G  L C +Q+ GE+ VA+  L G FN+Y    +D + GFSV+W++CLQW+ V+PLE
Sbjct: 83  YGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLE 142

Query: 233 LVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
           LVT SMTI+YW  +++                  G+ GYAEAEF FNS KV+++ GF IL
Sbjct: 143 LVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIIL 202

Query: 293 AIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGAS 352
            ++I+TG  G  G IG +Y  +PG F  +K+ +  K             G  EF+A+ A+
Sbjct: 203 GVLIDTGCVGTSGTIGFRYLIDPGMF--NKNYNIIKATAGTLVNAAFSCGGVEFLALSAA 260

Query: 353 EQS--NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIA 410
           EQ+  N  ++I  A   +  RI   +L SI++VG LVP+NS  LMGSGS    +SPYV A
Sbjct: 261 EQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAA 320

Query: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470
           VA +G+ VVPH INAVIL++V+SVANSA YSS R L+SL++Q +AP +F  +++ G+P R
Sbjct: 321 VAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMR 380

Query: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530
            + +SALF +I+F A    +E +F WLL+ISGLS +FTW  IC++HIRFR A+K +G+S+
Sbjct: 381 CLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSL 440

Query: 531 DEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVL 589
           + +G+KS  GV GS  A ++  + L+ +FWVS+ P+  +   +   FF+NY+A+P+ ++ 
Sbjct: 441 ETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLF 500

Query: 590 YFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           Y G+K+  ++W L IRA ++D+ + R IY
Sbjct: 501 YIGHKVYTKNWSLLIRASNVDITTDRDIY 529

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  430 bits (1105), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 224/568 (39%), Positives = 332/568 (58%), Gaps = 20/568 (3%)

Query: 82  KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVX 141
           ++ DSF+RAE  +   N      +      ++  K P            L+ T+K RH+ 
Sbjct: 63  RIKDSFKRAEKEEVDPNLTEAERIA-----INTAKAP------------LKHTLKGRHMQ 105

Query: 142 XXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNF 201
                            +AL  AGP G+VIG+ +  + +YC++ A GE+AV +  + G F
Sbjct: 106 MVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFP-VSGGF 164

Query: 202 NAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXXX 260
             Y +  +DE+FGF+  + Y LQWL  +PLE+V+AS+T+ YW T     D          
Sbjct: 165 TTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVI 224

Query: 261 XXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG 320
                 G +G+ EAEF F++ KVL + GF IL IV+  GG    G++G +YWHNPGAF G
Sbjct: 225 VIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAFVG 284

Query: 321 DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380
           D +  +FK V S           SE + I A+E +NPR+++P AAK +++RI+  ++ S+
Sbjct: 285 DNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSL 344

Query: 381 TLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
            ++G LVPY    L+G+ S    ASP+VIA+ +HG+R +P  IN VIL++VLSV NSA +
Sbjct: 345 IMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIF 404

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
           +  R + +LS+QG+ P  F YIDR+GRP   +I+ + F +IAF A S K+ +VF WL+A+
Sbjct: 405 AGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMAL 464

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           SGLS LFTW  IC+ HIRFR A+K QGRS +E+ F S  G+ GSS+   M+ L  IA+F+
Sbjct: 465 SGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFY 524

Query: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDG 620
           V++ P G     A+ FFE+YL+ PI++  YFG+KI K++WKLFI+A+D+D+ + R+  D 
Sbjct: 525 VALFPPGSKP-SAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDL 583

Query: 621 XXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                             +W +   FWC
Sbjct: 584 ELLKQEIEEEKAILATKGWWYRQYQFWC 611

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/493 (41%), Positives = 308/493 (62%), Gaps = 5/493 (1%)

Query: 129 DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACG 188
           + L+++IKP HV                   ++  AG GG ++GY I+G  L C +Q  G
Sbjct: 35  NELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGIMLTCCMQTVG 94

Query: 189 EMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN 248
           E+ VA+  +PG F +Y    +D + GF+++W++ L W  V+PLE+  ASMTI +W   +N
Sbjct: 95  ELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASMTINFWNENIN 154

Query: 249 ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIG 308
                             GA+ YA+A+  FN  KVLM+ GF IL I +NTG  G  GY+G
Sbjct: 155 PSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIFVNTGVVGTSGYLG 214

Query: 309 AKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPR--RAIPSAAK 366
            KY+H+PG FR D+ +  FK + +         G +EF+A+  +EQ+     R+I  A+ 
Sbjct: 215 FKYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQNTEDMPRSIKRASI 272

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAV 426
            ++ RI  IF  S+ ++G LVP+NS  LMGSGS  T ASPYV+A+ ++GVR++PH +NA+
Sbjct: 273 QVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGVRIIPHIVNAI 332

Query: 427 ILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCAC 486
           ILLS++SVAN+A YSS R L+SL++QG+A  +F  +D  G+P R + +SA   + +F A 
Sbjct: 333 ILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSAFTGLFSFIAE 392

Query: 487 SSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSY 546
              +E VF WLL+ISGLS +FTW   CVSH+RFR+AMK Q +++D++G++S  GV+GS  
Sbjct: 393 YKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQSPCGVYGSYI 452

Query: 547 AAIMMTLALIAEFWVSIAPIGED-HLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIR 605
           +  +  + LI +FWVS+ P+  +  L+  +F +NY+A+PI IVLY G+K    +WK FIR
Sbjct: 453 SLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKAYTGNWKPFIR 512

Query: 606 AKDIDLVSHRKIY 618
           A +ID+ + R IY
Sbjct: 513 APEIDIQTDRDIY 525

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/571 (39%), Positives = 321/571 (56%), Gaps = 24/571 (4%)

Query: 81  RKLIDSFRRAE--DIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           +  +D F+R E  D+D    +  +  + T  SPL                   Q+ +K R
Sbjct: 47  QDFVDGFKRVELGDLDPNLTQAEKVAIATARSPL-------------------QRHLKNR 87

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                  SAL   GP  ++IG+ ++G  +Y ++ A GE+AV +  + 
Sbjct: 88  HLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGELAVTFP-VA 146

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXX 257
           G F  Y    VD++FGF++ ++Y LQWL V+PLE+V AS+T+ YW T     D       
Sbjct: 147 GGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDGFVALFY 206

Query: 258 XXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                    G KGY EAEF F+  KV  + GF IL IV+  GG    GY+G KYWHNPGA
Sbjct: 207 VVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGKYWHNPGA 266

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           F GD +  RFK V S           +E + + A+E  NPR+A+P AAK + +RI   ++
Sbjct: 267 FNGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQVFWRITLFYI 326

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            S+ L+G LVPY S  L+GS S    ASP+V+A+ +HG+  +P  IN VIL+SVLSV NS
Sbjct: 327 ISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSVINVVILISVLSVGNS 386

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           + Y+  R L +L+ QG+ P  F+YIDR+GRP   ++ +  F ++ F A S KE DVF WL
Sbjct: 387 SVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQSKKEGDVFNWL 446

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           +A+SGLS LFTW  IC+ H+RFRRA+  QGRS DE+ F S VGVWGS +  I++ L  IA
Sbjct: 447 MALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGVILICLVFIA 506

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           +FW+++ P+G    +A +FF+ YL++ +++  Y  +K+  R+W    RAKDID+ + R+ 
Sbjct: 507 QFWIAVWPMGGTP-NASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKDIDIDTGRRE 565

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            D                  P+W +V   WC
Sbjct: 566 LDLDALKQEIAEEKLRLSTKPWWYRVYHLWC 596

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 243/616 (39%), Positives = 338/616 (54%), Gaps = 32/616 (5%)

Query: 42  EYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQP------HLRKLIDSFRRAE--DI 93
           +Y +  T I     D D + E    KK   +FN  Q         R+ IDSF+R E  ++
Sbjct: 13  DYKDAKTNINTEFIDPDLESESIDIKK--ETFNYNQTGEEKGSKWRQFIDSFKRVEVPEL 70

Query: 94  DAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXX 153
           D          + T  +PL                 HL    K RH+             
Sbjct: 71  DPNLTEQERIAIITAHTPL---------------KHHL----KSRHLQMIAIGGAIGTGL 111

Query: 154 XXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAF 213
                +AL  AGP  L+IG++I GS +Y ++ A  EMAV Y  + G F  Y +  +DE+F
Sbjct: 112 FVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAVLYP-ISGGFTTYATRFIDESF 170

Query: 214 GFSVAWVYCLQWLCVMPLELVTASMTIQYW-TTTVNADXXXXXXXXXXXXXXXXGAKGYA 272
           GF+  + Y LQWL V+PLE+V+AS+T+ YW T T   D                G KGY 
Sbjct: 171 GFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRDGFVALFWLVIVIINLFGVKGYG 230

Query: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMS 332
           EAEF F++ KV+ + GF IL +V+  GG    GY+GAKYWH+PGAF G  +  +F+   S
Sbjct: 231 EAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAKYWHDPGAFVGATAGAQFQGFCS 290

Query: 333 XXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNST 392
                      SE I I  SE  NPR+A+P AAK + +RIL  ++ S+  +G LVP N +
Sbjct: 291 VFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDS 350

Query: 393 ELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQ 452
            L+GS +    ASP+VIA+  HG+R +P  IN VIL++VLSV NSA Y+  R L +L++Q
Sbjct: 351 RLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQ 410

Query: 453 GYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAI 512
           G+ P   +YIDR GRP   + +S+ F ++AF A S KE DVF WLLAISGLS  FTW AI
Sbjct: 411 GFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAI 470

Query: 513 CVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLD 572
           C+ HIRFR A+K Q RS DE+ F S +GV+GS +   ++ L L A+F+V+I P+G D   
Sbjct: 471 CLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVG-DTPS 529

Query: 573 AQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXX 632
           A NFF  YL++P+++V+Y  +K+  ++WK+FI    +DL + RK  D             
Sbjct: 530 ATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERA 589

Query: 633 XXXNGPFWKKVVAFWC 648
                P W ++  FWC
Sbjct: 590 TLAARPRWFRIYTFWC 605

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  420 bits (1079), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 227/575 (39%), Positives = 322/575 (56%), Gaps = 22/575 (3%)

Query: 77  QPHLR--KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKT 134
           + H R  +  +SF+RAE+++   N         T +   A K  Q           L+  
Sbjct: 40  EAHSRWGRFKESFKRAEEMELDPN--------LTEAERIAIKTAQ---------SPLKHH 82

Query: 135 IKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAY 194
           +K RH+                  +AL  AGP G++IG+ + G+ +Y ++ A GE+AV +
Sbjct: 83  LKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVF 142

Query: 195 SGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXX 253
             + G F  Y +  VDE+FGF+  ++Y LQWL V+PLE+V AS+T+ YW T     D   
Sbjct: 143 P-VAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFV 201

Query: 254 XXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWH 313
                        G KGY EAEF F+  KV+ + GF I+AIV+  GG  +  YIGA+YW+
Sbjct: 202 ALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWY 261

Query: 314 NPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRIL 373
           NPGAF GD +  +F+   +           SE + +  SE   PR+++P AAK + +RI 
Sbjct: 262 NPGAFVGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRIT 321

Query: 374 FIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLS 433
             ++  + L+G LVP +S  L+G+ S    ASP+VIA+ +HG++ +P  +N VIL++VLS
Sbjct: 322 LFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLS 381

Query: 434 VANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDV 493
           V NSA YS  R L +L+ QG+ PS   YIDR GRP   + +SA F +IAF A S KE DV
Sbjct: 382 VGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDV 441

Query: 494 FTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL 553
           F WL+A+SGLS LFTW  IC+ HIR+R A+  QGRS DE+ F++  GVWGS +   M  L
Sbjct: 442 FNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCIL 501

Query: 554 ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVS 613
             IA+F+V + P G    +A +FF  YL+  I I LY  +KI KR+WKLFI  KD+D+ +
Sbjct: 502 MFIAQFYVGLFPPGTKP-NAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDT 560

Query: 614 HRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            R+  D                  PFW +   FWC
Sbjct: 561 GRREVDLDVLREELAEERAALAARPFWYRSWKFWC 595

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  418 bits (1075), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 214/566 (37%), Positives = 319/566 (56%), Gaps = 21/566 (3%)

Query: 86  SFRRAEDI--DAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXX 143
           SF   E+I  D P   D EN +  T                   D  L K +  RH+   
Sbjct: 58  SFDSKENIKSDVPHVSDFENNVYDT-----------------ANDSKLNKDLSVRHLLTL 100

Query: 144 XXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNA 203
                          ++L+  GP  L++ + I+ +CL+ I+ A GE+A  +  + G FN 
Sbjct: 101 AVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFP-VVGGFNV 159

Query: 204 YPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXX 263
           Y +  V+ +FGF+V   Y  QW  ++PLELV AS+TI+YW  T+N+D             
Sbjct: 160 YITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLA 219

Query: 264 XXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKS 323
                K + E EF  +  K+L + GF IL IV+  GG  +  YIG +YW++PGAF GD  
Sbjct: 220 NMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTP 279

Query: 324 IDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLV 383
             RFK V +           +E +A+ A+E  NPR  +P A+K   + I   ++T +T++
Sbjct: 280 GRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTII 339

Query: 384 GFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSS 442
           G LVPYN   L+ G+ S    ASP VIA+ + G++ +P  +NA+IL+++LSVANSA Y+ 
Sbjct: 340 GCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYAC 399

Query: 443 CRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISG 502
            R + ++++ G  P   NYID+ GRP  A+  + +F +++F A S K+E+VFTWL A+SG
Sbjct: 400 SRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSG 459

Query: 503 LSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVS 562
           LS LF W +I +SHIRFR+AMK Q RS++E+ F S  GV+GS Y  I++ L LIA FW S
Sbjct: 460 LSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTS 519

Query: 563 IAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXX 622
           + P+G D  DA++FFE YL++PI IV Y G+K+ K+DW+L+++ KD+DL + R+  D   
Sbjct: 520 LFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDI 579

Query: 623 XXXXXXXXXXXXXNGPFWKKVVAFWC 648
                          PF+ + +  WC
Sbjct: 580 LKQEIRLEREQMAQKPFYIRFLNVWC 605

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 220/571 (38%), Positives = 329/571 (57%), Gaps = 24/571 (4%)

Query: 81  RKLIDSFRRAE--DIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           +K+ DSF+RAE  ++D       +  + T  SPL                   Q  +K R
Sbjct: 51  KKIKDSFKRAEVPELDPNLTEAEKIAIATARSPL-------------------QHQLKNR 91

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                  +AL  AGP G++IG+ I GS +YC++ +  E+A+A+  + 
Sbjct: 92  HLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAFP-VA 150

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXX 257
           G F  Y +  +DE++GF+  + Y LQW+  +PLE+V AS+T+ YW T     D       
Sbjct: 151 GGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDGFVALFW 210

Query: 258 XXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                    G +GY EAEF F+ CK+LM+ GF ILAI++  GG    GYIGA+YW++PGA
Sbjct: 211 VVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGA 270

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           F GD S  +FK   S           SE + + A+E SNPR+ +P AAK + +RI   ++
Sbjct: 271 FAGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFYV 330

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
             + L+G LVPY    L+G  S    ASP+VIA+ + G+  +P  +N VIL++VLSV NS
Sbjct: 331 LCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNVVILIAVLSVGNS 390

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           A Y+  R L +L+ QG+ P  F+YIDR GRP   + +++ F +IAF A S KE +VF WL
Sbjct: 391 AVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWL 450

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           +A+SGLS LFTW  IC+ HIRFRRA+  QGRS +E+ F S  GVWG+++   +  + L A
Sbjct: 451 MALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIMLAA 510

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           +F+V++ P+G     A +FF+ YL++PI++ ++ G+KI K++WKLFI+A+D+D+ + R+ 
Sbjct: 511 QFYVALFPLGAPP-SANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRE 569

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            D                  P W ++  F+C
Sbjct: 570 LDLDLLRQQVEEERAALAAKPMWYRIYKFFC 600

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  415 bits (1067), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/571 (39%), Positives = 328/571 (57%), Gaps = 25/571 (4%)

Query: 82  KLIDSFRRAEDIDAPTNRDIENELT--TTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           + +DSFR  E ++   N    +++   T  SPL                   Q  +K RH
Sbjct: 49  RFVDSFRERERLEVDPNMSELDQIAFRTANSPL-------------------QHHLKNRH 89

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                  +AL  AGP G++IG+ + G+ +Y ++ A GE+AV +  + G
Sbjct: 90  LQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGELAVLFP-VSG 148

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXX 258
            F  Y +  +DE++GF+    Y LQWL V+PLE+V AS+T+ YW T     D        
Sbjct: 149 GFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRDGFVALFWL 208

Query: 259 XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNP-GA 317
                   G KGY EAEF F+  KV+ + GF IL I++N GG    GYIG +YWH+P GA
Sbjct: 209 AIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGGRYWHHPYGA 268

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           F GD +  RFK V S           SE + + ++E +NPR+++P AAK + +RI   +L
Sbjct: 269 FVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYL 328

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            ++ +VG LVPY    L+G+ S    ASP+VIA+ +HG+R +P  +N VIL++VLSV NS
Sbjct: 329 LALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNS 388

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           A Y+  R L +L++Q + P +F YIDR GRP  ++++++ F ++AF A S KE +VF WL
Sbjct: 389 AIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWL 448

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           LA+SGLS LFTW  IC+ HIRFR+A+  QGR  DE+ F S  GV+GS +   M+ L  IA
Sbjct: 449 LALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIA 508

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           +F+V++ P G    +A+ FFE YL+ PI+I  Y G+KI K++WK+FI+A+D+D+ + RK 
Sbjct: 509 QFYVALFPPGAKP-NAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKD 567

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            D                  P+W +   FWC
Sbjct: 568 DDLDLLRQEVAEERAVLATKPWWYRWWVFWC 598

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  409 bits (1050), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/571 (40%), Positives = 320/571 (56%), Gaps = 26/571 (4%)

Query: 82  KLIDSFRRAE--DIDAPTNRDIEN-ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
             +DSF+R E  ++D P   D+E   + T  SPL                   Q  +K R
Sbjct: 56  NFLDSFKRVEVEEVD-PNLTDLEKIAIKTARSPL-------------------QHKLKSR 95

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                   AL  AGP G++IG++I G+ ++ ++ A GE+AV +  + 
Sbjct: 96  HLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGELAVMFP-VS 154

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXX 257
           G F  Y +  +DE+FGF+  + Y LQWL V+PLE+V AS+T+ YW T V   D       
Sbjct: 155 GGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVALFW 214

Query: 258 XXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                    G +GY EAEF F+  KV  + GF IL IV+  GG    GY+GA+YWHNPGA
Sbjct: 215 LVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGA 274

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           F G  S  +F    S           SE I +  SE  NPR+A+PSAAK + +RIL  ++
Sbjct: 275 FVGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYI 334

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
             + L+GFLVPYN   L+ S S    ASP+VIA+ +HG+  +P  IN VIL+SVLSV NS
Sbjct: 335 ICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNS 394

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           A YS  R L +LS+QG+ P   +YIDR+GRP   + +S+ F +IAF A S+K+ ++F WL
Sbjct: 395 AIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWL 454

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           LAISGLS  FTW AIC+ HIRFR A+K QGR  DE+ F S  GV GS +   +  L LIA
Sbjct: 455 LAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIA 514

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           +F++++ PIG     A  FF  YLA P+++  Y  +K+ K++WK  I  +D+D+ + R+ 
Sbjct: 515 QFYIALFPIGGSP-SAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRD 573

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            D                  P+W +V  FWC
Sbjct: 574 TDVNLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  408 bits (1048), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 223/565 (39%), Positives = 324/565 (57%), Gaps = 20/565 (3%)

Query: 85  DSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXX 144
           DSF+R E ++   N             L+  +   F          L+  +K RH+    
Sbjct: 56  DSFKRVEPVEVDPN-------------LTEAEKVAFI----TAQTPLKHQLKNRHLQMIA 98

Query: 145 XXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAY 204
                          AL   GP  L+IG+  MG+ +Y ++ A GE+AV +  + G F  Y
Sbjct: 99  IGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGELAVVFP-ISGGFTTY 157

Query: 205 PSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXXXXXX 263
            +  +DE+FGF+  + Y LQWL  +PLE+V+AS+T+ YW T     D             
Sbjct: 158 ATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRDGFVALFWLVIVCI 217

Query: 264 XXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKS 323
              G KGY EAEF F+  KV+ + GF IL I++N GG    GYIG KY+H+PGAF GD  
Sbjct: 218 NMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAFAGDTP 277

Query: 324 IDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLV 383
             +FK V S           SE + + ASE  +PR+++P AAK + +RI   ++ S+ ++
Sbjct: 278 GAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMI 337

Query: 384 GFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSC 443
           G LVPYN + L+G+ S    ASP+VIA+ +HG++ +P  +N VIL++VLSV NSA ++  
Sbjct: 338 GLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACS 397

Query: 444 RILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGL 503
           R   +L++QG+ P  F Y+DR+GRP   +I+++   +IAF A S+KEEDVF WLLA+SGL
Sbjct: 398 RTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGL 457

Query: 504 SQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSI 563
           S LFTW  IC+ HIRFR+A+  QGRSVDE+ FKS  GVWGS +   M+ +  IA+F+V++
Sbjct: 458 SSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVAL 517

Query: 564 APIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXX 623
            P+      A+ FFE YL+ P+++ +Y G+KI KR+WKL I A ++D+ S R+  D    
Sbjct: 518 FPV-NGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVDLELL 576

Query: 624 XXXXXXXXXXXXNGPFWKKVVAFWC 648
                         P W +V +FWC
Sbjct: 577 KQEIAEEKAILATKPAWFRVYSFWC 601

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  407 bits (1047), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/583 (40%), Positives = 337/583 (57%), Gaps = 24/583 (4%)

Query: 71  PSF-NIKQP---HLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEE 126
           PSF +  QP     +K  DSF++AED++   N      LT       AT     AP    
Sbjct: 56  PSFTSTTQPSTTRWQKFKDSFKKAEDVELDPN------LTEAERIAQATAK---AP---- 102

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
               LQ T+K R                    +AL   GP GL+IG+ +  + +Y ++ A
Sbjct: 103 ----LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMA 158

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW-TT 245
            GE+AV +  + G F  Y +  VDE+FG++  + Y LQWL V+PLE+V+AS+T+ YW T 
Sbjct: 159 LGELAVVFP-VAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTP 217

Query: 246 TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDG 305
           T   D                G KG+ EAEF F+  KV  + GF IL IV+  GG    G
Sbjct: 218 TRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGG 277

Query: 306 YIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAA 365
           ++GAKYWH+PGAF G  S  +FK V S           SE I I A+E +NPR++IP AA
Sbjct: 278 FVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAA 337

Query: 366 KTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINA 425
           K +++RI+  ++ ++T++G LVPYN   L+G+ S    ASP+VIA+ +HG++ +P  IN 
Sbjct: 338 KQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINV 397

Query: 426 VILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCA 485
           VIL++VLSV NSA ++  R + +LS QG+ P  F YIDR GRP   + +++ F ++AF A
Sbjct: 398 VILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVA 457

Query: 486 CSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSS 545
            S KE +VF WLLA+SGLS LFTW  IC+ HIRFR A+K QGR  +E+ F S  GV GS 
Sbjct: 458 ASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSY 517

Query: 546 YAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIR 605
           +   M+ L  IA+F+V++ P G    DA+ FF++YL+ PI++  YFG+KI KR+WKLFI 
Sbjct: 518 WGLFMIVLMFIAQFYVALFPPGGKP-DAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIP 576

Query: 606 AKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +D+D+ + R+  D                + P++ +  AFWC
Sbjct: 577 LEDMDIDTGRRETDMELLKQEIMEEKAILASKPWYIRAYAFWC 619

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  406 bits (1043), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/565 (39%), Positives = 322/565 (56%), Gaps = 20/565 (3%)

Query: 85  DSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXX 144
           DSFRR E ++   N             L+  +   F         HL    K RH+    
Sbjct: 57  DSFRRVEPVEVDPN-------------LTEAEKVAFVTAQTPLKHHL----KNRHLQMIA 99

Query: 145 XXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAY 204
                         +AL   GP  L+IG+   G+ +Y ++ A GE+AV +  + G F  Y
Sbjct: 100 IGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELAVIFP-ISGGFTTY 158

Query: 205 PSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXXXXXX 263
            +  +DE+FG++  + Y LQWL V+PLE+V+AS+T+ +W T     D             
Sbjct: 159 ATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVII 218

Query: 264 XXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKS 323
              G KGY EAEF F+  KV+ + GF IL I++N GG    GYIG KYWH+PGAF GD  
Sbjct: 219 NMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTP 278

Query: 324 IDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLV 383
             +FK + S           SE + + ASE  +PR+++P AAK + +RI   ++ S+ +V
Sbjct: 279 GAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMV 338

Query: 384 GFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSC 443
           G LVPYN   L+G+ S    ASP+VIA+ +HG++ +P  +N VIL++VLSV NSA Y+  
Sbjct: 339 GLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACS 398

Query: 444 RILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGL 503
           R + +L++Q + P  F Y+DR+GRP   + +++ F +IAF A S KE DVF WLLA+SGL
Sbjct: 399 RTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGL 458

Query: 504 SQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSI 563
           S LFTW  IC+ HIRFR+A+  QGR +DE+ FKS  GVWGS +   M+ +  IA+F+V++
Sbjct: 459 SSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVAL 518

Query: 564 APIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXX 623
            P+G     A+ FFE YL+ P+++ +Y G+KI KR+WKLFI A+D+D+ + R+  D    
Sbjct: 519 FPVGASP-SAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRREVDLELL 577

Query: 624 XXXXXXXXXXXXNGPFWKKVVAFWC 648
                         P W ++  FWC
Sbjct: 578 KQEIAEEKAIMATKPKWYRIWNFWC 602

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  403 bits (1035), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/522 (41%), Positives = 320/522 (61%), Gaps = 3/522 (0%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           +  L++ +K RH+                   AL  AGP G++IG+A+ G+ +YC++ A 
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GE+AV +  + G F  Y +  +DE+FG++  + Y LQWL V+PLE+V AS+T+ YW T  
Sbjct: 134 GELAVTFP-VSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDP 192

Query: 248 N-ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
              D                G KGY EAEF F+  KV+ + GF IL I++  GG    GY
Sbjct: 193 KYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGY 252

Query: 307 IGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 366
           IG   WHNPGAF G+ +  RFK V S           SE + + ++E +NPR+++P AAK
Sbjct: 253 IGGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAK 312

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAV 426
            + +RI   ++ S+ L+G LVPYN T L+G+ S    ASP+V+A+ +HG++ +P  +N V
Sbjct: 313 QVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNVV 372

Query: 427 ILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCAC 486
           IL++VLSV NSA +   R L +L++QG+ P  F YIDR+GRP   +  ++ F +++F A 
Sbjct: 373 ILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAA 432

Query: 487 SSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSY 546
           S KE +VF WLLA+SGLS LFTW+AIC+ H+RFRRA+  QGRS DE+ F S  GVWGS Y
Sbjct: 433 SPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSIY 492

Query: 547 AAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRA 606
             +++ L L A+FW+++ PIG    DA++FFE+YL++P+++V+Y G+K  KR+WKLFIRA
Sbjct: 493 GTVLIMLILAAQFWIALFPIGSPP-DAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRA 551

Query: 607 KDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           ++ID+ + R+  D                +   W +   FWC
Sbjct: 552 ENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYYFWC 593

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  402 bits (1034), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 221/565 (39%), Positives = 326/565 (57%), Gaps = 20/565 (3%)

Query: 85  DSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXX 144
           DSF+R + I+   N   E E    ++     + P            L+  +K RH+    
Sbjct: 57  DSFKRVKPIEVDPNLS-EAEKVAIIT----AQTP------------LKHHLKNRHLQMIA 99

Query: 145 XXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAY 204
                         +AL   GP  L+IG+   G+ +Y ++ A GE+AV +  + G F  Y
Sbjct: 100 IGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTY 158

Query: 205 PSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXXXXXX 263
            +  +DE+FG++  + Y LQWL V+PLE+V+AS+T+ +W T     D             
Sbjct: 159 ATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVII 218

Query: 264 XXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKS 323
              G KGY EAEF F+  KV+ + GF IL I++N GG    GYIG KYWH+PGAF GD  
Sbjct: 219 NMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTP 278

Query: 324 IDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLV 383
             +FK V S           SE + + ASE   PR+++P AAK + +RI   ++ S+ ++
Sbjct: 279 GAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMI 338

Query: 384 GFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSC 443
           G LVPYN   L+G+ S    ASP+VIA+ +HG++ +P  +N VIL++VLSV NSA Y+  
Sbjct: 339 GLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACS 398

Query: 444 RILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGL 503
           R + +L++Q + P  F+Y+DR+GRP   + +++ F +IAF A S KE +VF WLLA+SGL
Sbjct: 399 RTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGL 458

Query: 504 SQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSI 563
           S LFTW  IC+ HIRFR+A+  QGR +DE+ FKS  GVWGS +   M+ +  IA+F+V++
Sbjct: 459 SSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAV 518

Query: 564 APIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXX 623
            P+G D   A+ FFE YL+ P+++V+Y G+KI KR+WKLFI A+ +D+ + R+  D    
Sbjct: 519 FPVG-DSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLL 577

Query: 624 XXXXXXXXXXXXNGPFWKKVVAFWC 648
                         P W ++  FWC
Sbjct: 578 KQEIAEEKAIMATKPRWYRIWNFWC 602

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  402 bits (1032), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/532 (39%), Positives = 310/532 (58%), Gaps = 5/532 (0%)

Query: 121 APHAEEKDDH---LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMG 177
           +P   ++D H   + + +  RH+                  ++L+  GP  LVIG+ I+ 
Sbjct: 73  SPDDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVS 132

Query: 178 SCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTAS 237
           + L+ +I + GE+A AY  + G FN Y +  VD +F FSV   Y +QWL ++PLELV AS
Sbjct: 133 TALFTVINSLGELAAAYP-VVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAAS 191

Query: 238 MTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVIN 297
           +TI+YW  T+N+D                  K + E EF  +  K+L + GFFIL IV+ 
Sbjct: 192 LTIRYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLT 251

Query: 298 TGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
            GG    GYIG KYWH+PGAF GD +  +FK + S            E IA+ A+E  NP
Sbjct: 252 CGGGPKGGYIGGKYWHDPGAFVGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNP 311

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGV 416
           R+ IP+AAK   + I F ++T +TLVG LV YN T L+ GS S    ASP VIA+ + G+
Sbjct: 312 RKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGI 371

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
           + +P  +NA+IL+++LSVANSA Y+  R + S++  G  P   + +D+ GRP RA+  + 
Sbjct: 372 KGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTL 431

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
            F +++F A S K+E+VFTWL A+SGLS +F W+ I ++HIRFR+AM VQ RS+DE+ + 
Sbjct: 432 FFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYL 491

Query: 537 SQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIC 596
           SQ G++GS Y   ++ L LIA FW S+ P+G D  DA+ FFE YL+ PILI  Y G+K+ 
Sbjct: 492 SQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLY 551

Query: 597 KRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            ++W++    ++IDL++ RK  D                   F K+ +  WC
Sbjct: 552 FKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQSSFMKRFLLIWC 603

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  399 bits (1025), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 218/606 (35%), Positives = 334/606 (55%), Gaps = 28/606 (4%)

Query: 70  LPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIEN---ELTTTLSPLSA------------ 114
           +P   +K+ +  ++ID F   +  D+  +R       EL++  SP+              
Sbjct: 1   MPKNPLKKQYWTEVIDGFHSPDRTDSANDRSSSPDNFELSSVNSPVRVNVSSSGNDDILK 60

Query: 115 --TKD--------PQFAPHAEE-KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHK 163
             TK+        P+ A + E+  + +L K +  RH+                  ++L  
Sbjct: 61  GDTKEYPRDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTT 120

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
            GP  LVIG+ I+ +CL+ +I + GE+A A+  + G FN Y +  ++ +F F++   Y  
Sbjct: 121 GGPASLVIGWVIVSTCLFTVINSLGELAAAFP-VVGGFNVYITRFIEPSFAFAINLNYLA 179

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
           QWL ++PLELV AS+TI+YW   +N+D                  K + E EF  +  K+
Sbjct: 180 QWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKI 239

Query: 284 LMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGA 343
           L + GF IL IV+  GG  + GYIG KYWHNPGAF G  +  +FK + S           
Sbjct: 240 LAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSG 299

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAAT 402
            E  A+ A+E  NP+  IP AAK   + I   ++  +TL+G LVPYN   L+ GS S   
Sbjct: 300 IEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDA 359

Query: 403 KASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYI 462
            ASP VIA+ + G++ +P  +NA+IL++++SVANSA Y+  R + S++  G  P + + +
Sbjct: 360 AASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKV 419

Query: 463 DREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRA 522
           D+ GRP  A++++  F +++F A S K+E+VFTWL A+SGLS +F W+AI +S IRFR A
Sbjct: 420 DKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDA 479

Query: 523 MKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLA 582
           MK QGRS+DE+ F SQ G WG+ Y  I++ L L+A FW S+ P+G     A++FFE YL+
Sbjct: 480 MKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLS 539

Query: 583 MPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKK 642
           +PILI  Y G+K+ KRDW+L +   ++DL S R++ D                N  F+ +
Sbjct: 540 LPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLDAETREEELRVEREYLANASFFTR 599

Query: 643 VVAFWC 648
            +  WC
Sbjct: 600 FLHIWC 605

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  396 bits (1017), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/567 (40%), Positives = 329/567 (58%), Gaps = 29/567 (5%)

Query: 85  DSFRRA--EDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXX 142
           DSF+RA  +D+D P   D E      ++ L+A      AP        L++T+K RH+  
Sbjct: 47  DSFKRADTQDLD-PNLTDAEK-----MAILTAN-----AP--------LKRTLKSRHLQM 87

Query: 143 XXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFN 202
                            AL  AGP G++IG+A+ G+ +YC++ A GE+AV +  + G F 
Sbjct: 88  IAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFT 146

Query: 203 AYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXXXX 261
            Y S  VDE+FGF+   +Y LQWL V+PLE+V AS+T+ YW T     D           
Sbjct: 147 TYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIV 206

Query: 262 XXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD 321
                G KGY EAEF F+  KV+ + G+ IL +++  GG    GYIG + WHNPGAF   
Sbjct: 207 AINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFA-- 264

Query: 322 KSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSIT 381
              + FK V S           SE + + A+E +NPR+++PSAAK + +RI   ++ ++ 
Sbjct: 265 ---NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALL 321

Query: 382 LVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYS 441
           +VG LVPY S  L+G  S    ASP+VI++ + G++ +P  IN VIL++VLSV NSA ++
Sbjct: 322 MVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFA 381

Query: 442 SCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAIS 501
             R + +L+ QG  P  F YIDR GRP   +I++ +F +++F A S KE +VF WLLA+S
Sbjct: 382 CSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALS 441

Query: 502 GLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWV 561
           GLS LFTW  I + HIR RRA+  Q R+  E+ F +  GVWGS Y  +++ L L+A+FW+
Sbjct: 442 GLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWI 501

Query: 562 SIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGX 621
           ++ PIG D   A  FFE YL+ PILI  Y G+KI K++WKLFIRAK+ID+ + R+  D  
Sbjct: 502 ALFPIG-DKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIE 560

Query: 622 XXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                         + PF+ ++  FWC
Sbjct: 561 ALKQEIAEEKAFIASKPFYYRMYKFWC 587

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  394 bits (1013), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/555 (38%), Positives = 314/555 (56%), Gaps = 6/555 (1%)

Query: 95  APTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXX 154
           +P  +   N++T++      ++D       +  + +L K +  RH+              
Sbjct: 54  SPGMKQTTNDITSS----ERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLY 109

Query: 155 XXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFG 214
               +AL   GP  LVI + I+G+CL+ +I + GE++ A+  + G FN Y    V+ +F 
Sbjct: 110 VNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFP-VVGGFNVYGMRFVEPSFA 168

Query: 215 FSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEA 274
           F+V   Y  QWL ++PLELV AS+TI+YW   +N+D                  K + E 
Sbjct: 169 FAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGET 228

Query: 275 EFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXX 334
           EF  +  K+L + GF IL IV++ GG  + GYIG KYW NPGAF G  S  +FK + S  
Sbjct: 229 EFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGTKFKGLCSVF 288

Query: 335 XXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTEL 394
                     E  A+ A+E  NPR  IP AAK   + I   ++T +TL+G LVP N   L
Sbjct: 289 VTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRL 348

Query: 395 M-GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQG 453
           + GS S    +SP VIA+ +  ++ +P  +NA+IL++V+SVANSA Y+  R + +++  G
Sbjct: 349 LNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIG 408

Query: 454 YAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAIC 513
             P + N +D+ GRP  A++++  F +++F A S+KE +VFTWL A+SGLS +F W+AI 
Sbjct: 409 NLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAIN 468

Query: 514 VSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDA 573
           +SHIRFR+AMKVQ RS+DE+ F SQ GV GS Y  +++ L LIA FW S+ PIG     A
Sbjct: 469 LSHIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASA 528

Query: 574 QNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXX 633
           ++FFE YL+ PILIV YFG+KI  R+W L ++ +DIDL + RK  D              
Sbjct: 529 ESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIEREN 588

Query: 634 XXNGPFWKKVVAFWC 648
                F  + + FWC
Sbjct: 589 LAKKSFITRFLHFWC 603

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  394 bits (1011), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 211/573 (36%), Positives = 313/573 (54%), Gaps = 30/573 (5%)

Query: 80  LRKLIDSFR--RAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKP 137
           +   +D FR  + +D+D   +      + T  SPL                   ++ +K 
Sbjct: 50  IHNFVDGFREYKLDDVDPNLSSTERAAIATARSPL-------------------KRHLKN 90

Query: 138 RHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGL 197
           RH+                   AL   GP  +++ + + GS +Y ++QA GE+ VA   +
Sbjct: 91  RHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALP-V 149

Query: 198 PGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXX 256
            G++ +Y S  +D +FGF++A+ Y +  L  MPLE+V AS+T+ YW      AD      
Sbjct: 150 SGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALF 209

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND-GYIGAKYWHNP 315
                     G KGY EAEF F+  KVL + GF IL IV+  GG  N+ GYIG KYWHNP
Sbjct: 210 YVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNP 269

Query: 316 GAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFI 375
           G F        FK   +           SE  A+GA+E  NPRR +P AAK + +RI   
Sbjct: 270 GGFA-----HGFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLF 324

Query: 376 FLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVA 435
           +L S+TL+G LVPY +  L  S S    ASP+VIA+   G+  +P  IN VIL++VLSV 
Sbjct: 325 YLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVG 384

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           N+  ++S R   SL+  GY P  F Y+DR+GRP   +I+S +F +++F + S  +  VF 
Sbjct: 385 NTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFE 444

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           W+LA+SGL   FTW +ICV H+RFR+ ++ QGRS DE+ FK+Q G+WGS Y   ++++ L
Sbjct: 445 WMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVL 504

Query: 556 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHR 615
             +FWV++ P+ +    A +FFE YL++P++IV Y G+K+  R+W+L I AK++DL + R
Sbjct: 505 CFQFWVALFPLSKSP-SAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGR 563

Query: 616 KIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           +  D                + P W ++  FWC
Sbjct: 564 REVDLELLKQEIKEENESIRSRPIWYRIYRFWC 596

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  392 bits (1008), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/575 (38%), Positives = 313/575 (54%), Gaps = 9/575 (1%)

Query: 77  QP-HLRKLIDSFRRAEDIDAPTNRDI-ENELTTTLSPLSATKDPQFAPHAEEKDDHLQKT 134
           QP  LR     +  A+D      +D+     T  L  L +T         E++D    K 
Sbjct: 21  QPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQ-----EVEDQDARYNKD 75

Query: 135 IKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAY 194
           +  RH+                  +AL   GPG LVI + I+ +CL+ I+ A GE++  +
Sbjct: 76  LSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTF 135

Query: 195 SGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXX 254
             + G FN Y S  V+ +FGF+V   Y  QW  ++PLELV AS+TI+YW  T+N+D    
Sbjct: 136 P-VVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVA 194

Query: 255 XXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHN 314
                         K + E EF  +  K+L + GF IL IV+  GG    GYIG KYW N
Sbjct: 195 IFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSN 254

Query: 315 PGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILF 374
           PGAF G  + DRF  + S           +E IA+ A+E  NPR  +P A K   + I  
Sbjct: 255 PGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITV 314

Query: 375 IFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLS 433
            ++  +TLVG LV  +   L+ GS S    ASP VIA+ + G++ +P  +NA+IL++VLS
Sbjct: 315 CYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLS 374

Query: 434 VANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDV 493
           VANSA Y+  R + S++Q G  P  F Y+DR+GRP  A++ + +F +++F A S K+E+V
Sbjct: 375 VANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEV 434

Query: 494 FTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL 553
           FTWL A+SGLS LF W AI VSHIRFRR MK +GR++DE+ F S  GVWGS Y  I++ +
Sbjct: 435 FTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFI 494

Query: 554 ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVS 613
            L+  FW S+ P G +  +A++FFE YL+ PIL+  YFG+K+  R W+L    K+IDL S
Sbjct: 495 VLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDS 554

Query: 614 HRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            R+  D                    + + +  WC
Sbjct: 555 GRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  392 bits (1008), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 213/519 (41%), Positives = 305/519 (58%), Gaps = 3/519 (0%)

Query: 131 LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEM 190
           L+  +K RH+                  +AL  AGP G++IG+ + G+ +YC++ A GE+
Sbjct: 81  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGEL 140

Query: 191 AVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-A 249
           +V +  + G F  Y +  +DE+FGF+  + Y LQWLCV+PLE+V AS+T+ YW T     
Sbjct: 141 SVVFP-ISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYR 199

Query: 250 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGA 309
           D                G KGY EAEF F+  KVL + GF I+ IV+N GG    GYIG 
Sbjct: 200 DGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGG 259

Query: 310 KYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMI 369
           KY+H+PGAF GD +  RF+ V S           SE I I A+E + PR+++P AAK + 
Sbjct: 260 KYFHDPGAFVGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVF 319

Query: 370 YRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILL 429
           +RI   ++ S+ +VG LVPY    L+G+ S    ASP+VIA+ SHG+R +P  +N VIL+
Sbjct: 320 WRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILI 379

Query: 430 SVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSK 489
           +VLSV NSA Y   R L +L+QQ + P  F YIDR GRP   +  ++ F ++AF A S K
Sbjct: 380 AVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKK 439

Query: 490 EEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAI 549
           E +VF WLLA+SGLS LFTW  IC  HIRFR A+  QGRS DE+ FK+  G++GS +   
Sbjct: 440 EGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLF 499

Query: 550 MMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDI 609
           M+ L  +A+F+V++ P G     A+ FF++YL+ P+++  YFG+K+  R+WKL I    +
Sbjct: 500 MIVLMFMAQFYVALFPPGGKP-SAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKL 558

Query: 610 DLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D+ + R+  D                  P+W +  +FWC
Sbjct: 559 DIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRWYSFWC 597

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  389 bits (999), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 306/495 (61%), Gaps = 3/495 (0%)

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
            + +L K +  RH+                  +AL   GP  LV+G+ I+ +CL+ +I +
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GE+A A+  + G FN Y +  VD + GF+V   Y  QWL ++PLELV AS+TI+YW   
Sbjct: 99  LGELAAAFP-IVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           +N+D                  K + E EF  +  K+L + GF IL IV+ +GG  + GY
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 307 IGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 366
           +G KYW+NPGAF G  +  +FK + S            E IA+ A+E  NPR+ IP AAK
Sbjct: 218 LGFKYWNNPGAFVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAK 277

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHGVRVVPHFINA 425
              + +   ++  +TLVG LVPYN + L+ + ++    ASP VIA+ + G++ +P  +NA
Sbjct: 278 RTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNA 337

Query: 426 VILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCA 485
           +IL++++SVANSA Y+  R + S++  G  P   + +D++GRP  A+I++ +F +++F A
Sbjct: 338 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIA 397

Query: 486 CSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSS 545
            S K+ +VFTWL A+SGLS +F W+AI  S IRFRRAM+VQ RS+DE+ + SQ G+WG+ 
Sbjct: 398 ASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAW 457

Query: 546 YAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-CKRDWKLFI 604
           Y  +++ L ++A FW S+ P+G  H DA++FFE++L++PIL+V YFG+K+   R+W+L I
Sbjct: 458 YGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQI 517

Query: 605 RAKDIDLVSHRKIYD 619
            A+++D+ S RKI D
Sbjct: 518 GAEEMDIDSGRKIID 532

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  389 bits (1000), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/523 (39%), Positives = 301/523 (57%), Gaps = 2/523 (0%)

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
            + +L K +  RH+                  +AL   GP  LVI + I+ +CL+ +I +
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GE++ A+  + G FN Y    V+ +F F+V   Y  QWL ++PLELV AS+TI+YW   
Sbjct: 142 LGELSAAFP-VVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           +N+D                  K + E EF  +  K+L + GF IL IV++ GG  + GY
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 307 IGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 366
           IG KYWH+PGAF G  S  +FK + S            E  A+ A+E  NPR  IP AAK
Sbjct: 261 IGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAK 320

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHFINA 425
              + I   ++  +TL+G LVP N   L+ GS S    +SP VIA+ + G++ +P  +NA
Sbjct: 321 RTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNA 380

Query: 426 VILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCA 485
           +IL++V+SVANSA Y+  R + +++  G  P + N +D+ GRP  A++++  F +++F A
Sbjct: 381 IILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVA 440

Query: 486 CSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSS 545
            S K+ +VFTWL A+SGLS +F W+AI +SHIRFR+AMKVQ RS+DE+ F SQ GV GS 
Sbjct: 441 ASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSW 500

Query: 546 YAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIR 605
           Y  I++ L LIA FW S+ P+G    +A++FFE YL+ PILIV YFG+KI  R+W L ++
Sbjct: 501 YGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVK 560

Query: 606 AKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +DIDL + RK  D                   F  + + FWC
Sbjct: 561 LEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFWC 603

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  389 bits (998), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/567 (36%), Positives = 316/567 (55%), Gaps = 24/567 (4%)

Query: 85  DSFRRAEDIDA-PTNRDIEN-ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXX 142
           DSF+R + +D  P   D +   + T+ SPL                   Q+ +K RH+  
Sbjct: 55  DSFKRMDSVDLDPNLTDAQKIAILTSQSPL-------------------QRKLKNRHLQM 95

Query: 143 XXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFN 202
                            AL  AGP G++IG+ +M + + C+  + GEMAV +  + G + 
Sbjct: 96  IAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFP-VSGGYT 154

Query: 203 AYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXX-XXXX 261
            Y +  +DE++GF+    Y +Q L V+PLE+V AS+T+ YW                   
Sbjct: 155 TYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRAAFVALFWLCIV 214

Query: 262 XXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD 321
                G KGY EAEF F+  KV+ + GF IL +++  GG     YIG+K+W NPGAF GD
Sbjct: 215 SINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAFVGD 274

Query: 322 KSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSIT 381
            +  +FK + S           +E + + A+E  +PR+++P AAK + +RI   ++ S+ 
Sbjct: 275 TAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLL 334

Query: 382 LVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYS 441
           +VG LVPY    L+GS      ASP+V+A+ +HG++ +P  IN VIL +VLSV NS+ +S
Sbjct: 335 MVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFS 394

Query: 442 SCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAIS 501
             R L +LS+QG+ P+ F YIDR+GRP  ++I S+ F ++ F A S + +++F W+L++S
Sbjct: 395 CSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLS 454

Query: 502 GLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWV 561
           GLS LF W+ I + HIRFR+A+  Q RS+DE+ F S +G+WGS Y+  ++ + LI +FW+
Sbjct: 455 GLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWI 514

Query: 562 SIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGX 621
           ++ P G     A NFF+ YL+MPI + +Y G+KI  ++WKL I  K +D+ + R+  D  
Sbjct: 515 ALFP-GHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELDIE 573

Query: 622 XXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           PF  +V  FWC
Sbjct: 574 LFKQELLEQNAIMAKKPFIYRVYNFWC 600

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  389 bits (998), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/605 (36%), Positives = 324/605 (53%), Gaps = 33/605 (5%)

Query: 45  ENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENE 104
           E+TT +    + +DS F  + K    P  N     +    D FRR ED +     DI N 
Sbjct: 31  ESTTFVTELTSKTDSAFPLSSKDS--PGINQTTNDITS-SDRFRRNEDTE---QEDINNT 84

Query: 105 LTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKA 164
                                    +L K +  RH+                  +AL   
Sbjct: 85  -------------------------NLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTG 119

Query: 165 GPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQ 224
           GP  LVI + I+ +CL+ +I + GE++ A+  + G FN Y    ++ +F F+V   Y  Q
Sbjct: 120 GPASLVIDWVIISTCLFTVINSLGELSAAFP-VVGGFNVYSMRFIEPSFAFAVNLNYLAQ 178

Query: 225 WLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVL 284
           WL ++PLELV AS+TI+YW   +N+D                  K + E EF  +  K+L
Sbjct: 179 WLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKIL 238

Query: 285 MMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGAS 344
            + GF IL IV++ GG  + GYIG KYWH+PGAF G  S  +FK + S            
Sbjct: 239 SIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGI 298

Query: 345 EFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATK 403
           E  A+ A+E  NPR  IP AAK   + I   ++T +TL+G LVP N   L+ GS S    
Sbjct: 299 EMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAA 358

Query: 404 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
           +SP VIA+ + G++ +P  +NA+IL++V+SVANSA Y+  R + +++  G  P + N +D
Sbjct: 359 SSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVD 418

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           + GRP  A++++  F +++F A S K+ +VFTWL A+SGLS +F W+AI +SHIRFR+AM
Sbjct: 419 KRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAM 478

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAM 583
           KVQ RS+DE+ F SQ GV GS Y  I++ L LIA FW S+ P+G     A++FFE YL+ 
Sbjct: 479 KVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSF 538

Query: 584 PILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKV 643
           PILIV Y G+K+  R+W L ++ +D+DL + RK  D                   F  + 
Sbjct: 539 PILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFVTRF 598

Query: 644 VAFWC 648
           + FWC
Sbjct: 599 LHFWC 603

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  387 bits (995), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/608 (36%), Positives = 329/608 (54%), Gaps = 34/608 (5%)

Query: 70  LPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLS----------PLSA----- 114
           +P   +K+ +   ++D F+ +    APT  + E + +  ++          PLSA     
Sbjct: 1   MPKNPLKKEYWADVVDGFKPS----APTGPENEKDSSAFVTEQTPKTDSGFPLSAKGSSG 56

Query: 115 ----TKDPQFAPHAEEKDD---------HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSAL 161
               T D   +      DD         +L K +  RH+                  +AL
Sbjct: 57  VNQTTNDITSSGRFHSDDDVQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAAL 116

Query: 162 HKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVY 221
              GP  LVI + I+ +CL+ +I + GE++ A+  + G FN Y    V+ +F F+V   Y
Sbjct: 117 STGGPASLVIDWVIISTCLFTVINSLGELSAAFP-VVGGFNVYSMRFVEPSFAFAVNLNY 175

Query: 222 CLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSC 281
             QWL ++PLELV AS+TI+YW   +N+D                  K + E EF  +  
Sbjct: 176 LAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMI 235

Query: 282 KVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXX 341
           K+L + GF IL IV++ GG  + GYIG KYW++PGAF G  S  +FK + S         
Sbjct: 236 KILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHDSGTKFKGLCSVFVTAAFSY 295

Query: 342 GASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSA 400
              E  A+ A+E  NPR  IP AAK   + I   ++T +TL+G LVP N   L+ GS S 
Sbjct: 296 SGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSV 355

Query: 401 ATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFN 460
              +SP VIA+ +  ++ +P  +NA+IL++V+SVANSA Y+  R + +++  G  P +  
Sbjct: 356 DAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLR 415

Query: 461 YIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFR 520
            +D+ GRP  A++++  F +++F A S K+ +VFTWL A+SGLS +F W+AI +SHIRFR
Sbjct: 416 RVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 521 RAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENY 580
           +AMK Q RS+DE+ F SQ GVWGS Y  +++ L LIA FW S+ PIG    +A++FFE Y
Sbjct: 476 QAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGY 535

Query: 581 LAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFW 640
           L+ PILIV YFG+KI  RDW+L ++ +D+DL + RK  D                   F 
Sbjct: 536 LSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFL 595

Query: 641 KKVVAFWC 648
            + +  WC
Sbjct: 596 TRFLRVWC 603

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  387 bits (993), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/595 (36%), Positives = 325/595 (54%), Gaps = 34/595 (5%)

Query: 75  IKQPHLRKLIDSFRRAED---------------IDAPTNR-----DIENELTTTLSPLSA 114
           ++   L K+++ F+ AED               +D    +     ++ N+ T+T+S  S 
Sbjct: 6   LRNGPLNKIVNGFKSAEDEKSILEGKSSTQSSLLDLTLKKCDNGIEVVNDATSTVSNASV 65

Query: 115 TKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYA 174
           T            + +L K +  RH+                  +AL   GP  LVI + 
Sbjct: 66  T------------NVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWV 113

Query: 175 IMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELV 234
           I+ +CL+ +I A GEMA A+  + G FN Y +  VD + GF+V   Y  QWL ++PLELV
Sbjct: 114 IISTCLFTVINALGEMAAAFP-VVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELV 172

Query: 235 TASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAI 294
            ASMTI+YW  T+N+D                  K + E EF  +  K+L + GF IL I
Sbjct: 173 AASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGI 232

Query: 295 VINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQ 354
           V++ GG    GY+G KYWHNPG+F G  S  +FK + S            E  A+ A+E 
Sbjct: 233 VLSCGGGPQGGYLGGKYWHNPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAES 292

Query: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVAS 413
            +PRR IP AAK   + I   ++T +TL+G LVPY+   L+ GS S    +SP VIA+ +
Sbjct: 293 KDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIEN 352

Query: 414 HGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMI 473
            G++ +P  +NA+IL+S++SVANSA Y+  R + +++  G  P    +ID++GRP  A++
Sbjct: 353 GGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAIL 412

Query: 474 MSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEI 533
            +  F +++F A S K+ +VFTWL A+SGLS +F W+AI +SHIRFR+AMK Q +S+DE+
Sbjct: 413 FTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDEL 472

Query: 534 GFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGY 593
            + SQ GVWGS Y  I++ L LI  FW S+ P+G    DA++FF+ YL+ PILI  Y G+
Sbjct: 473 PYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGH 532

Query: 594 KICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           K+  R  ++ +  +D+D+ + R+  D                   F+ + +  WC
Sbjct: 533 KLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  385 bits (990), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 202/573 (35%), Positives = 318/573 (55%), Gaps = 10/573 (1%)

Query: 82  KLIDSFRRAEDIDA-----PTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136
           KL  SF+R E+++       +N D++  +      +   +   F  +  ++  +L + + 
Sbjct: 20  KLFSSFKRMEEVEVVESLTKSNYDVQ-VMGKKYEDMDDVEKAIF--NTTKRSLNLNRDLS 76

Query: 137 PRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196
            RH+                  SAL+  GP  LVI + I+ +CL+ I+ A GE+A  +  
Sbjct: 77  IRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFP- 135

Query: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXX 256
           + G FN Y + LVD + GF+V   Y  QW  ++PLELV AS+TI+YW  +VN+D      
Sbjct: 136 VVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSDAWVAVF 195

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316
                       K + E EF  +  K+L + GF IL IV+  GG   +GYIGAKYW++PG
Sbjct: 196 YVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPG 255

Query: 317 AFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIF 376
           +F G     +FK + S           +E + + A+E +NPR  +P A+K   + I   +
Sbjct: 256 SFVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSY 315

Query: 377 LTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVA 435
           L  +T++G LV ++  +L+  S S    ASP VIA+ + G++ +P  +NA+IL++++SVA
Sbjct: 316 LLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVA 375

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS+ Y+  R + S+++ G  P  F YID  GRP  A+I + +F +++F A S+K+E++F 
Sbjct: 376 NSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFV 435

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL A+SGLS LF W+AI +SHIRFRRA+  QG S+DE+ + S  GV GS Y  +++ L L
Sbjct: 436 WLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILVL 495

Query: 556 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHR 615
           IA FW S+ P G    D ++FF+ YL++PI +  + G+K+ KR+W   IR+  ID+ + R
Sbjct: 496 IASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKIDVNTGR 555

Query: 616 KIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           ++ D                   F  K+   WC
Sbjct: 556 RMIDKEELEKEKQEFNEYMARKSFIAKLWNLWC 588

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  385 bits (988), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/571 (39%), Positives = 324/571 (56%), Gaps = 26/571 (4%)

Query: 82  KLIDSFRR--AEDIDAPTNRDIEN-ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           + +DSF+R   E++D P   D E   + T  SPL                   + T+K R
Sbjct: 55  RFVDSFKRIELEELD-PNLTDAEKIAIATARSPL-------------------KHTLKSR 94

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                   AL  AGP G++IG+ + G+ +Y ++ A GE+AV +  + 
Sbjct: 95  HLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGELAVVFP-VS 153

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXX 257
           G F  Y +  +DE+FGF++ + Y LQWL  +PLE+V+AS+T+ YW       D       
Sbjct: 154 GGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRDGFVALFW 213

Query: 258 XXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                    G KGY EAEF F   KV+ + GF I+A+++  GG    GYIGAKYWH+PGA
Sbjct: 214 VFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAKYWHHPGA 273

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           F GD +  +FK   +         G SE + +  SE  NPR+++P AAK + +RI   ++
Sbjct: 274 FVGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYV 333

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
             + L+G LVPYN   L+G+ S    ASP+VIAV + G+R +P  IN VIL+SVLSV NS
Sbjct: 334 LCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINVVILISVLSVGNS 393

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
           + Y   R L +L++QG+ P    YIDR GRP  A+ +++ F +IAF A SS E +VF WL
Sbjct: 394 SIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWL 453

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           LA+SGLS LF+W AIC+ HIRFRRA+  QGRS DE+ F S VG+ GS +   +  L LIA
Sbjct: 454 LALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIA 513

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617
           +F+V + P G    +A++FF  YL+ PI++  Y  +KI K++WKL+I+A+D+D+ + R+ 
Sbjct: 514 QFYVGLFPAGASP-NAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAEDMDIDTGRRE 572

Query: 618 YDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            D                  P W +   FWC
Sbjct: 573 VDRDLLKQEVAAERADLAARPIWYRCWKFWC 603

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  384 bits (987), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/589 (37%), Positives = 326/589 (55%), Gaps = 17/589 (2%)

Query: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSA--TKDPQ--------FAPHA 124
           +K+ +  ++I   + +E  +   N  +E E  +TLSPL++  +K P         FA   
Sbjct: 6   LKREYWNEMITGSKSSEAGNIDANFALE-EKDSTLSPLASLDSKVPHEKIQTTTDFASVI 64

Query: 125 EEKDD----HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCL 180
             +DD    +L K +  RH+                  +AL   GP  LVI + I+ +CL
Sbjct: 65  SHEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCL 124

Query: 181 YCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTI 240
           + +I A GEMA A+  + G FN Y +  +D + GF+V   Y  QWL ++PLELV ASMTI
Sbjct: 125 FTVINALGEMAAAFP-VVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTI 183

Query: 241 QYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGG 300
           +YW  T+N+D                  K + E EF  +  K+L + GF IL IV+  GG
Sbjct: 184 KYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGG 243

Query: 301 AGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRA 360
             + G+IG KYW++PG+F G  S  +FK + S            E  A+ A+E  +PR  
Sbjct: 244 GPHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTT 303

Query: 361 IPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVV 419
           IP AAK   + I   ++T +TL+G LVPY+   L+ G+ S    +SP VIA+ + G++ +
Sbjct: 304 IPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGL 363

Query: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479
           P  +NA+IL+S++SVANSA Y+  R + +++  G  P   N +D +GRP  A+I +  F 
Sbjct: 364 PSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFG 423

Query: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539
           +++F A S ++ DVFTWL A+SGLS +F W+AI +SHIRFR++M  Q RS+DE+ F SQ 
Sbjct: 424 LLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQT 483

Query: 540 GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD 599
           GVWGS Y  I++ L L+A FW S+ P+G    DA++FFE YL+ PIL+  YFG+K+  R 
Sbjct: 484 GVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRK 543

Query: 600 WKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +  +   D+DL + R+  D                   F+K  +  WC
Sbjct: 544 REFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  384 bits (985), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/593 (36%), Positives = 319/593 (53%), Gaps = 31/593 (5%)

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQF---------------- 120
           Q   ++++DSF+ AE     +  D        +SPL+ ++ P F                
Sbjct: 5   QSSWQRMLDSFKPAETYKQSSRND--------MSPLT-SEAPDFKKADAASGNESWALEN 55

Query: 121 ----APHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIM 176
               +  ++ +D    K +  RH+                  SAL   GPG LVI + I+
Sbjct: 56  VESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVII 115

Query: 177 GSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTA 236
            +CL+ I+ A GE++  +  + G FN Y S  V+ +FGF+V   Y  QW  ++PLELV A
Sbjct: 116 STCLFTIVNALGELSSTFP-VVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAA 174

Query: 237 SMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVI 296
           S+TI+YW +T+N+D                  K + E EF  +  K+L + GF IL IV+
Sbjct: 175 SLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVL 234

Query: 297 NTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
             GG    GYIG KYW NPGAF G+ S  RF  + S           +E IA+ A+E  N
Sbjct: 235 TCGGGPEGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVN 294

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHG 415
           PR  +P A K   + I   ++  +TLVG LVP +   L+ GS S    ASP VIA+ + G
Sbjct: 295 PRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGG 354

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
           ++ +P  +NA+IL++VLSVANSA Y+  R + S+++ G  P  F+Y+DR+GRP  A++ +
Sbjct: 355 IKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILAT 414

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
            +F +++F A S+K+E VFTWL A+SGLS LF W AI VSHIRFR  MK +GRS+DE+ F
Sbjct: 415 LIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPF 474

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595
            S  GVWGS Y  +++ + L+  FW ++ P  E    A++FFE YL+ PIL+V Y G+K+
Sbjct: 475 VSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKL 534

Query: 596 CKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             + W+L     +ID+ S R+  D                   +  + +  WC
Sbjct: 535 YTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  380 bits (977), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 202/500 (40%), Positives = 293/500 (58%), Gaps = 4/500 (0%)

Query: 124 AEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCI 183
           A E  ++L K +  RH+                  ++L+  GP  L+IG+ I+ S L+ +
Sbjct: 71  AFEYGENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTV 130

Query: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243
           I A GE+A  +  + G FN Y +  VD +F F+V   Y + W+  +PLELV AS+TI+YW
Sbjct: 131 INALGELAATFP-IVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW 189

Query: 244 TTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 303
              +N+D                  K ++EAEF  +  K+L + GFFIL IV+  GG   
Sbjct: 190 NREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPT 249

Query: 304 DGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPS 363
            GYIG KYW++PGAF GD +  RFK + S            E  A+ A+E  NPR+ IP 
Sbjct: 250 GGYIGGKYWNDPGAFHGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPK 309

Query: 364 AAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHF 422
           A K   + I F +++ +TL+G LVPYN   L+ GS S    ASP VIA+ + G++ +P  
Sbjct: 310 ATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSL 369

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
           +NA+IL+++LSVANS  Y   R++ S++     P  F+ +D+ GRP  ++  +    +++
Sbjct: 370 MNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLS 429

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           F A S K+E+VFTWL AI GLS +F WI I ++HIRFR A+K Q RS+DE+ + SQ G+W
Sbjct: 430 FIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIW 489

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
           GS Y  I++ L LIA FWVS+ P+GE   DA+ FFE YL+ PILI  Y G+K+  ++WK 
Sbjct: 490 GSWYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKW 549

Query: 603 FIRAK--DIDLVSHRKIYDG 620
            I  +  DIDL     I++G
Sbjct: 550 VIPLEEIDIDLGKKNTIWNG 569

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/597 (35%), Positives = 319/597 (53%), Gaps = 30/597 (5%)

Query: 56  DSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFR--RAEDIDAPTNRDIENELTTTLSPLS 113
           D +SD  ++  K  +   +  +   +  +D FR  R ED+D          + T  SPL 
Sbjct: 31  DVESDQNHDYYKDKVHVNDPNKSRFQNFVDGFRELRMEDVDPNLTAAERAAIATASSPL- 89

Query: 114 ATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGY 173
                             ++ +K RH+                   AL   GP  +VI +
Sbjct: 90  ------------------KRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAW 131

Query: 174 AIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLEL 233
            + GS +Y ++QA GE+AVA   + G++ +Y S  ++ +FGF++A+ Y +  L  MPLEL
Sbjct: 132 IMTGSMVYSVVQALGELAVALP-VSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLEL 190

Query: 234 VTASMTIQYWTTTVN-ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
           + AS+T+ YW      AD                G KGY EAEF F+  KV  + GF IL
Sbjct: 191 IAASITVNYWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIIL 250

Query: 293 AIVINTGGAGND-GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGA 351
            IV+  GG  +D GYIGA+YW+NPG F        FK   +           SE  A+ A
Sbjct: 251 GIVLVCGGGPSDEGYIGARYWYNPGGFA-----HGFKGFAAIFVTSAFSFAGSEMFALAA 305

Query: 352 SEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAV 411
           +E  NPR+ +P AAK + +RI   ++ S+TL+G LVPY    L  + S    ASP+VIA+
Sbjct: 306 AETENPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAI 365

Query: 412 ASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARA 471
           A  G++ +P  +N VIL++VLSV N   Y++ R + SL+  G+ P  F Y+DR+GRP   
Sbjct: 366 ARAGIKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVG 425

Query: 472 MIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVD 531
           +++ A+F +++F + SS   +VF W+LAISGL+  F W +ICV H+RFRRA+ VQGRS D
Sbjct: 426 ILLCAIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTD 485

Query: 532 EIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYF 591
           E+ +K+Q G+WGS Y   ++ + L  +FWV++ PIG    +A +FF  YL++P++I  Y 
Sbjct: 486 ELSYKAQTGIWGSLYGIGLIFIVLCFQFWVALFPIGGSP-NANHFFSAYLSLPVVIFFYT 544

Query: 592 GYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +K+  R W   I++ DID+ + R+  D                + P W ++  FWC
Sbjct: 545 CHKLYTRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  380 bits (976), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/590 (36%), Positives = 324/590 (54%), Gaps = 17/590 (2%)

Query: 75  IKQPHLRKLIDSFR----RAEDIDAPTNRDIENELTTTLSPLS-ATKDP----------Q 119
           +K+ +   +ID FR      E+    ++  + +  + T SP +  +KD           Q
Sbjct: 7   LKKEYWADVIDGFRAPDEEGEEGIGRSSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQ 66

Query: 120 FAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSC 179
            +   E+ +  L K +  RH+                  +AL   GP  LVI + I+ +C
Sbjct: 67  SSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTC 126

Query: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239
           L+ +I + GE+A A+  + G FN Y +  VD +F F+V   Y  QWL ++PLELV AS+T
Sbjct: 127 LFTVINSLGELAAAFP-VVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASIT 185

Query: 240 IQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299
           I+YW +T+N+D                  K + E EF  +  K+L + GF IL IV++ G
Sbjct: 186 IKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCG 245

Query: 300 GAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRR 359
           G    GY+G KYWHNPGAF G  S  +FK + S            E  A+ A+E  +PR+
Sbjct: 246 GGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRK 305

Query: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRV 418
            IP AAK   + I   ++T +TLVG LVPY+   LM G+ S    ASP VIA+ + G++ 
Sbjct: 306 TIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKG 365

Query: 419 VPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALF 478
           +   +NA+IL+S++SVANSA Y+  R + S++  G  P     +D+ GRP  A +++  F
Sbjct: 366 LDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFF 425

Query: 479 SVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQ 538
            +++F A S K+ +VFTWL A+SGLS +F W+AI +SHIRFR+AM  Q RS+DE+ + SQ
Sbjct: 426 GLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQ 485

Query: 539 VGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKR 598
            GVWGS Y  +++ L L+A FW S+ P+G D  D Q+FFE YL++PILIV Y G+K+  +
Sbjct: 486 TGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFK 545

Query: 599 DWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           +W   +  +++DL + RK  D                   F K+    WC
Sbjct: 546 NWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHVWC 595

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  380 bits (975), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 221/627 (35%), Positives = 331/627 (52%), Gaps = 53/627 (8%)

Query: 29  NSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFR 88
           +SD K     N     E  T I +   + D +F  +     +     K P  R++IDSF+
Sbjct: 12  SSDIKYKSSKN-----EFITIIESDNKNIDDNFIPHDTLSTISRKEKKPPIYRRIIDSFK 66

Query: 89  RAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXX 148
             ED    T                                +L+K++K RH+        
Sbjct: 67  PPEDGSFHTG-------------------------------NLKKSLKSRHLIMIAIGGS 95

Query: 149 XXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFL 208
                      AL   GP  ++IG+A+ GS +   I   GE+ V +  + G F +Y +  
Sbjct: 96  IGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIHGLGEITVRFP-VVGAFASYTTRF 154

Query: 209 VDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGA 268
           +D +  F V+ +Y LQW  V+PLE++ +++T+QYW  +++                  GA
Sbjct: 155 LDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGA 214

Query: 269 KGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFK 328
           +G+ EAEF F++ K++ + GF IL IV+  GG  +  YIGAKYWHNPG+         FK
Sbjct: 215 RGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEYIGAKYWHNPGSLA-----HGFK 269

Query: 329 DVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVP 388
            V+S         G +E   + AS +++P+  +PSA K + +RILF FL S+TLVGFLVP
Sbjct: 270 GVLSVLVVASYSLGGTEMTCL-ASGETDPKE-LPSAIKQVFWRILFFFLVSLTLVGFLVP 327

Query: 389 YNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYS 448
           Y +  L+G  S     SP+VIA+  H ++V+P  +NAVIL+S+LSV NS  ++S R L S
Sbjct: 328 YTNPNLLGGSSVDN--SPFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCS 385

Query: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508
           ++ Q   P WF YIDR GRP   +I+++LF ++AF   SS   +VF WL+AI+GL+    
Sbjct: 386 MAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIV 445

Query: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG- 567
           W++I + H+RFR AMK Q R++DE+ F S VG+WGS Y+ I+  L L+A+F++++ PIG 
Sbjct: 446 WLSINICHVRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGG 505

Query: 568 --EDHLDAQNFFENYLAMPILIVLYFGYKICKR----DWKLFIRAKDIDLVSHRKIYDGX 621
             +    A+ FF+NYL   ILIVL+ G+KI  R     W  +I  KDIDL + RK  D  
Sbjct: 506 WTDSGTRAKKFFQNYLCALILIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIE 565

Query: 622 XXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                         + P++ +    WC
Sbjct: 566 IIKQEIHEKKMYLASKPWYVRQFHVWC 592

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  378 bits (970), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/592 (38%), Positives = 321/592 (54%), Gaps = 26/592 (4%)

Query: 61  FEYNGKKKILPSFNIKQPHLRKLIDSFRR--AEDIDAPTNRDIEN-ELTTTLSPLSATKD 117
             Y       P   I +   R  +DSF+R   E++D P   DIE   + T  SPL     
Sbjct: 35  LSYKDLSNTTPESTIDKSRWRNFLDSFKRIEVEEVD-PNLTDIEKIAIKTARSPL----- 88

Query: 118 PQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMG 177
                         Q  +K RH+                   AL  AGP G++IG+ I G
Sbjct: 89  --------------QHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITG 134

Query: 178 SCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTAS 237
           + ++ ++ A GE+AV +  + G F  Y +  +DE+FGF+  + Y  QWL  +PLE+V AS
Sbjct: 135 TMIFTMVMALGELAVVFP-VSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAAS 193

Query: 238 MTIQYWTTTVN-ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVI 296
           +T+ YW T V   D                G +GY EAEF F+  KV+ + GF IL I++
Sbjct: 194 ITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIIL 253

Query: 297 NTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
             GG    GY+G +YWH+PGAF G     RFK   S           SE + I ++E  N
Sbjct: 254 VCGGGPVGGYVGGRYWHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKN 313

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGV 416
           PR+++P AAK + +RIL  ++  + LVG LVPY    L+GS      ASP+VIA+ +HG+
Sbjct: 314 PRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGI 373

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
             +P  +N VIL+SVLSV NS+ Y+  R L +LS+QG+ P    YIDR+GRP   + + +
Sbjct: 374 SGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICS 433

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
            F +IAF A S+K+E +F WLLAISG+S   TW +IC  HIRFR A+KV GRS DE+ FK
Sbjct: 434 GFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFK 493

Query: 537 SQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIC 596
           S VG+ GS +   +  L L+A+F+ ++ PIG    +A +FF  YLA PI++  Y  +K+ 
Sbjct: 494 SPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSP-NAYDFFSAYLAAPIVLAFYIAHKLW 552

Query: 597 KRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           KR+WKL I  KDID+ + R+  D                  P+W +V  FWC
Sbjct: 553 KRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  379 bits (972), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/570 (36%), Positives = 313/570 (54%), Gaps = 6/570 (1%)

Query: 82  KLIDSFRRAEDIDAPTNRDI-ENELTTTLSPLSATKDPQFAP-HAEEKDDHLQKTIKPRH 139
           +L++ F+RA++    T R + ++++           D + A   A      L K +  RH
Sbjct: 60  RLLNDFKRADE--GETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRH 117

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                  ++L+  GPG ++I + ++ +CL+ I+ + GE+A A+  + G
Sbjct: 118 LLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFP-VVG 176

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
            FN Y +  V+ +FGF+V   Y  QW  ++PLEL  AS+TI+YW   +N+D         
Sbjct: 177 GFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVC 236

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                    K + E EF  +  K+L + GF IL  V+  GG    G+IGAKYWH+PGAF 
Sbjct: 237 IALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFV 296

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
           GD    +FK + S           +E + + A+E  NPR  IP A+K   + I   +L  
Sbjct: 297 GDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLV 356

Query: 380 ITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSA 438
           +T+ G LVP N   L+ G  S    ASP VIA+ + G+R VP  +NA+IL++++SVANS+
Sbjct: 357 LTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSS 416

Query: 439 FYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLL 498
            Y+  R + S++Q G  P  FNYIDR+GRP  A++ + +F +++F A S K+E +FTWL 
Sbjct: 417 VYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLS 476

Query: 499 AISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAE 558
           A+SGLS LF W AI +SHIRFRRAM  Q RS+DE+ + S  GV GS Y A ++   L+  
Sbjct: 477 ALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLS 536

Query: 559 FWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIY 618
           FW S+ P G     A++FFE YL+ PI ++ Y  +K+ KRDW+LFI A  ID+ S R+  
Sbjct: 537 FWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRAL 596

Query: 619 DGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           D                  PF+ +   FWC
Sbjct: 597 DIEELKEQKLREQAETAKKPFYVRWWIFWC 626

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  378 bits (970), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 209/527 (39%), Positives = 303/527 (57%), Gaps = 4/527 (0%)

Query: 125 EEKDDHLQ--KTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
           E+ D H Q  K +  RH+                  +AL   GP  LVI + I+ +CL+ 
Sbjct: 88  EDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFT 147

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           ++ + GE+A A+  + G FN Y +  +D +FGF+V   Y  QWL ++PLELV AS+TI+Y
Sbjct: 148 VVNSLGELAAAFP-VVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRY 206

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           W   +N+D                  K + E EF  +  K+L + GF IL IV++ GG  
Sbjct: 207 WNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGP 266

Query: 303 NDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
             GYIG KYWH+PGAF G+ S  +FK + S            E  A+ A+E  NPR  IP
Sbjct: 267 KGGYIGGKYWHDPGAFVGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIP 326

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPH 421
            AAK   + I   ++T +TL+G LVPYN+ +L+ GS S    +SP VIA+ + G+R +P 
Sbjct: 327 KAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPS 386

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
            +NA+IL++++SVANSA Y+  R + S+++    P +   +DR+GRP  A +++  F ++
Sbjct: 387 LMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLL 446

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           +F A S K+E+VFTWL A+SGLS +F W+AI +SHIRFR+AM  QG S+DE+ + S  GV
Sbjct: 447 SFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGV 506

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
            GS Y  I++ L L+A FW S+ P+G    DA +FFE YL+ PILIV Y G+K+  R  +
Sbjct: 507 SGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKR 566

Query: 602 LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           L I   D+DLVS RK+ D                   F+ + +  WC
Sbjct: 567 LLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLHLWC 613

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/569 (39%), Positives = 321/569 (56%), Gaps = 25/569 (4%)

Query: 81  RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140
            +  DSFR AE +D          L  +L+P  A K      +A      L++T+K RH+
Sbjct: 43  ERFKDSFREAETVD----------LDPSLTP--AEKMAILTANAP-----LKRTLKSRHL 85

Query: 141 XXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200
                              +L  AGP G++IG+A+ G+ +YC++ A GE+AV +  + G 
Sbjct: 86  QMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VAGG 144

Query: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXX 259
           +  Y S  VDE+FGF+   VY + WL  +PLE+V AS+T+ YW T     D         
Sbjct: 145 YTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVV 204

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                  G KGY EAEF F+  KV+ + GF IL +++  GG    GYIG + WHNPGAF 
Sbjct: 205 IVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFA 264

Query: 320 GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
                + FK V S           SE + + A+E +NPR++IPSAAK + +RI   ++ +
Sbjct: 265 -----NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILA 319

Query: 380 ITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
           + +VG LVPY S  L+G  S    ASP+VI++ + G++ +P  IN VIL++VLSV N A 
Sbjct: 320 LLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAV 379

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           +   R + +L+ QG  P  F YIDR GRP   ++++ +F +++F A S KE +VF WLLA
Sbjct: 380 FGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLA 439

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           +SGLS LFTW  I + HIR RRA+  Q R+  E+ F +   VWGS Y+ I++ L LIA+F
Sbjct: 440 LSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQF 499

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           W+++ PIG     A  FFE YL+ PI IV Y G+KI K++WKLFI+A DID+ S R+  D
Sbjct: 500 WIALFPIGGKP-SAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETD 558

Query: 620 GXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                           + PF+ ++  FWC
Sbjct: 559 IEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/613 (34%), Positives = 326/613 (53%), Gaps = 38/613 (6%)

Query: 54  VNDSDSDFEYNGKKKILPSFNIK-------QPHLRK----LIDSFRRAED--IDAPTNRD 100
           V D +  F  +GK++   S ++        QP  RK     +D+FRRAE   ID   +  
Sbjct: 12  VEDIEKSFYVSGKEQARVSTDLAVDEPISVQPEPRKGWNGFVDTFRRAEMPVIDPNLSEA 71

Query: 101 IENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSA 160
            +  + T  +PLS                   + +K RH+                   A
Sbjct: 72  EKLAIRTAAAPLS-------------------RRLKNRHLQMIAIGGAIGVGLFVGSGKA 112

Query: 161 LHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWV 220
           L  AGP G++IG+ +  + +  +  + GE+AV +  + G +  Y +  +DE++GF+  + 
Sbjct: 113 LATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYAARFIDESWGFANNFN 171

Query: 221 YCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXX-XXXXXXXXXGAKGYAEAEFFFN 279
           Y +Q + VMPLE+V AS+T+ YW T                      G +G+ EAE  F+
Sbjct: 172 YMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFS 231

Query: 280 SCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXX 339
             KV+ + GF I+ +V+ +GG  +   IG KYW++PG F G+   D+FK V S       
Sbjct: 232 LIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGVCSVFVTAAF 291

Query: 340 XXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGS 399
               SE I + A+E   PR++IP AAK + +RI   ++ S+ +VG LVP N+  L+    
Sbjct: 292 SFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQ 351

Query: 400 AATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
                SP+VIA+  H +RV+P  IN VIL +V+SV NS+ YSS R + +L++ G+ P  F
Sbjct: 352 IDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIF 411

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
            YIDR+GRP  A+  ++LF ++ F A + +E ++F WLLAISGLS  FTW+ I ++H+RF
Sbjct: 412 GYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRF 471

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQN---- 575
           R A+K QGR+ +E+ F S  G  GS YA  ++ + L+A+FWV++ P   D   A+     
Sbjct: 472 RMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPIL 531

Query: 576 FFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXX 635
           FF+ YL+  + IV+Y  +KI  R+WK FI+AK++D+ + R+  D                
Sbjct: 532 FFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEELAQERALLA 591

Query: 636 NGPFWKKVVAFWC 648
             PF  +V  FWC
Sbjct: 592 QKPFIIRVFNFWC 604

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  376 bits (966), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/512 (39%), Positives = 302/512 (58%), Gaps = 5/512 (0%)

Query: 112 LSATKDPQFAPHAEEKD---DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGG 168
           ++ T +P  +    ++D    +L K +  RH+                  ++L+  GP  
Sbjct: 67  INGTSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPAS 126

Query: 169 LVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCV 228
           LVIG+ I+ + L+ +I + GE+A AY  + G F+ Y +  +D +  FS+   Y +QWL +
Sbjct: 127 LVIGWVIVSTALFTVINSLGELAAAYP-VVGGFSVYMTRFIDPSIAFSINLNYLVQWLVL 185

Query: 229 MPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAG 288
           +PLELV AS+TI+YW   +N+D                  K + E EF  +  K+L + G
Sbjct: 186 LPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIG 245

Query: 289 FFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIA 348
           F IL IV++ GG    GYIG KYWH+PGAF G  +  +FK + S            E IA
Sbjct: 246 FTILGIVLSCGGGPVGGYIGGKYWHDPGAFVGHTAGSQFKGLCSVFVTAAFSYSGIEMIA 305

Query: 349 IGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPY 407
           + A+E  +PR+ IP AAK   + I   ++T +TL+G LVPY+   L+ GS S    +SP 
Sbjct: 306 VSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPL 365

Query: 408 VIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGR 467
           VIA+ + G++ +P  +NA+IL++VLSVANSA Y+  R + S++  G  P     ID++GR
Sbjct: 366 VIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGR 425

Query: 468 PARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQG 527
           P  A +++  F +I+F A S K+ +VFTWL A+SGLS +F W+ I +SHIRFRRAM +QG
Sbjct: 426 PINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQG 485

Query: 528 RSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILI 587
           RS++E+ + SQVGV+GS Y  I++ L LIA FW S+ P+G    +A  FFE YL++PIL+
Sbjct: 486 RSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILL 545

Query: 588 VLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
             Y G+K   ++W+LF    +IDL S ++  D
Sbjct: 546 ACYVGHKFYFKNWRLFTPYNEIDLDSGKRDID 577

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  373 bits (957), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/518 (40%), Positives = 301/518 (58%), Gaps = 24/518 (4%)

Query: 85  DSFRRAEDIDA-PTNRDIEN-ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXX 142
           DSF+R E I   P   + E   + T  +PL                 HL    K RH+  
Sbjct: 57  DSFKRVEPIAVDPNLTEAEKVAIVTAQTPL---------------KHHL----KNRHLQM 97

Query: 143 XXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFN 202
                           +AL   GP  L+IG+   G+ +Y ++ A GE+AV +  + G F 
Sbjct: 98  IAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFT 156

Query: 203 AYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN-ADXXXXXXXXXXX 261
            Y +  +DE+FG++  + Y LQWL V+PLE+V+AS+T+ +W T     D           
Sbjct: 157 TYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIV 216

Query: 262 XXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD 321
                G KGY EAEF F+  KV+ + GF IL I++N GG    GYIG KYWH+PGAF GD
Sbjct: 217 IINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAGD 276

Query: 322 KSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSIT 381
               +FK V S           SE + + ASE   PR+++P AAK + +RI   ++ S+ 
Sbjct: 277 TPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLL 336

Query: 382 LVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYS 441
           ++G LVPYN   L+G+ S    ASP+VIA+ +HG++ +P  +N VIL++VLSV NSA Y+
Sbjct: 337 MIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYA 396

Query: 442 SCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAIS 501
             R + +L++Q + P  F Y+DR+GRP   + +++ F +IAF A S KE DVF WLLA+S
Sbjct: 397 CSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALS 456

Query: 502 GLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWV 561
           GLS LFTW  IC+ HIRFR+A+  QGR +DE+ FKS  GVWGS +   M+ +  IA+F+V
Sbjct: 457 GLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYV 516

Query: 562 SIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD 599
           ++ P+G     A+ FFE YL+ P+++ +Y G+KI KR+
Sbjct: 517 ALFPVGGSP-SAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  374 bits (960), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 222/646 (34%), Positives = 339/646 (52%), Gaps = 59/646 (9%)

Query: 12  RISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYN--GKKKI 69
           + SF+ E      EI +  D +    D      + T+ + A    +  ++E N  G    
Sbjct: 4   QTSFTDEGARRRSEINEFIDFEKKPVD-----IKKTSSVVATTKHAHDEYEDNFPGNGFY 58

Query: 70  LPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDD 129
            P  NI Q    + IDSF+                      PL  + D           +
Sbjct: 59  QPPRNIFQ----RCIDSFK---------------------PPLDGSFD----------TN 83

Query: 130 HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGE 189
           +L++++K RH+                   A+   GP  +VIG+AI GS +   I   GE
Sbjct: 84  NLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGE 143

Query: 190 MAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNA 249
           + V +  + G F  Y +  +D +  F ++ +Y +QW  V+PLE+++++MT+QYW  +++ 
Sbjct: 144 ITVRFP-VVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSIDP 202

Query: 250 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGA 309
                            GA+G+ EAEF F+S KVL + GF IL IV+  GG  +  ++GA
Sbjct: 203 VVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVGA 262

Query: 310 KYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMI 369
           KYWH+PG          F  V+S         G +E + + AS +++P+  +PSA K   
Sbjct: 263 KYWHDPGCLA-----HGFPGVLSVLVVASYSLGGTEMVCL-ASGETDPKE-LPSAIKQTF 315

Query: 370 YRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILL 429
           +RILF FL S+TL+GFLVPY +  L+G  S     SP+VIA+  H ++V+P  +NAVIL+
Sbjct: 316 WRILFFFLVSLTLIGFLVPYTNENLLGGSS--VNNSPFVIAIKLHQIKVLPSIVNAVILI 373

Query: 430 SVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSK 489
           S+LSV NS  ++S R L S++ QG  P +F YIDR GRP   +I ++LF ++AF   SS 
Sbjct: 374 SILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSSS 433

Query: 490 EEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAI 549
             +VF WL+AI+GL+    W++I +SHIRFR AMK QGRS+DE+ F S VG+WGS+Y+A+
Sbjct: 434 MSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAV 493

Query: 550 MMTLALIAEFWVSIAPIG---EDHLDAQNFFENYLAMPILIVLYFGYKICKR----DWKL 602
           + +L L+A+F+ ++ PIG      + A+ FF++YL   I+IVL+ G+KI  R     W  
Sbjct: 494 INSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWWS 553

Query: 603 FIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +    IDL + RK  D                  P++ +   FWC
Sbjct: 554 MLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVRWYHFWC 599

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  374 bits (960), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/538 (36%), Positives = 301/538 (55%), Gaps = 2/538 (0%)

Query: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVI 171
           +  T   QF+   E+ +++L K +  RH+                  +AL   GP  LVI
Sbjct: 73  IETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVI 132

Query: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231
            + I+ +CL+ +I A GE+A AY  + G FN Y +  VD +  F++   Y  QWL ++PL
Sbjct: 133 DWVIISTCLFTVINALGELAAAYP-VVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPL 191

Query: 232 ELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFI 291
           ELV AS+TI+YW  T+N+D                  K + E EF  +  K+L + GF I
Sbjct: 192 ELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTI 251

Query: 292 LAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGA 351
           L IV+  GG    G++G  YWH+PG+F GDK   +FK + S            E  A+ A
Sbjct: 252 LGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSA 311

Query: 352 SEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIA 410
           +E  +PR+ IP A K   + +   ++T +T++G LVP++   L+ GS S    ASP VI+
Sbjct: 312 AESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVIS 371

Query: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470
           + + G++ +   +NA+IL+S++SVANSA Y+  R + S++  G  P   + +D+ GRP  
Sbjct: 372 IKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVN 431

Query: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530
           A++ +  F +++F A S K+ +VFTWL A+SGLS +F W+AI  SHIRFR AMKVQ +++
Sbjct: 432 AILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTL 491

Query: 531 DEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLY 590
           DE+ + SQ GV GS Y  I++ L L+A FW S+ P+G    D  +FFE YL++PILI  Y
Sbjct: 492 DELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACY 551

Query: 591 FGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            G+K+  R+ ++ ++ +D+DL + RK  D                   F K+    WC
Sbjct: 552 VGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHVWC 609

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  372 bits (956), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 202/546 (36%), Positives = 304/546 (55%), Gaps = 7/546 (1%)

Query: 109 LSPLSATKDPQFAPHAEE-----KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHK 163
           L PL+  KD       E+     KD  L K +  RH+                   +L  
Sbjct: 37  LKPLAEEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLST 96

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
            GP  LVI + I+ +CL+ I+ + GE++  +  + G FN Y +  V+ +FGF+V + Y  
Sbjct: 97  GGPASLVIAWTIISTCLFTIVNSLGELSATFP-VVGGFNVYVTRFVEPSFGFAVNFNYLA 155

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
           QW  ++PLEL  AS+TI+YW  ++N D                  K + E EF  +  K+
Sbjct: 156 QWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKI 215

Query: 284 LMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGA 343
           L + GF IL IV+  GG  + G+IG KYW++PGAF GD    RFK + +           
Sbjct: 216 LAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSG 275

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAAT 402
            E + + A+E  NPR  +P AAK   + I   +L  +TL+G LVP N   L+ G+ S   
Sbjct: 276 LELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDA 335

Query: 403 KASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYI 462
            ASP VIA+ + G++ +P  +NA+IL+++LSVANSA Y+  R + S+++ G  P    ++
Sbjct: 336 AASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHV 395

Query: 463 DREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRA 522
           D++GRP  A+ ++ L  +++F A S+K ++VFTWL A+SGLS LF W AI ++H+RFR A
Sbjct: 396 DKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHA 455

Query: 523 MKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLA 582
           MK Q RS++E+ + S  G WGS Y  I++ L LIA FW S+ P G +  DA +FFE+YL+
Sbjct: 456 MKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLS 515

Query: 583 MPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKK 642
           +PI I  Y G+KI KR+ +L+I+  ++D+ S R   D                  PF+ +
Sbjct: 516 LPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIR 575

Query: 643 VVAFWC 648
           +  FWC
Sbjct: 576 LWNFWC 581

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  365 bits (936), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/605 (35%), Positives = 321/605 (53%), Gaps = 27/605 (4%)

Query: 52  AAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAP-TNRDIENELTTTLS 110
           ++V DS  + +    K     +  KQ       +S     D D    NR+I      +  
Sbjct: 7   SSVKDSSEELKERRSKVEFVEYKSKQLTSSSSHNSKSSHHDDDGQYNNRNIFQRCVDSFK 66

Query: 111 PLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLV 170
           P     D  F         +L++T+KPRH+                   A+ + GP G+V
Sbjct: 67  P---PLDGSF------DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVV 117

Query: 171 IGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMP 230
           +G+ I GS +   +   GE+ V +  + G F  Y +  +D +  F V+ +Y LQW  V+P
Sbjct: 118 LGWTIAGSQIIGTVHGLGEITVRFP-VVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLP 176

Query: 231 LELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFF 290
           LE++ A+MT+QYW ++++                  GA+G+ EAEF F++ K + + GF 
Sbjct: 177 LEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFI 236

Query: 291 ILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIG 350
           IL IV+  GG  +  +IGAKYWH+PG          F  V+S         G  E   + 
Sbjct: 237 ILCIVLICGGGPDHEFIGAKYWHDPGCLA-----HGFPGVLSVLVVASYSLGGIEMTCL- 290

Query: 351 ASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIA 410
           AS +++P+  +PSA K + +RI+F FL S+TLVGFLVPY +  L+G  S     SP+VIA
Sbjct: 291 ASGETDPK-GLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDN--SPFVIA 347

Query: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470
           +  H ++V+P  +NAVIL+SVLSV NS  ++S R L S++ QG  P WF YIDR GRP  
Sbjct: 348 IKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLV 407

Query: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530
            ++ ++LF ++AF   S    +VF WL+AI+GL+    W++I +SH+RFR AMK QG+S+
Sbjct: 408 GIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSL 467

Query: 531 DEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG---EDHLDAQNFFENYLAMPILI 587
           DE+ F S VG+WGS Y+A++  L LIA+F+ S+ PIG        A+ FF+NYL   I++
Sbjct: 468 DELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMV 527

Query: 588 VLYFGYKICKR----DWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKV 643
            ++  +KI  R     W      KDIDL + RK  D                + P++ + 
Sbjct: 528 FIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLDSRPWYVRQ 587

Query: 644 VAFWC 648
             FWC
Sbjct: 588 FHFWC 592

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  364 bits (934), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/565 (36%), Positives = 312/565 (55%), Gaps = 26/565 (4%)

Query: 91  EDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXX 150
           +D    +NR+I      +  P     D  F         +L++T+KPRH+          
Sbjct: 48  DDDGEHSNRNIFQRCVDSFKP---PLDGSF------DTSNLKRTLKPRHLIMIAIGGSIG 98

Query: 151 XXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVD 210
                    A+ + GP G+V+G+ I GS +   I   GE+ V +  + G F  Y +  +D
Sbjct: 99  TGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFP-VVGAFANYGTRFLD 157

Query: 211 EAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKG 270
            +  F V+ +Y LQW  V+PLE++ A+MT+QYW ++++                  GA+G
Sbjct: 158 PSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARG 217

Query: 271 YAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDV 330
           + EAEF F++ K + + GF IL+IV+  GG  +  +IGAKYWH+PG        + F  V
Sbjct: 218 FGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLA-----NGFPGV 272

Query: 331 MSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390
           ++         G  E   + AS +++P+  +P A K + +RILF FL S+TLVGFLVPY 
Sbjct: 273 LAVLVVASYSLGGIEMTCL-ASGETDPK-GLPGAIKQVFWRILFFFLASLTLVGFLVPYT 330

Query: 391 STELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLS 450
           +  L+G  S     SP+VIA+  H ++V+P  +NAVIL+SVLSV NS  ++S R L S++
Sbjct: 331 NQNLLGGSSVDN--SPFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMA 388

Query: 451 QQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWI 510
            QG  P WF YIDR GRP   ++ ++LF ++AF   S    DVF WL+AI+GL+    W+
Sbjct: 389 HQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWL 448

Query: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG--- 567
           +I +SHIRFR AMK QG+S+DE+ F S VG+WGS+Y+A++  L LIA+F+ S+ PIG   
Sbjct: 449 SINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWS 508

Query: 568 EDHLDAQNFFENYLAMPILIVLYFGYKI---CKR-DWKLFIRAKDIDLVSHRKIYDGXXX 623
                A+ FF+NYL   I++ ++  +KI   C+   W      KDIDL + RK  D    
Sbjct: 509 SGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEII 568

Query: 624 XXXXXXXXXXXXNGPFWKKVVAFWC 648
                       + P++ +   FWC
Sbjct: 569 KQEIMERKMHLDSRPWYVRQFHFWC 593

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  363 bits (933), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/527 (38%), Positives = 300/527 (56%), Gaps = 17/527 (3%)

Query: 129 DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACG 188
            +L++T+KPRH+                   A+ + GP G+VIG+AI GS +   I   G
Sbjct: 76  SNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLG 135

Query: 189 EMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN 248
           E+ V +  + G F  Y +  +D +  F V+ +Y LQW  V+PLE++ A+MT+QYW ++++
Sbjct: 136 EITVRFP-VVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSID 194

Query: 249 ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIG 308
                             G +G+ EAEF F++ K + + GF IL +V+  GG  +  +IG
Sbjct: 195 PVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIG 254

Query: 309 AKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTM 368
           AKYWH+PG        + F  V+S         G  E   + AS +++P+  +PSA K +
Sbjct: 255 AKYWHDPGCLA-----NGFPGVLSVLVVASYSLGGIEMTCL-ASGETDPK-GLPSAIKQV 307

Query: 369 IYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVIL 428
            +RILF FL S+TLVGFLVPY +  L+G  S     SP+VIA+  H ++ +P  +NAVIL
Sbjct: 308 FWRILFFFLISLTLVGFLVPYTNQNLLGGSS--VDNSPFVIAIKLHHIKALPSIVNAVIL 365

Query: 429 LSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSS 488
           +SVLSV NS  ++S R L S++ QG  P WF YIDR GRP   ++ ++LF ++AF   S 
Sbjct: 366 ISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSG 425

Query: 489 KEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA 548
              +VF WL+AI+GL+    W++I +SHIRFR AMK QG+S+DE+ F S VG+WGS+Y+A
Sbjct: 426 SMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSA 485

Query: 549 IMMTLALIAEFWVSIAPIG---EDHLDAQNFFENYLAMPILIVLYFGYKI---CKR-DWK 601
           ++  L LIA+F+ S+ PIG        A+ FF+NYL   I++ ++  +KI   C+   W 
Sbjct: 486 LINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWW 545

Query: 602 LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
                KDIDL + RK  D                + P++ +   FWC
Sbjct: 546 GVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLDSRPWYVRQFHFWC 592

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  365 bits (936), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/641 (34%), Positives = 336/641 (52%), Gaps = 32/641 (4%)

Query: 11  DRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKIL 70
           DR + ST S+ E+K     S   + +  +   +F+N T I     D  ++          
Sbjct: 47  DRKNLSTTSQQELKNGEIYSLQSNLDFQDGTNHFDNETQIDIVSPDYKNE---------- 96

Query: 71  PSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEK--D 128
            + N+ +       D    ++DI     RD+++    + S +S+ +D       EE    
Sbjct: 97  -NINVDE-------DKLPFSDDI-----RDVKDRSDFSSSFVSSARDKD-----EETLLA 138

Query: 129 DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACG 188
             + K +  RH+                  S+L+  GP  LVIG+ I+ + L+ +I + G
Sbjct: 139 TDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLG 198

Query: 189 EMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN 248
           E+A A+  + G F+ Y    VD +F F+V   Y LQWL ++PLELV AS+TI+YW +++N
Sbjct: 199 ELAAAFP-VVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSIN 257

Query: 249 ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIG 308
           +D                  K + E EF  +  K+L + GFFIL IV++ GG  +  YIG
Sbjct: 258 SDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIG 317

Query: 309 AKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTM 368
            KYWH+PGAF G  S  +FK + S            E  A+ A+E  NPR  IP AAK  
Sbjct: 318 GKYWHDPGAFVGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRT 377

Query: 369 IYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVRVVPHFINAVI 427
            + I   +++ +TLVG LVPYN   LM GS S    +SP VIA+ +  +  +P  +NA+I
Sbjct: 378 FWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAII 437

Query: 428 LLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACS 487
           L+++LSVANS+ Y+  R + S+S+    P  F  +DR GRP  A+     F +++F A S
Sbjct: 438 LIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAAS 497

Query: 488 SKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYA 547
            K+ +VFTWL A+SGLS +F W+ I + HIRFR+ M VQ  S+DE+ F SQ G+WGS Y 
Sbjct: 498 DKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYG 557

Query: 548 AIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAK 607
            +++ L L+A FW S+ P+G    +A +FFE YL+ PIL+  Y  +K+  ++W+ +I A 
Sbjct: 558 IVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPAS 617

Query: 608 DIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +DL S RK  D                   F+ + +  WC
Sbjct: 618 KMDLHSGRKQVDLEVVREELRLEKEHLAQRSFFYRFLHVWC 658

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  362 bits (930), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/582 (35%), Positives = 314/582 (53%), Gaps = 33/582 (5%)

Query: 81  RKLIDSFRRAEDIDAPT----NRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136
           +  ID + R    + P      +   N     +      +D  F         +L+KT+K
Sbjct: 38  KTFIDVYSRRSSTEGPPVAKGTKPPRNIFQRAIDSFKPPEDGSF------DTSNLKKTLK 91

Query: 137 PRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196
            RH+                   AL   GP  ++IG+AI GS +   I   GE+ V +  
Sbjct: 92  ARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHGLGEITVRFP- 150

Query: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXX 256
           + G F  Y +  +D +  F V+ +Y +QW  V+PLE+++++MT+QYW  +++        
Sbjct: 151 VVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESIDPVVWVAIF 210

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316
                     G +G+ EAEF F++ KV+ ++GF +L I++  GG  +  Y+G++YWHNPG
Sbjct: 211 YVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYVGSRYWHNPG 270

Query: 317 AFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIF 376
                   + F  V+S         G +E   + AS +++P+  +PSA K + +RILF F
Sbjct: 271 CLA-----NGFPGVLSVMVVASYSLGGTEMTCL-ASGETDPKE-LPSAIKQVFWRILFFF 323

Query: 377 LTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVAN 436
           L S+TLVGFLVPY +  L+G  S     SP+VIA+  H ++V+P  +NAVIL+S+LSV N
Sbjct: 324 LVSLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKIHHIKVLPSIVNAVILISILSVGN 381

Query: 437 SAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTW 496
           S  ++S R L S++ Q   P WF YIDR GRP   +I ++LF ++AF   S    +VF W
Sbjct: 382 SCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDW 441

Query: 497 LLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALI 556
           L+AI+GL+    W++I VSHIRFR AMK QGRS++E+ F S VG+WGS Y+AI+  L L+
Sbjct: 442 LMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLILV 501

Query: 557 AEFWVSIAPIG-----EDHLDAQNFFENYLAMPILIVLYFGYKI-----CKRDWKLFIRA 606
           A+F++S+ PIG     ED   A+ FF++YL   I++ ++ G+KI       + W  F   
Sbjct: 502 AQFYISLWPIGGWKNSEDR--AKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWA-FTPL 558

Query: 607 KDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            +IDL   RK  D                + P++ +   +WC
Sbjct: 559 AEIDLDEGRKNIDLDVLKQEIHERKMYLKSRPWYIRFYHYWC 600

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  360 bits (923), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/565 (36%), Positives = 314/565 (55%), Gaps = 26/565 (4%)

Query: 91  EDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXX 150
           +D    +NR+I      +  P     D  F         +L++T+KPRH+          
Sbjct: 47  DDNHQYSNRNIFQRCVDSFKP---PLDGSF------DTSNLKRTLKPRHLIMIAIGGSIG 97

Query: 151 XXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVD 210
                    A+ + GP G+V+G+ I GS +   I   GE+ V +  + G F  Y +  +D
Sbjct: 98  TGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFP-VVGAFANYGTRFLD 156

Query: 211 EAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKG 270
            +  F V+ +Y LQW  V+PLE++ A+MT+QYW ++++                  G +G
Sbjct: 157 PSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVRG 216

Query: 271 YAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDV 330
           + EAEF F++ K + + GF IL IV+  GG  +  Y+GAKYW++PG        + F  +
Sbjct: 217 FGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCLA-----NGFPGI 271

Query: 331 MSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390
           +S         G  E   + AS +++P+  +PSA K + +RILF FL S+TLVGFLVPY 
Sbjct: 272 LSVLVVASYSLGGIEMTCL-ASGETDPK-GLPSAIKQVFWRILFFFLVSLTLVGFLVPYT 329

Query: 391 STELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLS 450
           +  L+G  S     SP+VIA+  H ++V+P  +N VIL+SVLSV NS  ++S R L S++
Sbjct: 330 NQNLLGGSS--VDNSPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMA 387

Query: 451 QQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWI 510
            QG  P WF YIDR GRP   ++ ++LF ++AF   S    DVF WL+AI+GL+    W+
Sbjct: 388 HQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWL 447

Query: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG--E 568
           +I VSHIRFR AMK QG+ +DE+ F S VG+WGS+Y+A++  L L+A+F+ S+ PIG  +
Sbjct: 448 SINVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWK 507

Query: 569 DHLD-AQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRA-KDIDLVSHRKIYDGXXX 623
           +  D A+ FF+NYL   I++ ++  +KI   C+      I+A KDIDL + RK  D    
Sbjct: 508 NSSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIV 567

Query: 624 XXXXXXXXXXXXNGPFWKKVVAFWC 648
                       + P++ +   +WC
Sbjct: 568 KQEIAEKKMYLDSCPWYVRHFHYWC 592

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  359 bits (921), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 218/641 (34%), Positives = 329/641 (51%), Gaps = 65/641 (10%)

Query: 28  KNSDAKSPEQDNIVEYFENTTGIPAAVND-------------SDSDFEYNGKKKILPSFN 74
           +NS +   E     E +E TT  P A++               D D    G     P  N
Sbjct: 4   ENSLSNEGENKQNSEIYEFTTFEPKALDSYKSSSFRTFTKQSKDDDDIAEGHSSYQPPRN 63

Query: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKT 134
           I Q    + IDSF+                      PL    D  F  H      +L++T
Sbjct: 64  IFQ----RCIDSFK---------------------PPL----DGSFHTH------NLKRT 88

Query: 135 IKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAY 194
           +K RH+                   AL   GP  L+IG++I G+ +   I   GE+ V +
Sbjct: 89  LKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRF 148

Query: 195 SGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXX 254
             + G F  Y +  +D +  F ++ +Y +QW  V+PLE++ ++MTIQYW  +++      
Sbjct: 149 P-VVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVA 207

Query: 255 XXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHN 314
                       GA+G+ EAEF F+S KV+ + GF IL IV+  GG  +  ++GA+YWH+
Sbjct: 208 IFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHD 267

Query: 315 PGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILF 374
           PG          F  V+S         G +E + + AS ++NPR  +PSA K   +RILF
Sbjct: 268 PGCLS-----HGFPGVLSVLVVASYSLGGTEMVCL-ASGETNPRE-LPSAIKQTFWRILF 320

Query: 375 IFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSV 434
            FL S+TL+GFLVPY +  L+G  S     SP+VIA+  H ++ +P  +NAVIL+S++SV
Sbjct: 321 FFLISLTLIGFLVPYTNPNLLGGSS--VNNSPFVIAIKLHHIKALPSIVNAVILISIMSV 378

Query: 435 ANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVF 494
            NS  ++S R L S++ QG  P +F YIDR GRP   ++ ++LF ++AF   SS   +VF
Sbjct: 379 GNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVF 438

Query: 495 TWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLA 554
            WL+AI+GL+    W++I +SHIRFR AMK QG+S+DE+ F S VG+WGS+Y+A++ +L 
Sbjct: 439 DWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLI 498

Query: 555 LIAEFWVSIAPIG---EDHLDAQNFFENYLAMPILIVLYFGYKICKR----DWKLFIRAK 607
           LIA+F+ ++ PIG   +    A+ FF++YL   I+  L+  +K+  R     W   +   
Sbjct: 499 LIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLD 558

Query: 608 DIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
            IDL + RK  D                  P++ +   FWC
Sbjct: 559 KIDLETDRKNIDIDVLKQEIAERNRHLQASPWYVRWYHFWC 599

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  354 bits (909), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/539 (36%), Positives = 302/539 (56%), Gaps = 19/539 (3%)

Query: 119 QFAPHAEEKDD--HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIM 176
            F P  +   D  +L++T+K RH+                   AL   GP  ++IG+ I 
Sbjct: 49  SFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIA 108

Query: 177 GSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTA 236
           GS +   I   GE+ V +  + G F  Y +  +D +  F V+ +Y +QW  V+PLE++ +
Sbjct: 109 GSQIVGTIHGLGEITVRFP-VVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIAS 167

Query: 237 SMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVI 296
           ++TIQYW ++++                  GA+G+ EAEF F++ K + + GF IL IV+
Sbjct: 168 AITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVL 227

Query: 297 NTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
             GG  +  +IGAKYWH+PGA         F  V+S         G +E   + AS +++
Sbjct: 228 ICGGGPDHEFIGAKYWHDPGALA-----HGFPGVLSVLVVASYSLGGTEMTCL-ASGETD 281

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGV 416
           P+  +PSA K + +RILF FL S+TLVGFLVPY +  L+G  S     SP+VIA+  H +
Sbjct: 282 PKE-LPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS--VDNSPFVIAIKLHHI 338

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
           + +P  +NAVIL+S+LSV NS  ++S R L S++ QG  P +F YIDR GRP   ++ ++
Sbjct: 339 KALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNS 398

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
           LF ++AF   SS   +VF WL+AI+GL+    W++I +SHIRFR AMK Q +++DE+ F 
Sbjct: 399 LFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFV 458

Query: 537 SQVGVWGSSYAAIMMTLALIAEFWVSIAPIG---EDHLDAQNFFENYLAMPILIVLYFGY 593
           S VG+WGS+Y+A++  L LIA+F++S+ PIG   +    A+ FF++YL   I+++++  +
Sbjct: 459 SAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIH 518

Query: 594 KICKR----DWKLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           K+  R     W      KDIDL + RK  D                  P+  +   FWC
Sbjct: 519 KVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  353 bits (905), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/580 (35%), Positives = 315/580 (54%), Gaps = 33/580 (5%)

Query: 81  RKLIDSFRRAE---DIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKP 137
           + + D +  AE   D     NR+I   +  +  P           +      +L++++K 
Sbjct: 32  KNIDDKYEHAESLTDYTKTENRNIFQRVIDSFKP---------PANGSFHTSNLKRSLKS 82

Query: 138 RHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGL 197
           RH+                   AL   GP  LV+G++I GS +   I   GE+ V +  +
Sbjct: 83  RHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFP-V 141

Query: 198 PGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXX 257
            G F  Y +  +D +  F ++ +Y LQW  V+PLE++++++T+QYW  T++         
Sbjct: 142 VGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFY 201

Query: 258 XXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                    G +G+ EAEF F++ KV+ + GF IL I++  GG     +IGAKYWH+PG 
Sbjct: 202 CAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGC 261

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
                  + F+  +S         G +E   + AS +++P+  +PSA K + +RILF FL
Sbjct: 262 LA-----NGFRGFLSVLITASYSLGGTEMTCL-ASGETDPKE-LPSAIKQVFWRILFFFL 314

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            S+TLVGFLVPY +  L+G  S     SP+VIA+  H ++V+P  +NAVIL+S+LSV NS
Sbjct: 315 VSLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHNIKVLPSIVNAVILISILSVGNS 372

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
             ++S R L S++ QG  P WF YIDR GRP   +++++LF ++AF   SS   +VF WL
Sbjct: 373 CIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVFDWL 432

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           +AI+GL+    W++I + HIRFR AMK Q +++DE+ F S VGVWGS Y+AI+ +L LI 
Sbjct: 433 MAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIV 492

Query: 558 EFWVSIAPIG--EDHLD-AQNFFENYLAMPILIV------LYFGYKICKRDWKLFIRAKD 608
           +F+VS+ PIG   D  D A  FF+NYL   + ++      LYF YK   + W   I  KD
Sbjct: 493 QFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKLYFRYK--TKKWWEIIPLKD 550

Query: 609 IDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           IDL + RK  D                  P++ +++  WC
Sbjct: 551 IDLDTGRKNIDIDIVKEEIKERKQYLATKPWYIRLMHHWC 590

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  348 bits (892), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/559 (36%), Positives = 303/559 (54%), Gaps = 26/559 (4%)

Query: 97  TNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXX 156
           T R+I   +  +  P     D  F        D+L+K++K RH+                
Sbjct: 48  TKRNIIQRMVDSFKP---PLDGSF------HSDNLKKSLKARHLIMIAIGGSIGTGLFIG 98

Query: 157 XXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS 216
              AL   GP  L+IG+ + G+ +   I   GE+ V +  + G F  Y +  ++ +  F 
Sbjct: 99  SGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRFP-VVGAFADYGTRFLEPSISFV 157

Query: 217 VAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEF 276
           V  +Y LQW  V+PLE++ A+MT++YW ++V                   G +G+ EAEF
Sbjct: 158 VVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEF 217

Query: 277 FFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXX 336
            F+  KVL + GF IL +V+  GG     ++GAKYW +PG        + FK V +    
Sbjct: 218 IFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPLA-----NGFKGVAAVFVI 272

Query: 337 XXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMG 396
                G +E +A  AS +++P+  +PSA K + +RI+F FL S+TLVGFLVPY +  LMG
Sbjct: 273 ASYSLGGTE-MACLASGETDPKE-LPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMG 330

Query: 397 SGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAP 456
             S     SP+VIA+  HG++ +P  +NAVIL+S+LSV NS  ++S R L S++ QG  P
Sbjct: 331 GSS--VDNSPFVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIP 388

Query: 457 SWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSH 516
             F YIDR GRP   ++ +  F ++AF   SS  +DVFTWL+AI+GL+    W++I VSH
Sbjct: 389 RIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSH 448

Query: 517 IRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG---EDHLDA 573
           IRFR AMK QG S+DE+ F S VGV+GS Y+A +  L L+A+F+VS+ P+G         
Sbjct: 449 IRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRT 508

Query: 574 QNFFENYLAMPILIVLYFGYKICKR----DWKLFIRAKDIDLVSHRKIYDGXXXXXXXXX 629
           +NFF+NYL   IL++L+ G+KI  R     W  F   +DIDL++  ++ D          
Sbjct: 509 ENFFQNYLCSLILLLLFAGHKIYYRISTGKWWGFKALRDIDLLTDMRVTDTELSKHELHE 568

Query: 630 XXXXXXNGPFWKKVVAFWC 648
                   P   ++   WC
Sbjct: 569 KRVKLAQKPLIVRLYHQWC 587

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/584 (34%), Positives = 315/584 (53%), Gaps = 52/584 (8%)

Query: 44  FENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIEN 103
             NT+ +   +    S  E +  + +  S   K+  +R+ IDSF+               
Sbjct: 14  LSNTSAVQRVLKKRSSVLEES--RLLEESRTNKRGLVRRCIDSFK--------------- 56

Query: 104 ELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHK 163
                  P+  + DP          D+L++T+K RH+                   AL  
Sbjct: 57  ------PPVDGSFDP----------DNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALAT 100

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
            GP  ++IG+ + G+ +   I   GE+ V +  + G F  Y +  +D +  F V+ +Y L
Sbjct: 101 GGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFP-VVGAFANYSTRFLDPSVSFVVSSIYVL 159

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
           QW  V+PLE++ +++T+++WTT+V+                  G + + + +F F+  K+
Sbjct: 160 QWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKM 219

Query: 284 LMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGA 343
           + + GF IL +V+  GG     +IGA+YWH+PGA       + FK V +         G 
Sbjct: 220 VPICGFIILCLVLILGGGPTHEFIGARYWHDPGALA-----NGFKGVAAVMVTASYSLGG 274

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATK 403
           SE   + AS +++P+  IP A K + +RI+F FL S+TLVGFLVPY + +L+G  +    
Sbjct: 275 SEMTCL-ASGETDPKE-IPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSN--VN 330

Query: 404 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
            SP+VIA+  H +RV+PH IN VIL+S+LSV NS  ++S R L S++ QG  P  F Y+D
Sbjct: 331 NSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVD 390

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           R GRP   ++ ++LF ++AF   SS    VFTWL+A++GL+    W++I VSHIRFR AM
Sbjct: 391 RAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAM 450

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI---GEDHLDAQNFFENY 580
           K QG+S+DE+ F S VG+WGS Y+ +M  + L+A+F+VS+ PI    +     + FF+NY
Sbjct: 451 KAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNY 510

Query: 581 LAMPILIVLYFGYKICKRD-----WKLFIRAKDIDLVSHRKIYD 619
           L   IL+ ++  +KI  R      WK+   A +IDL S RK  D
Sbjct: 511 LCALILLFMFVAHKIYYRSTTGQWWKILPLA-EIDLESGRKNID 553

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  340 bits (872), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/565 (33%), Positives = 300/565 (53%), Gaps = 27/565 (4%)

Query: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXX 152
           ++  T     N +   +       D  F P       ++++ +K RH+            
Sbjct: 46  LNGSTEERKRNVVQRVIDSFKPPVDGSFDP------SNMKRALKSRHLIMIAIGSSIGTG 99

Query: 153 XXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP--GNFNAYPSFLVD 210
                  AL   GP  L+IG+ + G+ +   I   GE+ V    LP  G F  Y +  +D
Sbjct: 100 LFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTVR---LPVVGAFADYSTRFLD 156

Query: 211 EAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKG 270
            +  F ++ +Y +QW  V+PLE++ + +T+++WT +V+                  G +G
Sbjct: 157 PSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVSINLLGVRG 216

Query: 271 YAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDV 330
           + EAEF F+S KV+ + GF IL IV+  GG     Y+G++YWH+PG        + FK V
Sbjct: 217 FGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLA-----NGFKGV 271

Query: 331 MSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390
            +         G SE   + AS +++P+  +P A K + +RILF FL S+TLVGFLVPY 
Sbjct: 272 AAVMVTASYSLGGSEMTCL-ASGETDPKE-LPHAIKQIFWRILFFFLVSLTLVGFLVPYT 329

Query: 391 STELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLS 450
           +  L+G  SA  + SP+V+A+  H V+VVPH +N VIL+S+LSV NS  ++S R L S++
Sbjct: 330 NENLLGGSSA--ENSPFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFASSRTLCSMA 387

Query: 451 QQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWI 510
            QG  P  F Y+DR GRP   ++ +++F ++AF    S   +VF+WL+AI+GL+    W+
Sbjct: 388 HQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIAGLATCVVWL 447

Query: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI---G 567
           +I VSH+RFR AMK Q +S+DE+ F S VGVWGS YA ++  L L+A+F++++ P+    
Sbjct: 448 SINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYIALWPVEGWK 507

Query: 568 EDHLDAQNFFENYLAMPILIVLYFGYK----ICKRDWKLFIRAKDIDLVSHRKIYDGXXX 623
           +    A+ FF+NYL   ILI ++  +K    I    W    +  ++DL + R   D    
Sbjct: 508 DSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSEVDLDTGRVNIDIEII 567

Query: 624 XXXXXXXXXXXXNGPFWKKVVAFWC 648
                       N  ++ +   +WC
Sbjct: 568 KEEVAERKKFLRNKAWYTRYYYYWC 592

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  335 bits (859), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/439 (40%), Positives = 262/439 (59%), Gaps = 10/439 (2%)

Query: 129 DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACG 188
           D L++++K RH+                   AL   GP  ++IG+ I G+ +   I   G
Sbjct: 75  DSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLG 134

Query: 189 EMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVN 248
           E+ V +  + G F  Y +  +D +  F V+ +Y LQW  V+PLE++ ++MTIQ+W T+++
Sbjct: 135 EITVRFP-VVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSID 193

Query: 249 ADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIG 308
                             G +G+ EAEF F+S KV+ ++GF IL IV+  GG     Y+G
Sbjct: 194 PVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVG 253

Query: 309 AKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTM 368
           A+YWH+PGA         FK V S         G SE +A  AS +++P+  +PSA K +
Sbjct: 254 ARYWHDPGALA-----HGFKGVASVFVTASYSLGGSE-MACLASGETDPKE-LPSAIKQV 306

Query: 369 IYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVIL 428
            +RI+F FL S+TLVGFLVPY +  L+G  S     SP+VIA   + ++V+P  INAVIL
Sbjct: 307 FWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS--VNNSPFVIACNLYHIKVLPSIINAVIL 364

Query: 429 LSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSS 488
           +S++SV NS  ++S R L S++ QG  P  F Y+DR GRP   +I ++LF ++AF   SS
Sbjct: 365 VSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSS 424

Query: 489 KEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA 548
              +VF WL+AI+GL+    W++I VSHIRFR AMK Q +++DE+ F S VG+WGS Y+A
Sbjct: 425 SMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSA 484

Query: 549 IMMTLALIAEFWVSIAPIG 567
           ++  L LIA+F++S+ P+G
Sbjct: 485 VVNVLILIAQFYISLWPVG 503

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 215/638 (33%), Positives = 330/638 (51%), Gaps = 63/638 (9%)

Query: 18  ESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQ 77
           E +Y+M   +K  +  SP   ++   F +  GI +   + D D + +  K I+       
Sbjct: 3   EDEYDM---SKMDNLLSPSSGDLEMKFSD--GIMSKETEIDLDKKEDKNKNIV------- 50

Query: 78  PHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKP 137
              R++IDSF+   D                                    D+L++ +K 
Sbjct: 51  ---RRMIDSFKPPLD-------------------------------GSYHSDNLKRKLKS 76

Query: 138 RHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGL 197
           RH+                   AL   GP  ++IG++I GS +   I   GE+ + +  +
Sbjct: 77  RHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFP-V 135

Query: 198 PGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXX 257
            G F  Y + L+D +  F V+ +Y  QW  V+P+EL+ ++MT+Q+WTT V+         
Sbjct: 136 VGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFY 195

Query: 258 XXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317
                    G K + EAEF F+  KV+ + GF IL+I++  GG  +  +IG +YWH+PGA
Sbjct: 196 VIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGA 255

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
                  + FK V S         G SE + +  S +++P+  +P A K + +RI+F FL
Sbjct: 256 LA-----NGFKGVASVFVTASYSLGGSEMVCL-CSAETDPKE-LPHAIKQVFWRIVFFFL 308

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            S+TLVGFLVPY +  L+G  S     SP+VIA+   G+RV+P  INAVIL+S+LSV NS
Sbjct: 309 VSLTLVGFLVPYTNENLLGGSS--VNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNS 366

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
             ++S R L S++ QG  P  F Y+DR GRP   +I+++LF ++AF   S+    VF WL
Sbjct: 367 CIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWL 426

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           +AI+GL+    W++I +SHIRFR AMK Q RS+DE+ FKS VGV+GS Y+A +  L LIA
Sbjct: 427 MAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIA 486

Query: 558 EFWVSIAPIG---EDHLDAQNFFENYLAMPILIVLYFGYKI---CKR-DWKLFIRAKDID 610
           +F++S+ P+G         ++FF+NYL   +L+ ++  +KI   C    W  F    +ID
Sbjct: 487 QFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEID 546

Query: 611 LVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           L + RK  D                + P++ +   FWC
Sbjct: 547 LETDRKNIDIEIVKQEVREREMYLASKPWYIRFYNFWC 584

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/465 (37%), Positives = 256/465 (55%), Gaps = 24/465 (5%)

Query: 85  DSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXX 144
           D  RR       TNR++   +  +  P    +D  F        D+L+K++K RH+    
Sbjct: 41  DGVRRRS-----TNRNVLQRMVDSFKP---PEDGSF------HSDNLKKSLKARHLVMIA 86

Query: 145 XXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAY 204
                          AL   GP  L+IG+ I G+ +   I   GE+ V +  + G F  Y
Sbjct: 87  IGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFP-VVGAFADY 145

Query: 205 PSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXX 264
            +  ++ +  F V  +Y LQW  V+PLE++ A+MT++YW T+V+                
Sbjct: 146 GTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALIN 205

Query: 265 XXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSI 324
             G +G+ EAEF F+  KV+ + GF IL IV+  GG     ++GAKYWH+PG        
Sbjct: 206 LVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLA----- 260

Query: 325 DRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVG 384
           + FK V           G +E   + AS +++P+  +PSA K + +RI+F FL S+TLVG
Sbjct: 261 NGFKGVAGVLVIASYSLGGTEMACL-ASGETDPKE-LPSAIKQVFWRIVFFFLVSLTLVG 318

Query: 385 FLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCR 444
           FLVPY +  LMG  S     SP+VIA+  HG+  +P  +NAVIL+S+LSV NS  ++S R
Sbjct: 319 FLVPYTNQNLMGGSS--VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSR 376

Query: 445 ILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLS 504
            L S++ QG  P  F YIDR GRP   ++ + LF ++AF   S    DVFTWL+AI+GL+
Sbjct: 377 TLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLA 436

Query: 505 QLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAI 549
               W++I +SHIRFR AMK QG  ++E+ F S VG++GS Y+AI
Sbjct: 437 TCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSAI 481

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/465 (37%), Positives = 256/465 (55%), Gaps = 24/465 (5%)

Query: 85  DSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXX 144
           D  RR       TNR++   +  +  P    +D  F        D+L+K++K RH+    
Sbjct: 41  DGVRRRS-----TNRNVLQRMVDSFKP---PEDGSF------HSDNLKKSLKARHLVMIA 86

Query: 145 XXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAY 204
                          AL   GP  L+IG+ I G+ +   I   GE+ V +  + G F  Y
Sbjct: 87  IGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFP-VVGAFADY 145

Query: 205 PSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXX 264
            +  ++ +  F V  +Y LQW  V+PLE++ A+MT++YW T+V+                
Sbjct: 146 GTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALIN 205

Query: 265 XXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSI 324
             G +G+ EAEF F+  KV+ + GF IL IV+  GG     ++GAKYWH+PG        
Sbjct: 206 LVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLA----- 260

Query: 325 DRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVG 384
           + FK V           G +E   + AS +++P+  +PSA K + +RI+F FL S+TLVG
Sbjct: 261 NGFKGVAGVLVIASYSLGGTEMACL-ASGETDPKE-LPSAIKQVFWRIVFFFLVSLTLVG 318

Query: 385 FLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCR 444
           FLVPY +  LMG  S     SP+VIA+  HG+  +P  +NAVIL+S+LSV NS  ++S R
Sbjct: 319 FLVPYTNQNLMGGSS--VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSR 376

Query: 445 ILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLS 504
            L S++ QG  P  F YIDR GRP   ++ + LF ++AF   S    DVFTWL+AI+GL+
Sbjct: 377 TLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLA 436

Query: 505 QLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAI 549
               W++I +SHIRFR AMK QG  ++E+ F S VG++GS Y+AI
Sbjct: 437 TCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSAI 481

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  317 bits (812), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 290/526 (55%), Gaps = 13/526 (2%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           D  L+KT++ RH+                   +L  +GPG L+IGY I+G  ++C++Q+ 
Sbjct: 63  DQPLRKTLQQRHLTMIAIGGTLGTGLFIGLGESL-ASGPGSLLIGYIIVGIAVFCVVQSA 121

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
            E++  Y  + G++    +  ++E+FGF+VA  YCL WL   P ELV ++M I+YW  +V
Sbjct: 122 AELSCQYP-VSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIRYWNDSV 180

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND-GY 306
           N+                 G +GYAE EF+ +  K++ +  F I+ IV+  GG  N  GY
Sbjct: 181 NSCVWIAIFWVFVMCLNLFGVEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGGPNSTGY 240

Query: 307 IGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAK 366
           IG KYWH+PG+F    +   FK + +         G  E + + ++E S    +I  AAK
Sbjct: 241 IGTKYWHDPGSF----AHPVFKSLCNTFVSAAYSFGGCEIVVLTSAE-SRKISSIARAAK 295

Query: 367 TMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHGV--RVVPHFI 423
              +RI   +L +I ++G LVPY   +L+ + S+    ASP+VIA+++ G     V HF+
Sbjct: 296 GTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGTRVSHFM 355

Query: 424 NAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAF 483
           N VIL+S +SV+NS  Y+S RI+ +L      PS   YIDR GRP   + +  LF ++ F
Sbjct: 356 NTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGLFGLLGF 415

Query: 484 CACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWG 543
              +  E  +FTWL +++ ++   TW +IC   +RFR A+K QGRS DEI +KS +G++G
Sbjct: 416 LVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKSMLGIYG 475

Query: 544 SSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-L 602
               AI+  + +I E ++SI P+ E    A  FF+N L++PI++V +FG+KI  + WK  
Sbjct: 476 GYVGAILNIVLIIGEVYISIFPLNESP-SANIFFQNCLSIPIMLVSFFGHKIYCKGWKDW 534

Query: 603 FIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           F+RAKDIDL +   I D                + P + ++  FWC
Sbjct: 535 FVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  316 bits (810), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 206/600 (34%), Positives = 322/600 (53%), Gaps = 26/600 (4%)

Query: 55  NDSDSDFEYNGKKKILPSFNIKQPHL-RKLIDSFRRAEDIDAPTNRDIENELTTTLSPLS 113
           N+SD   +   +   +P+ + +   L R++ DSF+++     P   D+EN   T    + 
Sbjct: 8   NESDKFTKIETESTTIPNDSDRSGSLIRRMKDSFKQSNLHVIP--EDLENSEQTEQEKIQ 65

Query: 114 ATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGY 173
                Q  P+        QK +  RH+                   +L  +GP  L+IG+
Sbjct: 66  WKLASQ--PY--------QKVLSQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPAALLIGF 114

Query: 174 AIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLEL 233
            ++G+ ++C++Q+  E++  +  + G++  + S  +DE+ GF+VA  Y L WL   P EL
Sbjct: 115 LLVGTSMFCVVQSAAELSCQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLISFPSEL 173

Query: 234 VTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILA 293
           +  ++TI YW  TVN                  G +G+AE EF  +  KV+ +  F I+ 
Sbjct: 174 IGCALTISYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIG 233

Query: 294 IVINTGGAGND-GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGAS 352
           IV+  GG  N  GYIGAKYWH+PGAF    +   FK++ +         G SE + + ++
Sbjct: 234 IVLIAGGGPNSTGYIGAKYWHDPGAF----AKPVFKNLCNTFVSAAFSFGGSELVLLTST 289

Query: 353 EQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAV 411
           E  N   AI  AAK   +RI   ++T++ ++G LVPYN   L+ GS S    ASP+VIA+
Sbjct: 290 ESKNIS-AISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIAL 348

Query: 412 ASHGVR--VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPA 469
           ++ G     V +F+N VIL++V+SV NS  Y+S R++ +L   G  PS  +Y+DR+GRP 
Sbjct: 349 SNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPL 408

Query: 470 RAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRS 529
             + +S  F ++ F   S KE++VFTWL A+  +S  FTW  IC+S IRFR A+K QGRS
Sbjct: 409 VGIGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRS 468

Query: 530 VDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589
            DEI +KS +GV+G     ++  L +  E +VS AP+G     A+ FFE  L++PI+IV+
Sbjct: 469 NDEIAYKSILGVYGGILGCVLNALLIAGEIYVSAAPVGSPS-SAEAFFEYCLSIPIMIVV 527

Query: 590 YFGYKICKRDWKLF-IRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           YF ++  +RDWK F I+  +IDL +   + +                + PF+ K+  FWC
Sbjct: 528 YFAHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC 587

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  314 bits (804), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 195/588 (33%), Positives = 305/588 (51%), Gaps = 28/588 (4%)

Query: 68  KILPSFNIKQ--PHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAE 125
           ++   F  KQ    + ++  SFRR    DA    D++  +           D Q   +  
Sbjct: 33  RLTRPFQRKQMSSRMNRITQSFRRQ---DAVEYADVDLSMM----------DEQQRRNYV 79

Query: 126 EKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQ 185
             +  LQKT+  RH+                   +L  +GPG L+IG+ I+G  ++C++Q
Sbjct: 80  LANQPLQKTLSQRHLMMIAIGGTLGTGLFIGIGYSL-SSGPGSLLIGFLIVGLMMFCVVQ 138

Query: 186 ACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT 245
           +  E+A  Y  + G++  + S  ++ + GF+VA  Y L WL   P EL+  +MT+QYW  
Sbjct: 139 SAAELACQYP-VSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNK 197

Query: 246 TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND- 304
           +VN                  G + Y EAEF+ +  KV+ +  F I+ IV+  GG  N  
Sbjct: 198 SVNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNST 257

Query: 305 GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 364
           GYIG KYWH+PG+F    +   FK + +         G +E + + ASE S    ++  A
Sbjct: 258 GYIGTKYWHDPGSF----AKPVFKGLCNTFVSAAFSFGGAELVVLTASE-SRKVESVSRA 312

Query: 365 AKTMIYRILFIFLTSITLVGFLVPYNSTELMGS-GSAATKASPYVIAVASHGV--RVVPH 421
           AK   +RI   ++T++ ++G LVPY + +L+G        ASP+VIA++  G       H
Sbjct: 313 AKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASH 372

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
           F+N VIL++VLSV NSA Y+S RI+ +L   G  P    Y+D++GRP   + +  +F ++
Sbjct: 373 FMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLL 432

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
            F   S  E DVFTWL A+  +S  FTW  IC S +RFR A++ QGRS DEI  KS +G+
Sbjct: 433 GFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSMLGI 492

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-CKRDW 600
           +G     ++  L +  E +VSI P+G D   A+ FF+  L++PI+I +Y G+K+   +  
Sbjct: 493 YGGFLGCLLNALLIAGEIYVSIFPLGGDP-SAKQFFQYCLSIPIMIAVYIGHKLFANKSK 551

Query: 601 KLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           ++ I A++IDL + RKI D                + P + ++  FWC
Sbjct: 552 RVLIPAQEIDLETGRKIKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC 599

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  313 bits (802), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 183/550 (33%), Positives = 296/550 (53%), Gaps = 18/550 (3%)

Query: 109 LSPLSATKDPQFAPHAEEKDDHL-----QKTIKPRHVXXXXXXXXXXXXXXXXXXSALHK 163
           L+ +S  ++    P  E     L     QK +  RH+                   +L  
Sbjct: 43  LTLISEDQEINDVPEQERIQRRLASQPYQKVLDQRHLTMIAIGGTLGTGLFIGLGYSL-A 101

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
           +GPG L+IG+ ++G+ ++C++Q+  E++  Y  + G++  + S  VDE+ GF+V+  Y L
Sbjct: 102 SGPGALLIGFLLVGTSMFCVVQSAAELSCQYP-VSGSYATHVSRFVDESVGFTVSTNYAL 160

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
            WL   P EL+  S+TI YW  +VN                  G +G+AE EFF +  KV
Sbjct: 161 AWLISFPSELIGCSITITYWNQSVNPAVWVAIFYIFIMGLNLFGVRGFAETEFFLSIIKV 220

Query: 284 LMMAGFFILAIVINTGGA-GNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXG 342
           L +  F I+ IV+  GG   + GYIG KYWH PG+F    +   FK++ +         G
Sbjct: 221 LAIIIFIIIGIVLIAGGGPDSSGYIGTKYWHQPGSF----AQPVFKNLCNTFVSAAFSFG 276

Query: 343 ASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAA 401
            SE + + ++E  N   +I  AAK   +RI   ++T++ ++G LVPY    L+ GS S  
Sbjct: 277 GSELVLLTSTEARNVS-SIARAAKGTFWRIAVFYITTVVIIGCLVPYTDERLLNGSSSED 335

Query: 402 TKASPYVIAVASHGVR--VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
             ASP+VIA+++ G     V +F+N +IL++VLSV NS  Y+S RI+ +L   G  P   
Sbjct: 336 VSASPFVIALSNSGSMGGKVANFMNVIILIAVLSVCNSCVYASSRIIQALGAAGQLPKAC 395

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
           ++ID++GRP   + +S +F ++ F     KE +VFTWL A+  +S  FTW  IC+S +RF
Sbjct: 396 SFIDKKGRPLVGIAISGVFGLLGFLVACDKEGEVFTWLFALCSISSFFTWFCICLSQVRF 455

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFEN 579
           R A++ QGR   +I +KS +GV+G     ++  L +  E +V+ +P+G +   A+ FFE 
Sbjct: 456 RMALRAQGRPKSDIAYKSMLGVYGGIVGCVLNFLLIAGEIYVASSPVGGES-SARGFFEY 514

Query: 580 YLAMPILIVLYFGYKICKRDW-KLFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGP 638
            L++PI+IV+YFG++  + DW   +I+ ++IDL +   I +                + P
Sbjct: 515 CLSIPIMIVVYFGHRFYRNDWGNWYIKRRNIDLDTGCSIENVELFRQQREQEQEKISSRP 574

Query: 639 FWKKVVAFWC 648
           F+ ++  FWC
Sbjct: 575 FYYRIYRFWC 584

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  313 bits (802), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 194/578 (33%), Positives = 306/578 (52%), Gaps = 26/578 (4%)

Query: 76  KQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTI 135
           K   L +  DSF+R  D+DA  + D           L   K P            L+K +
Sbjct: 29  KGTFLYRFRDSFKRV-DLDATIDEDDSKYTAEEKVQLRLAKQP------------LKKAL 75

Query: 136 KPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYS 195
             RH+                   +L  +GPG L+IG+ ++G  ++C++Q+  E++  Y 
Sbjct: 76  MQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPGCLLIGFILVGLSMFCVVQSAAELSCQYP 134

Query: 196 GLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXX 255
            + G++  + +  +DE+ GF+V+  Y L WL   P EL+ ++M IQYW  +V+       
Sbjct: 135 -VSGSYATHVTRFIDESIGFTVSTNYALAWLISFPSELMGSAMVIQYWNDSVDPAVWIAI 193

Query: 256 XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA-GNDGYIGAKYWHN 314
                      G +G+AE EF+ +  K+L +  F I+ IV+  GG  G+ GYIG KYWHN
Sbjct: 194 FYLFVMFLNLFGVEGFAETEFWLSIIKILAIIIFIIIGIVLICGGGPGSSGYIGTKYWHN 253

Query: 315 PGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILF 374
           PG+F    +   FK + +         G +E + + A+E S    AI  AAK   +RI  
Sbjct: 254 PGSF----AHPVFKSLCNTFVSAAFSFGGAELVLLTAAE-SKKISAISRAAKGTFWRIAV 308

Query: 375 IFLTSITLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHGV--RVVPHFINAVILLSV 431
            ++T++ ++G LVPY    L+G+ S     ASP+VIA+ + G     V +F+N +IL++V
Sbjct: 309 FYITTVVIIGCLVPYTDERLLGASSDEDVTASPFVIALTNAGSMGSSVANFMNVIILVAV 368

Query: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491
           +SV NS  Y+S R++ +L   G  P    YID++GRP   +++  +F ++AF    S+E 
Sbjct: 369 ISVCNSCVYASSRVIQALGSAGQLPRICGYIDKKGRPLVGIVICGIFGLLAFLIDCSEEG 428

Query: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551
            VFTWL A+  +S  FTW  IC S +R+R A+K Q RS DEI +KS +G++G    +++ 
Sbjct: 429 TVFTWLFALCSISSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSMLGIYGGILGSLLN 488

Query: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDID 610
            L ++ E +VSI+P+ E    A  FFEN L++PI+IV+Y  +K  K+ W+ LFI  K ID
Sbjct: 489 ILLIMGELYVSISPLDESP-SASAFFENCLSIPIMIVVYIFHKTYKKGWRSLFIPLKHID 547

Query: 611 LVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           L + R + +                + PF+ +V  FWC
Sbjct: 548 LDTGRAVENLALFKQQREEQKIIIASKPFYYRVYRFWC 585

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  311 bits (798), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/574 (32%), Positives = 298/574 (51%), Gaps = 25/574 (4%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           +R   DSF+ +E    P + D  +        L     P             QK +  RH
Sbjct: 31  VRSWKDSFKPSELSQIPEDLDYHDLTEREKIQLRLANQPY------------QKVLHQRH 78

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                  +AL  +GP  L+IGY ++G+ ++C+IQ+  E+A  +  + G
Sbjct: 79  LSMIAIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGTSMFCVIQSAAELACQFP-VSG 136

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           ++ ++ S  VDE+ GF+VA  Y L WL + P EL+  S+TI YW +++N           
Sbjct: 137 SYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSSINPAVWVSIFLVF 196

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN-DGYIGAKYWHNPGAF 318
                  G + +AE EF  +  KVL +  F I+ IV+  GG  +  GYIG KYWH+PG F
Sbjct: 197 VLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGGYIGTKYWHDPGPF 256

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
               +   FK++           G +E + +  +E  N   +I  AAK   YRI   ++T
Sbjct: 257 ----AKPVFKNLCQTFVAAAFSFGGTEMVLLTGTESKNVS-SIARAAKGTFYRIAIFYVT 311

Query: 379 SITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGVR--VVPHFINAVILLSVLSVA 435
           ++ ++G LVPYN   L+  S S    ASP+VIA+++ G     V HF+NAVIL++V+SV 
Sbjct: 312 TVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAKVSHFMNAVILVAVVSVC 371

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS  Y+S R++ +L   G  P  F Y+DR+GRP   + +SA F ++ F   + K+ +VFT
Sbjct: 372 NSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFGLLGFLVATKKQSEVFT 431

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL A+  ++   TW +IC++ +R+R AM+ + RS+D I +KS +G+WG     I+  L +
Sbjct: 432 WLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSILGIWGGVVGCIVNFLLV 491

Query: 556 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW-KLFIRAKDIDLVSH 614
             E +VS  P       A+ FF+  L++PI+IV++ G+KI + DW   +++ KD+DL + 
Sbjct: 492 AGEVYVSAFPANAKS-SAEGFFKYTLSIPIMIVVFLGHKIHRNDWGNWYVKRKDMDLDTG 550

Query: 615 RKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             I D                + P + +V  FWC
Sbjct: 551 CSIEDFELFQAQKEAEKRALASRPLYYRVYRFWC 584

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  311 bits (798), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 193/574 (33%), Positives = 305/574 (53%), Gaps = 26/574 (4%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           L++  DSF++ E I  P N D           LS  +D +   +      + ++T+  RH
Sbjct: 34  LKRFRDSFKKHEPI-LPENVD-----------LSQMEDYERTNYLLAHQPY-KRTLSQRH 80

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                   +L  +GPG L+IG+ I+G  ++C++Q   E++  Y  + G
Sbjct: 81  LTMISIGGTLGTGLFIGLGYSL-TSGPGNLLIGFTIIGISIFCVVQCAAELSCQYP-VSG 138

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           +F  + S  +D + GF+V+  Y L WL   P EL+  ++T++YW  +VN           
Sbjct: 139 SFATHVSRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYWNDSVNPAVWIAIFYVF 198

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA-GNDGYIGAKYWHNPGAF 318
                  G +G+AE EF+ +  K+  +  F I+ IV+  GG   ++GYIGAKYWH+PGAF
Sbjct: 199 IMCLNLFGVRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGAKYWHDPGAF 258

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
              K +  FK + +         G +E + + A+E S    +I  AAK   +RI   ++T
Sbjct: 259 V--KPV--FKGLCNTFVSAAFSFGGAELVVLTANE-SRKIESISRAAKGTFWRIAVFYIT 313

Query: 379 SITLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHGV--RVVPHFINAVILLSVLSVA 435
           ++ ++G LVP     L+G+ S     ASP+VIA+++ G     V HF+NAVIL++VLSV 
Sbjct: 314 TVVIIGCLVPSTDERLLGAASDVDVTASPFVIALSNTGSFGDKVSHFMNAVILIAVLSVC 373

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS  Y++ R++ SL      PS+  YIDR+GRP   + +  +F ++ F   SSKE +VFT
Sbjct: 374 NSCVYAASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFGLLGFLVASSKEGEVFT 433

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL A+  +S  FTW  IC S +RFR A++ QGRS DEI +KS +G WG     ++  L +
Sbjct: 434 WLFALCSISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGCVLNILLI 493

Query: 556 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVSH 614
             E +VS+ P+G    +A+ FF+  L++PI+I +YF ++I + +W    I  K IDL + 
Sbjct: 494 AGEIYVSLFPLGGSP-NAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTKKIDLDTG 552

Query: 615 RKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
           RK  D                + P + ++  FWC
Sbjct: 553 RKAEDLELMKHEILTEKARIASKPLYYRIYRFWC 586

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  311 bits (796), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 207/621 (33%), Positives = 322/621 (51%), Gaps = 41/621 (6%)

Query: 33  KSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAED 92
           K  E D   +    +T IP  +  SD                  +  +R++ DSF+++  
Sbjct: 6   KGNESDKFTKIETESTMIPTGLERSDKS----------------ESLIRRMKDSFKQSNL 49

Query: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXX 152
              P   D+EN   T    +      Q  P+        QK +  RH+            
Sbjct: 50  HVIP--EDLENSEQTEQEKIQWKLASQ--PY--------QKVLSQRHLTMIAIGGTLGTG 97

Query: 153 XXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEA 212
                  +L  +GP  L+IG+ I+G+ ++C++Q+  E++  +  + G++  + S  +DE+
Sbjct: 98  LFIGLGYSL-ASGPAALLIGFLIVGTSMFCVVQSAAELSCQFP-VSGSYATHVSRFIDES 155

Query: 213 FGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYA 272
            GF+VA  Y L WL   P EL+  S+TI YW  TVN                  G KG+A
Sbjct: 156 VGFTVATNYALAWLISFPSELIGCSLTISYWNQTVNPAVWVAIFYTFIMVLNLFGVKGFA 215

Query: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGND-GYIGAKYWHNPGAFRGDKSIDRFKDVM 331
           E EF  +  KV+ +  F I+ IV+  GG  N  GYIG KYWHNPGAF    +   FK++ 
Sbjct: 216 ETEFALSIIKVVAIIIFIIIGIVLIAGGGPNSTGYIGTKYWHNPGAF----AKPVFKNLC 271

Query: 332 SXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNS 391
           +         G SE + + ++E S    AI  AAK   +RI   ++T++ ++G LVPYN 
Sbjct: 272 NTFVSAAFSFGGSELVLLTSTE-SKDISAISRAAKGTFWRIAIFYITTVVIIGCLVPYND 330

Query: 392 TELM-GSGSAATKASPYVIAVASHGVR--VVPHFINAVILLSVLSVANSAFYSSCRILYS 448
           + L+ GS S    ASP+VIA+ + G     V +F+N VIL++V+SV NS  Y+S R++ +
Sbjct: 331 SRLLSGSTSEDISASPFVIALRNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQA 390

Query: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508
           L   G  PS  +Y+DR+GRP   + +S  F ++ F   S+KE++VFTWL A+  +S  FT
Sbjct: 391 LGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASNKEDEVFTWLFALCSISSFFT 450

Query: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGE 568
           W  IC+S +RFR A+K QGRS DEI +KS +GV+G     ++  L +  E +VS AP+G 
Sbjct: 451 WFCICLSQVRFRMALKTQGRSKDEIAYKSILGVYGGVLGCVLNALLIAGEVYVSAAPVGS 510

Query: 569 DHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL-FIRAKDIDLVSHRKIYDGXXXXXXX 627
               A+ FFE  L++PI+IV+Y  ++I ++D +  +I+  +IDL +   + +        
Sbjct: 511 PS-SAKAFFEYCLSIPIMIVVYIAHRIYRKDRRRWYIKRSEIDLDTGCSVENLELFKAQK 569

Query: 628 XXXXXXXXNGPFWKKVVAFWC 648
                   + PF+ K+  FWC
Sbjct: 570 EAEKQLIASKPFYYKIYRFWC 590

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  303 bits (775), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 170/490 (34%), Positives = 272/490 (55%), Gaps = 12/490 (2%)

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
           +GP  L+IG+ ++G+ + C++Q   E++  Y  + G++  + S  +D + GFS+   Y L
Sbjct: 101 SGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALHASRFIDPSVGFSIGINYLL 159

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
            WL   P ELV  S+TI YW  +VN                  GA+G+AE+EF+ +  K+
Sbjct: 160 MWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKI 219

Query: 284 LMMAGFFILAIVINTGGAGND-GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXG 342
           + +  F I+ IV+  GG  +  GYIG KYWH+PG+F    ++  FK++ +          
Sbjct: 220 VALFIFIIIGIVLIAGGGPDSTGYIGTKYWHDPGSF----AVPVFKNLCNTFVSAAYSFS 275

Query: 343 ASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAA 401
            +E + + ++E +    ++  AAK   +RI+  ++ ++ ++G LVPYN   L+ GS S  
Sbjct: 276 GTEMVVLTSTE-ARSVSSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSED 334

Query: 402 TKASPYVIAVASHGV--RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
             ASP+VIA+++ G     V HF+NAVIL++V SV NS  Y+S R++  L+  G  P   
Sbjct: 335 ITASPFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKIC 394

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
            Y+DR GRP   M +   F ++ F   S  +  VFTWL A+  +S   TW  IC   +RF
Sbjct: 395 AYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRF 454

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFEN 579
           R AMK QGRS D+I ++S +G++G  +  I+  L +I E +VS AP+G     A NFFE 
Sbjct: 455 RMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEY 513

Query: 580 YLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGP 638
            +++PI+I +Y G++I +RDW+  +I+  DIDL S   + D                + P
Sbjct: 514 CMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLEDFEATKLERDEDKKYVSSKP 573

Query: 639 FWKKVVAFWC 648
            + ++  F+C
Sbjct: 574 LYYRIYRFFC 583

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  302 bits (774), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 187/574 (32%), Positives = 297/574 (51%), Gaps = 25/574 (4%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           L++L DSF+++E   AP + D      +    LS  +  Q    ++      +K +  RH
Sbjct: 32  LKRLKDSFKQSEL--APIDED------SGFDGLSEKEKIQLKLASQP----YEKVLSQRH 79

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                   +L   GPG L+IG+ ++G+ ++C++Q+  E++  +  + G
Sbjct: 80  LTMIAIGGTLGTGLFIGLGYSL-ACGPGALLIGFLLVGTSIFCVVQSAAELSCQFP-VSG 137

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           ++  + S  +D++ GF+VA  Y L WL   P EL+  S+TI YW  T N           
Sbjct: 138 SYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWDQTTNPAVWVAIFYVF 197

Query: 260 XXXXXXXGAKGYAEAEFFFN-SCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318
                  G +G+AE EF  +    + ++    I  I+I  GG  + GYIG KYWH+PG+F
Sbjct: 198 IMTLNLFGVRGFAEVEFVLSVIKILAIIIFIIIGIILIAGGGPDSKGYIGTKYWHDPGSF 257

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
                   FK++ +         G SE + +  S++S    AI  AAK   +RI   ++T
Sbjct: 258 NNPV----FKNLCNTFVSAAFSFGGSELVLL-TSKESKSVSAISRAAKGTFWRIAIFYIT 312

Query: 379 SITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGV--RVVPHFINAVILLSVLSVA 435
           ++ ++G LVPY    L+ G       ASP+VIA+++ G   + V  F+N VIL++V+SV 
Sbjct: 313 TVVIIGCLVPYTDDRLLNGRSDEDVTASPFVIALSNTGSMGKKVSDFMNVVILIAVVSVC 372

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS  Y++ R++ +L   G  P    YIDR GRP   + +S +F ++ F   SS+E  VFT
Sbjct: 373 NSCVYAASRVIQALGASGQLPKICGYIDRRGRPLVGIAISGIFGLLGFLVASSEESKVFT 432

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL A+  +S  FTW  IC S IRFR A+K QGRS D+I +KS +GV+G     I+  L +
Sbjct: 433 WLFALCSISSFFTWFCICYSQIRFRMALKYQGRSTDQIAYKSMLGVYGGILGCILNILLI 492

Query: 556 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVSH 614
             E +VS +P+GE    A+ FFE  L++PI+I +Y  ++I ++DW   +I+  DIDL + 
Sbjct: 493 AGEIYVSASPVGEKS-TAEGFFEYCLSIPIMISVYVLHRIYRKDWTHWYIKRSDIDLDTG 551

Query: 615 RKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             + +                  PF+ K+  F C
Sbjct: 552 CSVENIELFKEQREEEKIYAATKPFYYKIYRFLC 585

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  302 bits (773), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 186/574 (32%), Positives = 301/574 (52%), Gaps = 25/574 (4%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
             +  DSF R ++I+  +  D +            TKD Q       +    +K++  RH
Sbjct: 51  FERFKDSFTRVDNIEPYSELDGDKY----------TKDEQIQMTLAAQP--YKKSLHQRH 98

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                   +L  +GP  L+IG+ I+G+ ++C++Q+  E++  Y  + G
Sbjct: 99  LTMIAIGGTLGTGLFIGLGYSL-ASGPASLLIGFLIVGTSMFCVVQSAAELSCQYP-VSG 156

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           ++  + S  +DE+ GF+V+  Y L WL   P EL+  SMTI YW  ++N           
Sbjct: 157 SYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMTISYWNDSINPCVWIAIFYVF 216

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA-GNDGYIGAKYWHNPGAF 318
                  G KG+AE EF+ +  KV+ +  F I+ IV+  GG   + GYIG KYWH+PG+F
Sbjct: 217 IMILNLFGVKGFAETEFWLSLIKVIAIIIFIIVGIVLICGGGPESSGYIGTKYWHDPGSF 276

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
               +   FK + +         G SE + + A+E  N   AI  AAK   +RI   ++ 
Sbjct: 277 ----APPVFKGLCNTFVSAAFSFGGSELVLLTAAESKNIS-AISRAAKGTFWRIAVFYIA 331

Query: 379 SITLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHG--VRVVPHFINAVILLSVLSVA 435
           ++ ++G LVPYN   L+G  S     ASP+V+A+ S     R + +F+N VIL++V+SVA
Sbjct: 332 TVVIIGCLVPYNDRRLLGGASDEDVSASPFVLALGSSTDLGRKLSNFMNFVILIAVVSVA 391

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           NS  Y+S R++ +L   G  PS   YID+ GRP   + +  +F ++ F   SS E  VFT
Sbjct: 392 NSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAICGVFGLLGFLVASSNERTVFT 451

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLAL 555
           WL A+  +S  FTW  IC S +RFR A+K Q RS D+I FKS +G++G    +I+  L +
Sbjct: 452 WLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKSMLGIYGGILGSILNILLI 511

Query: 556 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKD-IDLVSH 614
           + E +VS +P+GE    A+ FFEN L++P++++++  ++  +++W+ + ++ D IDL + 
Sbjct: 512 MGEIYVSASPLGEPS-SAEAFFENCLSIPLMLLVFIAHRFYRKNWRDWYKSLDEIDLDTG 570

Query: 615 RKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
               D                + P + K+  FWC
Sbjct: 571 CSYDDIELFKHQREQIKHKIQSKPLYYKIYRFWC 604

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  300 bits (769), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 185/572 (32%), Positives = 302/572 (52%), Gaps = 24/572 (4%)

Query: 82  KLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVX 141
           ++ DSF+R E ++     D++    T         D Q   +   K  + QK +  RH+ 
Sbjct: 36  RVKDSFKRQELVETE-GIDLDTYSMT---------DYQRTNYLLAKQPY-QKNLSQRHLT 84

Query: 142 XXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNF 201
                             +L  +GPG L+IG+ + G  ++C++Q   E++  Y  + G+F
Sbjct: 85  MIAIGGTLGTGLFIGIGWSL-ASGPGNLLIGFLLTGLAIFCVVQCAAELSCQYP-VSGSF 142

Query: 202 NAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXX 261
            ++ S  VD ++GF+V   YCL W    P EL+  +MTI YW ++VN             
Sbjct: 143 ASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNPVVWVIIFWLFIM 202

Query: 262 XXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN-DGYIGAKYWHNPGAFRG 320
                G +G+AE E+  +  K+L +  F I+ +V+  GG  N +GYIG KYWH+PG+F+ 
Sbjct: 203 ALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNGYIGTKYWHDPGSFKA 262

Query: 321 DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380
                 FK + +         G +E + + A+E S    +I  AAK   +R++  +++++
Sbjct: 263 PV----FKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESISRAAKGTFWRVIVFYVSTV 317

Query: 381 TLVGFLVPYNSTELMGSGSAA-TKASPYVIAVASHGV--RVVPHFINAVILLSVLSVANS 437
            ++G LVPY    L+G  ++    ASP+VIA+A+ G     V +F+NAVIL++VLSV NS
Sbjct: 318 VVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNFMNAVILIAVLSVCNS 377

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
             Y++ R++ SL   G  PS   Y+DR+GRP   +++  LF  + F   S+K  +VF WL
Sbjct: 378 CVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLPFIVASNKVSEVFDWL 437

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
            A+  +S +F W +IC S++R+R A+K Q RS DEI +KS +G+WG+    ++  L ++ 
Sbjct: 438 FALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAYLGLLLSALLIVG 497

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF-IRAKDIDLVSHRK 616
           E +VS+ P+GE    A+ FF+  L++PI+I +Y G+K    +WK F I    IDL +   
Sbjct: 498 EIYVSLFPLGESP-SAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVIPLSGIDLDTGLS 556

Query: 617 IYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             D                + P + ++  FWC
Sbjct: 557 HSDVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  299 bits (766), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 202/611 (33%), Positives = 319/611 (52%), Gaps = 34/611 (5%)

Query: 49  GIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLID---SFRRAEDIDAPTNRDIENEL 105
           G+  AV+  +S   +NG+         KQ   R++ D   SF+R E   AP +  ++   
Sbjct: 9   GVEQAVSSVESR-TWNGETSGSLINRFKQKSRRQIHDIAHSFQRQE---APNSEGVD--- 61

Query: 106 TTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAG 165
              LS LS  +   +    E  +   +K++  RH+                   +L  +G
Sbjct: 62  ---LSLLSEEQRRNY----ELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSL-ASG 113

Query: 166 PGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQW 225
           PG L+IG+ I+G  ++C++Q+  EMA  Y  + G+F+ + S  ++ + GF+V+  Y L W
Sbjct: 114 PGSLLIGFLIVGLMMFCVVQSAAEMACQYP-VSGSFSTHVSRFMEPSIGFTVSTNYALAW 172

Query: 226 LCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLM 285
           L   P EL+  ++T++YW++ VN                  G +GY EAEF+ +  KV+ 
Sbjct: 173 LISFPSELIGCAITLRYWSS-VNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVA 231

Query: 286 MAGFFILAIVINTGGA-GNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGAS 344
           +  F I+ IV+  GG   + GYIG KYWHNPG+F    +   FK + +         G +
Sbjct: 232 IVIFIIIGIVLICGGGPHSSGYIGTKYWHNPGSF----AKPVFKGLCNTFISAAFSFGGA 287

Query: 345 EFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAA-TK 403
           E + + ASE S    ++  AAK   +RI   ++T++ ++G LVPY    L+G  +     
Sbjct: 288 ELVVLTASE-SKKVESVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDIT 346

Query: 404 ASPYVIAVASHGV--RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNY 461
           ASP+VIA++  G     V HF+NAVIL++VLSV NS  Y+S R++ +L   G  P    Y
Sbjct: 347 ASPFVIALSGQGSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGY 406

Query: 462 IDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRR 521
           ID++GRP   + +  +F ++ F     K++DVFTWL A+  +S  FTW  ICVS +RFR 
Sbjct: 407 IDKKGRPLVGIAICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRL 466

Query: 522 AMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYL 581
           A++ QGRS DEI  KS +G++G     ++  L +  E +VSI P+G     A+ FF+  +
Sbjct: 467 ALRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPLGGSP-SAEQFFQYCM 525

Query: 582 AMPILIVLYF---GYKICKRDWK-LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNG 637
           ++PI+IV+Y     YK  +RD K + +   +IDL S R+I D                  
Sbjct: 526 SIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAK 585

Query: 638 PFWKKVVAFWC 648
           P + ++  FWC
Sbjct: 586 PLYYRIYRFWC 596

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  298 bits (763), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 179/575 (31%), Positives = 300/575 (52%), Gaps = 27/575 (4%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           +R   DSF+R + ++ P   +  +      + L     P             +K +  RH
Sbjct: 31  VRDWRDSFKRQDLLEMPDALEYNDLTEREKTQLKLASQPY------------KKVLSQRH 78

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                  +AL  +GP  L+IGY ++G+ ++C+IQ+  E+A  +  + G
Sbjct: 79  LTMISIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGASMFCVIQSASELACQFP-VTG 136

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           +++++ +  VDE+ GF+V   Y L WL + P EL+  S+TI YW +T+N           
Sbjct: 137 SYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGCSLTISYWNSTINPAVWVAIFLVF 196

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND--GYIGAKYWHNPGA 317
                  G + +AE EF  +  KVL +  F I+ IV+  GG G D  GYIG +YWH+PG 
Sbjct: 197 VLWINLFGVRLFAETEFVLSIIKVLAIVIFIIIGIVLIAGG-GQDSGGYIGTRYWHDPGP 255

Query: 318 FRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
           F    +   FK++ +         G SE + +  +E  N   +I  AAK   YRI   ++
Sbjct: 256 F----AKPVFKNLCNTFVSAAFSYGGSEMVLLTGTESKNIS-SIARAAKGTFYRIAIFYI 310

Query: 378 TSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGV--RVVPHFINAVILLSVLSV 434
           T++ ++G LVPYN   L+  S S    ASP+VIA+ + G     V +F+NA+IL+SV+SV
Sbjct: 311 TTVVVIGCLVPYNDPRLLNASSSEDISASPFVIALGNTGSMGSKVSNFMNAIILVSVVSV 370

Query: 435 ANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVF 494
            NS  Y+S R++ +L   G+ P    Y+D +GRP   + ++  F ++ F   ++K+ +VF
Sbjct: 371 CNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGIAITGAFGLLGFLVATNKQSEVF 430

Query: 495 TWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLA 554
           TWL A+  ++   TW  IC++ +RFR AMK + RS + I ++S +G++G     I+  L 
Sbjct: 431 TWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRSMLGIYGGIAGCIVNFLL 490

Query: 555 LIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVS 613
           +  E +VS  P+ +    A+ FFE  L++PI+I+++ G+KI + DWK  +++ +D+DL +
Sbjct: 491 IAGEIYVSAWPV-DGKSSAEGFFEYDLSIPIMIIVFLGHKIYRNDWKNWYVKRRDMDLDT 549

Query: 614 HRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
              I +                  P + ++  FWC
Sbjct: 550 GCSIENLELFQSQKESEKEDLACKPLYYRIYRFWC 584

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  297 bits (761), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 169/490 (34%), Positives = 273/490 (55%), Gaps = 12/490 (2%)

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
           +GP  L+IG+ ++G+ + C++Q   E++  Y  + G++  + S  +D + GFS+   Y L
Sbjct: 101 SGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALHASRFIDPSVGFSIGINYLL 159

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
            WL   P ELV  S+TI YW  +VN                  GA+G+AE+EF+ +  K+
Sbjct: 160 MWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNMFGARGFAESEFYMSIFKI 219

Query: 284 LMMAGFFILAIVINTGGAGND-GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXG 342
           + +  F I+ I++  GG  +  GYIG KYWH+PG+F    +   FK++ +          
Sbjct: 220 VALFIFIIIGIILIAGGGPDSTGYIGTKYWHDPGSF----APPVFKNLCNTFVSAAYSFS 275

Query: 343 ASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAA 401
            +E + + ++E  N   ++  AAK   +RI+  ++ ++ ++G LVPYN + L+ GS S  
Sbjct: 276 GTEMVVLTSTEARNVS-SVSRAAKGTFWRIVIFYIVTVIIIGCLVPYNDSRLINGSSSED 334

Query: 402 TKASPYVIAVASHGV--RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
             ASP+VIA+++ G   + V HF+NAVIL++V SV NS  Y+S R++  L+  G  P   
Sbjct: 335 ITASPFVIALSNTGTMGKRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPRIC 394

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
            Y+DR GRP   M +   F ++ F   S  +  VFTWL A+  +S   TW  IC   +RF
Sbjct: 395 AYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRF 454

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFEN 579
           R AMK QGRS D+I ++S +G++G     I+  L +I E +VS AP+G     A NFFE 
Sbjct: 455 RMAMKAQGRSKDDIIYRSSLGIYGGIVGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEY 513

Query: 580 YLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGP 638
            +++PI+I +Y G++I ++DW+  +I+ +DIDL S   + D                + P
Sbjct: 514 CMSIPIMIAVYIGHRIYRKDWRHWYIKRRDIDLDSGHSLEDFEATKLERDHDKRYVASRP 573

Query: 639 FWKKVVAFWC 648
            + ++  F+C
Sbjct: 574 LYYRIYRFFC 583

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  297 bits (760), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 189/538 (35%), Positives = 299/538 (55%), Gaps = 27/538 (5%)

Query: 80  LRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRH 139
           +R++ DSF+++ +++  T  D+EN          + +  Q     +      QK +K RH
Sbjct: 34  MRRMKDSFKQS-NLNVIT-EDLEN----------SEQSEQEKIQWKLASQPYQKVLKQRH 81

Query: 140 VXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPG 199
           +                   +L  +GP  L+IG+ ++G+ ++C++Q+  E++  +  + G
Sbjct: 82  LTMIAIGGTLGTGLFIGLGYSL-ASGPAALLIGFLLVGTSMFCVVQSAAELSCQFP-VSG 139

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           ++  + S  +D++ GF+VA  Y L WL   P EL+  S+TI YW  TVN           
Sbjct: 140 SYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWNQTVNPAVWVAIFYVF 199

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND-GYIGAKYWHNPGAF 318
                  G KG+AE EF  +  KV+ +  F I+ IV+  GG  N  GYIG +YWHNPG+F
Sbjct: 200 IMCLNLFGVKGFAETEFALSIIKVISIFIFIIIGIVLIAGGGPNSTGYIGTRYWHNPGSF 259

Query: 319 RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
               +   FK++ +         G SE + + ++E  N   +I  AAK   +RI   ++T
Sbjct: 260 ----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-SISRAAKGTFWRIAIFYIT 314

Query: 379 SITLVGFLVPYNSTELM-GSGSAATKASPYVIAVA---SHGVRVVPHFINAVILLSVLSV 434
           ++ ++G LVPYN   L+ GS S    ASP+VIA++   S G RV  +F+N VIL++V+SV
Sbjct: 315 TVVIIGCLVPYNDPRLLNGSTSEDISASPFVIALSNTGSMGTRV-SNFMNVVILVAVVSV 373

Query: 435 ANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVF 494
            NS  Y+S R++ +L   G  P    Y+DR+GRP   + +S +F ++ F   S+KE +VF
Sbjct: 374 CNSCVYASSRLIQALGASGQLPEICAYMDRKGRPLVGIGISGIFGLLGFLVASNKEGEVF 433

Query: 495 TWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLA 554
           TWL A+  +S  FTW  IC+S +RFR A+K QGRS +EI +KS +GV+G     ++  L 
Sbjct: 434 TWLFALCSISSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVLGCVLNALL 493

Query: 555 LIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDIDL 611
           +  E +VS AP+G     A+ FFE  L++PI+IV+Y  ++I + DWK  +I+   IDL
Sbjct: 494 IAGEIYVSAAPVGGTS-TAKGFFEYCLSIPIMIVVYISHRIYRGDWKNWYIKKSKIDL 550

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 173/491 (35%), Positives = 278/491 (56%), Gaps = 19/491 (3%)

Query: 163 KAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYC 222
           ++GPG L+IG+ I+G  ++C+IQ+  E++  Y  + G+F+++ S  ++ + GF+V+  Y 
Sbjct: 21  QSGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSFSSHVSRFIEPSLGFTVSCAYA 79

Query: 223 LQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCK 282
           L WL   P ELV  +MTI YW   +                     +G+AE+EF+ +  K
Sbjct: 80  LSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSIIK 139

Query: 283 VLMMAGFFILAIVINTGGAGN--DGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXX 340
           VL +  F I+ IVI  GG  N  +GY+G KYWH+PGAFR       F  +          
Sbjct: 140 VLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRPP----FFSSLCQTFVSAAFT 195

Query: 341 XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSA 400
            G +E + + A+E S    +I  AAK   +RI   +++++ ++G LVPY S  L G    
Sbjct: 196 FGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPALDGE--- 251

Query: 401 ATKASPYVIAVASHGV--RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSW 458
           + +ASP+VIA+++ G     V HF+NAVI+ +VLSV NS  Y++ R++ SL   G  P  
Sbjct: 252 SIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGACGQLPEI 311

Query: 459 FNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIR 518
           F YID++GRP   + + A+F ++AF   ++K +DVF WL A+  ++  F W  ICVS +R
Sbjct: 312 FGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFCICVSQLR 371

Query: 519 FRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFE 578
           +RRA+KVQG   +EI ++S +G W      ++  L +  E +VS+    +D  D + FF+
Sbjct: 372 YRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSV----KDG-DVETFFQ 426

Query: 579 NYLAMPILIVLYFGYKICKRDWKLF-IRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNG 637
           N +++P+LI+ YF +++ +RDWK + I A+D+DL + RK  D                + 
Sbjct: 427 NCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHELIVSRARIASS 486

Query: 638 PFWKKVVAFWC 648
           P++ +   FWC
Sbjct: 487 PWYYRAYRFWC 497

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  293 bits (749), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 185/578 (32%), Positives = 299/578 (51%), Gaps = 27/578 (4%)

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIE-NELTTTLSPLSATKDPQFAPHAEEKDDHLQKTI 135
           + H R+ ++SF+R   +  P+  D+E +ELT          D    P+        +K +
Sbjct: 31  RSHFREFMESFKRDGAVTVPS--DLEYDELT---EEEKVQWDLATQPY--------KKVL 77

Query: 136 KPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYS 195
             RH+                   +L  +GPG L+IG+ ++G  + C++Q   E++  Y 
Sbjct: 78  DQRHLTMIAIGGTLGTGLFIGLGLSL-ASGPGSLLIGFMLVGISMLCVVQCGAELSCQYP 136

Query: 196 GLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXX 255
            + G++  + S  +D + GFSV   Y L WL   P ELV  S+T+ YW  +VN       
Sbjct: 137 -VSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSLTLSYWNNSVNPAVWVAI 195

Query: 256 XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA-GNDGYIGAKYWHN 314
                      G +G+AE EF+ +  KV+ +  F I+ IV+ TGG  GN GYIG KYW +
Sbjct: 196 FFVFVMLLNLFGVRGFAETEFYMSIFKVISLFVFIIIGIVLITGGGPGNTGYIGTKYWQD 255

Query: 315 PGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILF 374
           PG+F    +   FK+  +           +E + + ++E  +   +I  AAK   +RI  
Sbjct: 256 PGSF----ATPAFKNFCNTFVSAAYSFSGTEMVVLTSTEVRDIS-SISRAAKGTFWRIAL 310

Query: 375 IFLTSITLVGFLVPYNSTELM-GSGSAATKASPYVIAVASHGV--RVVPHFINAVILLSV 431
            ++ ++ ++G LVPYN   L+ G+ S    ASP+VIA+++ G       +F+N VIL++V
Sbjct: 311 FYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALSNTGSMGSKAANFMNVVILVAV 370

Query: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491
           +SV N   Y+S R++  L+  G  PS   Y+DR GRP   + ++ +F ++ F   S  + 
Sbjct: 371 VSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLVGIAITGVFGLLGFLVASKDQS 430

Query: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551
            VFTWL A+  +S   TW  IC   IRFR AMK Q RS D+I + S +G++G     ++ 
Sbjct: 431 TVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSADDIVYISPLGIYGGVLGCVLN 490

Query: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDID 610
            L +  E +VS  P+G+    A+NFF+  +++PI+IV+Y G++I ++DW   +I+AKDID
Sbjct: 491 VLLVAGEIYVSAFPVGQPS-SAENFFQYCMSIPIMIVVYLGHRIYRKDWSHWYIKAKDID 549

Query: 611 LVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAFWC 648
             S   + +                + PF+ KV  F+C
Sbjct: 550 RDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  286 bits (733), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 165/504 (32%), Positives = 261/504 (51%), Gaps = 19/504 (3%)

Query: 121 APHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCL 180
           A  A   D  +++ +K RH+                  + L  AGP G +I Y  MGS +
Sbjct: 57  AEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIV 116

Query: 181 YCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTI 240
           Y I Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+      I
Sbjct: 117 YFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVI 175

Query: 241 QYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGG 300
           Q+WT+ V                     K Y E EF+  S KV+ + G+ I A+VI  GG
Sbjct: 176 QFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGG 235

Query: 301 AGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQS 355
           + + G IG +YW NPG +       DK+  RF   +S           +E + I A E +
Sbjct: 236 S-SQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 294

Query: 356 NPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHG 415
           NPR+++P A   +++RI+  ++ S+  VG LVP+N   L  S  A   +SP+VI++ + G
Sbjct: 295 NPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL-ASNVAVIASSPFVISIQNAG 353

Query: 416 VRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMS 475
            RV+PH  NAV++L+++S ANS  Y   R+LY+LSQ G AP  F Y+ R G P   +I +
Sbjct: 354 TRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIAT 413

Query: 476 ALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGF 535
           +L  ++AF   ++     F WL+ IS L+ L  W+ I +SHIRF +A+K +G S D++ F
Sbjct: 414 SLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPF 473

Query: 536 KSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG--- 592
           K+++  WG+ YAA  +T+ +  + + + +P      D   FF  Y+++ IL+VL  G   
Sbjct: 474 KAKLMPWGAYYAAFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVLLIGCQL 529

Query: 593 YKICKRDWKLFIRAKDIDLVSHRK 616
           Y  C+  WKL    +DID+ + R+
Sbjct: 530 YYRCRFLWKL----EDIDIDTDRR 549

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  283 bits (724), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 253/498 (50%), Gaps = 13/498 (2%)

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
           K+  +++ +KPRH+                  + L  AGP G +I Y  +G+  Y + Q+
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GEMA  +  +  +F  +    +  A G +  ++Y L W     LEL      IQ+WT  
Sbjct: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           V                     K Y E EF+    KVL + GF I A ++   GAG  G 
Sbjct: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215

Query: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAI 361
           +G +YW NPG +       D +  RF   +S           +E + I A E +NPR+ +
Sbjct: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275

Query: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421
           P A   + +RILF ++ S+  +G LVP+N  +L    S  + +SP+VIA+ + G +V+PH
Sbjct: 276 PRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYIS-SSPFVIAIENSGTKVLPH 334

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
             NAVIL +++S  NS  Y   RI YS++  G AP +  +  + G P  A++ +++   +
Sbjct: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           A+   SS    VF WLL I+ ++  FTWI I +SHIRF +A+K QG S D++ FK++   
Sbjct: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
           WG+ YAA  + + +I + + + AP         +FF  Y+++ +  V + G++I  R   
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509

Query: 602 LFIRAKDIDLVSHRKIYD 619
           LFI+ +DIDL + R+  D
Sbjct: 510 LFIKTEDIDLDTDRREID 527

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  280 bits (716), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/490 (33%), Positives = 266/490 (54%), Gaps = 12/490 (2%)

Query: 164 AGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCL 223
           +GP  L+IG+ ++G+ + C++Q   E++  Y  + G++  + S  +D + GFSV   Y L
Sbjct: 101 SGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALHASRFIDPSAGFSVGINYLL 159

Query: 224 QWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKV 283
            WL   P ELV  S+T+ YW  +VN                  GA+G+AE+EF+ +  K+
Sbjct: 160 MWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFTLSMLLNLFGARGFAESEFYMSIFKI 219

Query: 284 LMMAGFFILAIVINTGGA-GNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXG 342
           + +  F I+ I++  GG   + GYIG KYW++PG+F    +   FK+  +          
Sbjct: 220 VALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSF----APPAFKNFCNTFVSAAYSFS 275

Query: 343 ASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM-GSGSAA 401
            +E + + ++E  +   ++  AAK   +RI   ++ ++ ++G LVPYN   L+ GS S  
Sbjct: 276 GTEMVVLTSAEARDVS-SVSRAAKGTFWRIAVFYIVTVIIIGCLVPYNDPRLINGSSSED 334

Query: 402 TKASPYVIAVASHGV--RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
             ASP+VIA+++ G     V  F+NAVIL++V SV NS  Y+S R++  L+  G  P   
Sbjct: 335 ITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKIC 394

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
            Y+DR GRP   M +   F ++ F   S  +  VFTWL A+  +S   TW  IC   IRF
Sbjct: 395 GYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFALCSISFFTTWFCICFCQIRF 454

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFEN 579
           R AMK QG+  D+I +KS +G++G      +  L +I E +VS AP+G     A NFFE 
Sbjct: 455 RMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEIYVSAAPVGMPS-SAANFFEY 513

Query: 580 YLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGP 638
            +++PI+I +Y G++I +RDW+  +I+ +DIDL S   + D                + P
Sbjct: 514 CMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLEDLEATKLRRDQEKEYVASRP 573

Query: 639 FWKKVVAFWC 648
            + ++  F+C
Sbjct: 574 LYYRLYRFFC 583

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  278 bits (710), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 168/566 (29%), Positives = 287/566 (50%), Gaps = 24/566 (4%)

Query: 59  SDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDP 118
           + + Y+ KK +  +++       ++++      DI    NR   +     +S  S   D 
Sbjct: 41  TTYAYDDKKDMTVTYD------NEILEKKDSKSDIFTSVNRYASHPSEARIS--SDEYDH 92

Query: 119 QFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGS 178
           Q    AE KD  +++ +KPRH+                    L K+GP G +I Y  MG+
Sbjct: 93  Q---EAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGT 149

Query: 179 CLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASM 238
            +Y + QA GEMA  +  +  +   + S  +  AFG S  ++Y   W     +E+     
Sbjct: 150 VVYFVTQALGEMA-TFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQ 208

Query: 239 TIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINT 298
            I++WTT V                       Y E EF+  S KVL + G+ I A+VI  
Sbjct: 209 VIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVC 268

Query: 299 GGAGNDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASE 353
           GG+   G IG +YW +  A  G     DK+  RF   ++           +E + I A E
Sbjct: 269 GGS-KQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGE 327

Query: 354 QSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVAS 413
            +NPR+++P A   +++RI+  ++ S+  +G LVPYN  +L  S ++   +SP+VI++ +
Sbjct: 328 AANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKL-NSATSYIASSPFVISIEN 386

Query: 414 HGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMI 473
            G R +PH  NA+I+++++S ANS  Y S R+LYSL+  G+AP  F  +  +G P   +I
Sbjct: 387 AGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVI 446

Query: 474 MSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEI 533
           ++AL  ++AF   ++   + F WL+ IS L+ L  W+ I +SH+RF  A+K +G S D++
Sbjct: 447 VTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDL 506

Query: 534 GFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGY 593
            FK++   +GS YA   +T+ +  + + + +P      D  +FF  Y+++ +L VL+ G 
Sbjct: 507 PFKARFMPYGSYYACFFITVIIFIQGFTAFSP----KFDVASFFTAYISLILLAVLFIGC 562

Query: 594 KICKRDWKLFIRAKDIDLVSHRKIYD 619
           ++  R  + F + +DID+ + R+  D
Sbjct: 563 QLYYRC-RFFWKVEDIDIDTDRREID 587

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  276 bits (707), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 152/497 (30%), Positives = 254/497 (51%), Gaps = 12/497 (2%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           D  +++ +KPRH+                  S +  AGP G ++ Y  MG+  +C+ Q+ 
Sbjct: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GEMA  +  +  +F  Y    +  A G +  ++Y   W     LEL      IQYWT  V
Sbjct: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
                                + Y E EF+  + KVL + GF I A+V+  GG+ ++G +
Sbjct: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236

Query: 308 GAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           G +YW NPG +       +K   RF   +S           +E + I A E  NPR+ +P
Sbjct: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            A   + +RILF ++ S+  VG LVPY    L  +  +    SP+V+A+ + G +V+P  
Sbjct: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
            N VIL+++LS  NS  Y   R+LY LS+ G APS F   +++G P  A++ S++F  +A
Sbjct: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           +   S   + VF WLL I+ ++  F W+ I +SHIRF + +K +G S +++ FK++   W
Sbjct: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
           G+ YAA  +T+ ++ + + S AP          F  +Y+++ + IV + G+++  +  +L
Sbjct: 477 GAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531

Query: 603 FIRAKDIDLVSHRKIYD 619
            +R +D+D+ + R+  D
Sbjct: 532 ILRKEDVDIDTDRREID 548

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  275 bits (704), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 164/549 (29%), Positives = 269/549 (48%), Gaps = 37/549 (6%)

Query: 76  KQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTI 135
           K+ +  +L+  F R++D+              +L  L + K+ Q           +++ +
Sbjct: 11  KEKNSEELVSEFSRSKDV-------------VSLESLGSVKETQ-----------VKRAL 46

Query: 136 KPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYS 195
           KPRH+                  + L  AGP G +I Y  +G+  Y + Q+ GEMA  + 
Sbjct: 47  KPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMA-TFI 105

Query: 196 GLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXX 255
            +  +F  +    +  A G +  ++Y L W     LEL      IQ+WT  V        
Sbjct: 106 PVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIII 165

Query: 256 XXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNP 315
                        K Y E EF+    KVL + GF I A ++   GAG  G +G +YW NP
Sbjct: 166 LWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGPVGFRYWRNP 224

Query: 316 GAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIY 370
           G +       D +  RF   +S           +E + I A E +NPR+ +P A   + +
Sbjct: 225 GPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFF 284

Query: 371 RILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLS 430
           RILF ++ S+  +G LVP+N  +L    S  + +SP+VIA+ + G +V+PH  NAVIL +
Sbjct: 285 RILFFYILSLLFIGLLVPFNDPKLKSEDSYIS-SSPFVIAIENSGTKVLPHIFNAVILST 343

Query: 431 VLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKE 490
           ++S  NS  Y S R+LYS+   G AP +  +  + G P  A++ ++L   +A+   S   
Sbjct: 344 IISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGA 403

Query: 491 EDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIM 550
             VF WLL I+ ++  F W+ I V+HIRF +A+K QG S D++ FK++   WG+ YAA  
Sbjct: 404 SVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFF 463

Query: 551 MTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDID 610
           + + +I + + + AP      +  +FF  Y+++ +   ++ G++I  R   LF + +DID
Sbjct: 464 IGVIIIIQGFTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDID 518

Query: 611 LVSHRKIYD 619
           L + R+  D
Sbjct: 519 LDTDRREID 527

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/523 (29%), Positives = 266/523 (50%), Gaps = 23/523 (4%)

Query: 108 TLSPLSATKDPQFAPHAEEKDDH---LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKA 164
           +++P S  + P+   H +E D H   +++ +K RH+                  S L  A
Sbjct: 36  SITPDSGDEFPE--EHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTA 93

Query: 165 GPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQ 224
           GP G +I Y  MG+ +Y I Q+ GEMA  +  +  +   +    +  AFG +  ++Y   
Sbjct: 94  GPVGSLIAYIFMGTVVYSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFN 152

Query: 225 WLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVL 284
           W     +EL      I YWT+ V                     + Y E EF+  S KV+
Sbjct: 153 WAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVI 212

Query: 285 MMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXX 339
            + G+ I A ++  GG+ + G IG + W NPG +       +++  RF   +S       
Sbjct: 213 TIVGYLIYAFIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAF 271

Query: 340 XXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGS 399
               +E + I A E  NPR+ +P A   + +RILF ++ S+  VG LVPYN   +  +  
Sbjct: 272 TYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSD 331

Query: 400 AATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWF 459
               ASP+VI++ + G +++P   NAV+L++V+S ANS  Y   R++YSL+Q G AP  F
Sbjct: 332 TDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQF 391

Query: 460 NYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRF 519
            Y++R G P   ++++AL  ++AF   ++  +  F WL+ IS L+ L  W+ I ++HIRF
Sbjct: 392 GYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRF 451

Query: 520 RRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFEN 579
            + +K +G S D + FK++   W + YAA  + + +  + + + +P      D   FF  
Sbjct: 452 MQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSP----KFDVTQFFTA 507

Query: 580 YLAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRKIYD 619
           Y+++ +++V++ G +I   C+  WKL    +DID+ ++R+  D
Sbjct: 508 YISLMLMLVVFIGCQIYYKCRFLWKL----EDIDIDTNRREID 546

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  275 bits (702), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 156/502 (31%), Positives = 260/502 (51%), Gaps = 13/502 (2%)

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
             + ++  +++ +KPRHV                  S L  +GP G +I Y  MG+ +Y 
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           + Q+ GEMA  +  +  +   + S  +  AFG +  ++Y   W     +EL      I+Y
Sbjct: 167 VTQSMGEMA-TFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEY 225

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WT  V                     + Y E EF+  S KVL + G+ I A+VI  GG+ 
Sbjct: 226 WTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS- 284

Query: 303 NDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
             G IG +YW NPG +       DK   RF   ++           +E + I A E +NP
Sbjct: 285 KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANP 344

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417
           RR +P A   + +RILF ++ S+  VG LVPYN + L  + +    +SP+VI++ + G R
Sbjct: 345 RRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKT-TTVIASSPFVISIQNAGTR 403

Query: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477
            +P   NAV+L++++S ANS  Y   R+L+SL+  G AP  F+ +  +G P   +I+++L
Sbjct: 404 ALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSL 463

Query: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537
             ++AF   +    + F WL+ IS L+ L  W+ I +SHIRF + +K +G S D++ FKS
Sbjct: 464 LGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKS 523

Query: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICK 597
           ++  +G+ YAA  +T+ +  + + + +P    H     FF +Y+++ +L+V++ G ++  
Sbjct: 524 KLMPYGAYYAAFWVTVIIFVQGFQAFSP----HFKVTEFFTSYISLMLLVVVFCGAQLFY 579

Query: 598 RDWKLFIRAKDIDLVSHRKIYD 619
           R  + F R +DID+ S R+  D
Sbjct: 580 RC-RFFNRLEDIDIDSDRREAD 600

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  273 bits (699), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 251/495 (50%), Gaps = 16/495 (3%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           D  +++ +KPRH+                    L ++GP G +I Y  MGS +Y + Q+ 
Sbjct: 99  DTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSL 158

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GEMA  +  +  +   +    +  A G S  ++Y   W      EL      IQYWT  V
Sbjct: 159 GEMA-TFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKV 217

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
                                K Y E EF+ +S KVL + G+ I A+VI  GG+   G I
Sbjct: 218 PLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS-RQGPI 276

Query: 308 GAKYWHNPGAFRGDKSIDRFKD------VMSXXXXXXXXXGASEFIAIGASEQSNPRRAI 361
           G +YW +  AF GD  I + KD       +S           +E + I A E +NPR+ +
Sbjct: 277 GFRYWRHGYAF-GDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTV 335

Query: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421
           P A   +I+RI   ++ S+  +G LVPYN   L   GSA   +SP+VI++ + G   +P 
Sbjct: 336 PRAINKVIFRIALFYILSLFFIGLLVPYNDKRL-SDGSAIIASSPFVISMLNAGTSALPD 394

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
             NAVIL++VLS ANS  Y + R+LY+L+ QG AP  F Y++R G P   + ++ L   +
Sbjct: 395 IFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWL 454

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           AF   S+     F WL+ IS L+ L  W  IC +HIRF +A+K +G S D++ FK++   
Sbjct: 455 AFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMP 514

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
           WG+ YAA  + L +  + + +  P      D ++FF +Y+++ +  VLY G  I  R  +
Sbjct: 515 WGAYYAAFFVGLIIFIQGYDAFTP-----WDTKSFFTSYISLILFGVLYLGCLIYYRG-R 568

Query: 602 LFIRAKDIDLVSHRK 616
           L I+ +DID+ + RK
Sbjct: 569 LLIKIEDIDIDTDRK 583

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  271 bits (693), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 183/610 (30%), Positives = 299/610 (49%), Gaps = 41/610 (6%)

Query: 17  TESKYEMKE--ITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFN 74
           T +K++ K+  I + S  + PE D I    E       A++ S+    Y+  +K    +N
Sbjct: 9   TSNKWDEKQNNIGEQSMQELPE-DQIEHEME-------AIDPSNKTTPYSIDEK---QYN 57

Query: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKT 134
            K+ H      S +     D      I N LT        T   +    A  +D H+++ 
Sbjct: 58  TKKKH-----GSLQGGAIADV---NSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRA 109

Query: 135 IKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAY 194
           +K RH+                  + L  AGP G +I Y  MG+ +Y + Q+ GEMA  +
Sbjct: 110 LKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMA-TF 168

Query: 195 SGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXX 254
             +  +   +    +  AFG S  ++Y   W     +E+      I+YWT  V       
Sbjct: 169 IPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIA 228

Query: 255 XXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHN 314
                         K Y E EF+  S KVL + G+ I A++I  GG+ + G IG +YW N
Sbjct: 229 IFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRN 287

Query: 315 PGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMI 369
           PGA+       DKS  RF   +S           +E + I A E +NPR+ +P A   ++
Sbjct: 288 PGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVV 347

Query: 370 YRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILL 429
           +RI+  ++ S+  +G LVPYN + L  S SA   +SP+VI++ + G   +P   NAV+L+
Sbjct: 348 FRIVLFYIMSLFFIGLLVPYNDSRLSAS-SAVIASSPFVISIQNAGTYALPDIFNAVVLI 406

Query: 430 SVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSK 489
           +V+S ANS  Y   R+LYSL++ G AP  F Y+ R+G P   ++ +A   ++AF   ++ 
Sbjct: 407 TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNN 466

Query: 490 EEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAI 549
               F WL+ IS L+ L  W+ I ++HIRF +A+K +G S D++ FK+++  +G+ YAA 
Sbjct: 467 ANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAF 526

Query: 550 MMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRA 606
            +T+ +  + + +  P          FF +Y+++ +L V++ G +I   C+  WKL    
Sbjct: 527 FVTVIIFIQGFQAFCP-----FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKL---- 577

Query: 607 KDIDLVSHRK 616
           +DID+ S R+
Sbjct: 578 EDIDIDSDRR 587

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  271 bits (693), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 259/502 (51%), Gaps = 19/502 (3%)

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
            A+ +D  +++ +K RH+                  + L  AGP G +I Y  MGS +Y 
Sbjct: 96  EAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYF 155

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           + Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+      IQY
Sbjct: 156 VTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 214

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WT  V                     K Y E EF+  S KVL + G+ I A++I  GG+ 
Sbjct: 215 WTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS- 273

Query: 303 NDGYIGAKYWHNPGAFR----GDKSID-RFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
           + G IG +YW NPG +      DK+ + RF   +S           +E + I A E +NP
Sbjct: 274 HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 333

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417
           R+++P A   +++RI   ++ S+  +G LVP+N   L  + SA   +SP+VI++ + G R
Sbjct: 334 RKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL-ANDSAVIASSPFVISIQNAGTR 392

Query: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477
            +P   NAV+LL+++S ANS  Y   R+LY+L+  G AP  F+Y+ + G P   +I +A 
Sbjct: 393 ALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAA 452

Query: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537
             ++AF   ++     F WL+ IS L+ L  W+ I +SHIRF +A+K +G S D++ FK+
Sbjct: 453 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKA 512

Query: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG---YK 594
           ++  WG+ YA+  +T+ +  + + +  P      D   FF +Y+++ +L VL+ G   Y 
Sbjct: 513 KLMPWGAYYASFFVTVIIFIQGFQAFTP----KFDVSTFFTSYISLILLAVLFSGCQLYY 568

Query: 595 ICKRDWKLFIRAKDIDLVSHRK 616
            C+  WK+    +DID+ S R+
Sbjct: 569 RCRFIWKV----EDIDIDSDRR 586

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  270 bits (690), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 150/521 (28%), Positives = 267/521 (51%), Gaps = 18/521 (3%)

Query: 91  EDIDAPTNRDIENELTTTLSPL---SATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXX 147
           E+     ++ +E+ +++   P+   S    P      + ++  +++ +KPRH+       
Sbjct: 13  ENTKPSVSKKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGG 72

Query: 148 XXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSF 207
                      S L ++GP G +I Y  +GS +Y + Q+ GEMA  +  +  +   +   
Sbjct: 73  TIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMA-TFIPVTSSITVFSKR 131

Query: 208 LVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXG 267
            +  AFG +  ++Y   W     +E+      IQYWT  V                    
Sbjct: 132 FLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFP 191

Query: 268 AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDK 322
            K Y E EF+  S KV+ + G+ I A+VI  GG+ + G IG +YW NPG +       D 
Sbjct: 192 VKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPWGPGIISKDV 250

Query: 323 SIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITL 382
           +  RF   +S           +E + I A E +NPR+ +P A   + +RILF ++ S+  
Sbjct: 251 NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFF 310

Query: 383 VGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSS 442
           +G LVPY+   L  + +A   +SP+VI++ + G +V+PH  NA+++++++S ANS  Y  
Sbjct: 311 IGLLVPYDDLRLSNT-TAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVG 369

Query: 443 CRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISG 502
            R+LYSL+  G AP  F Y+ ++G P   +I++AL  ++AF   ++   + F WL+ IS 
Sbjct: 370 SRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNIST 429

Query: 503 LSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVS 562
           L+ L  W+ I +SH+RF + +K +G S +++ FK+++  WG+ YAA  + + +I + + +
Sbjct: 430 LAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKA 489

Query: 563 IAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CKRDW 600
             P         +FF +Y+++ +L VL+ G ++   C+  W
Sbjct: 490 FTP----KFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIW 526

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  270 bits (691), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/566 (29%), Positives = 281/566 (49%), Gaps = 32/566 (5%)

Query: 56  DSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT 115
           DSD+D E + +KK   +  +    L   +       D  +  N D++         LS T
Sbjct: 37  DSDTDMEPSQRKKAAMAGKLFSDQLSYNVS----VADNSSAANGDLD---------LSDT 83

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
           ++   A H +  D  +++ +K RH+                  + L  AGP G +I Y  
Sbjct: 84  EE---AGHVQ--DTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIF 138

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MGS +Y I Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+  
Sbjct: 139 MGSIIYFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISV 197

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
               IQYWT  V                     K Y E EF+  S KVL + G+ I A+V
Sbjct: 198 VGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALV 257

Query: 296 INTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIG 350
           I  GG+ + G IG +YW NPG +       D +  RF   +S           +E + I 
Sbjct: 258 IVCGGS-SQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGIT 316

Query: 351 ASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIA 410
           A E +NPR+++P A   +++RI   ++ S+  +G LVPYN   L  SG +   +SP+VI+
Sbjct: 317 AGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL-SSGDSYIASSPFVIS 375

Query: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470
           + + G   +P   NAV++L+++S ANS  Y   R+LY+L+Q G AP  F Y+ + G P  
Sbjct: 376 IQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWL 435

Query: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530
            +I++A   ++AF   ++     F WL+ IS L+ L  W  I +SHIRF +A+K +G S 
Sbjct: 436 GVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISR 495

Query: 531 DEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLY 590
           D++ FK+++  WG+ Y+A  + + +  + + +  P      D   FF +Y+++ +L+V++
Sbjct: 496 DDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-----WDTTTFFTSYISLILLVVVF 550

Query: 591 FGYKICKRDWKLFIRAKDIDLVSHRK 616
            G ++  R  +  ++ +DID+ + R+
Sbjct: 551 IGCQLYYRC-RFLLKVEDIDIDTDRR 575

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  270 bits (691), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 161/500 (32%), Positives = 256/500 (51%), Gaps = 19/500 (3%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           D  +++ +K RH+                  + L  +GP G +I Y  MG+ +Y + Q+ 
Sbjct: 88  DTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSL 147

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+      IQYWT  V
Sbjct: 148 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKV 206

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
                                K Y E EF+  S KV+ + G+ I A++I  GG+ + G I
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPI 265

Query: 308 GAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           G +YW NPGA        D    RF   +S           +E + I A E +NPR+++P
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            A   +++RI+  ++ S+  VG LVPYN   L  S SA   +SP+VI++ + G +V+P  
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSAS-SAVIASSPFVISIQNAGTKVLPDI 384

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
            NAV+L++V+S ANS  Y   R+LY+L+Q G AP  F Y+ R G P   +I +AL  ++A
Sbjct: 385 FNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLA 444

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           F   +      F WL+ IS L+ L  W+ I ++HIRF +A+K +G S D++ FK++   W
Sbjct: 445 FLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPW 504

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG---YKICKRD 599
           G+ YA+  +T+ +  + + + AP      D   FF  Y+++ +L+VL+ G   Y  C+  
Sbjct: 505 GAYYASFFVTVIIFIQGFQAFAP----KFDVSEFFTAYISLILLVVLFAGCQLYYRCRFL 560

Query: 600 WKLFIRAKDIDLVSHRKIYD 619
           WKL    +DID+ S R+  D
Sbjct: 561 WKL----EDIDIDSDRREID 576

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  270 bits (690), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 157/495 (31%), Positives = 255/495 (51%), Gaps = 20/495 (4%)

Query: 130 HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGE 189
           H+++ +K RH+                  + L  AGP G +I Y  MG+ +Y I Q+ GE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 190 MAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNA 249
           MA  +  +  +   +    +  AFG S  ++Y   W     +E+      IQYWT  V  
Sbjct: 165 MA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 223

Query: 250 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGA 309
                              K Y E EF+  S KVL + G+ I A+VI  GG+ + G IG 
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIGF 282

Query: 310 KYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSA 364
           +YW NPGA+       +KS  RF   +S           +E + I A E +NPR+ +P A
Sbjct: 283 RYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 365 AKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFIN 424
              +++RI+  ++ S+  +G LVPYN   L  S SA   +SP+VI++ + G   +P   N
Sbjct: 343 INKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPS-SAVIASSPFVISIQNAGTYALPDIFN 401

Query: 425 AVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFC 484
           AV+L++V+S ANS  Y   R+LYSL+Q G AP  F Y+ ++G P   ++ +A   ++AF 
Sbjct: 402 AVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFL 461

Query: 485 ACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGS 544
             ++     F WL++IS L+ L  W+ I ++HIRF +A+K +G S D++ FK+++  +G+
Sbjct: 462 VVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGA 521

Query: 545 SYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG---YKICKRDWK 601
            YA+  +T+ +  + + +  P          FF +Y+++ +L V++     Y  C+  WK
Sbjct: 522 YYASFFVTIIIFIQGFQAFCP-----FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 602 LFIRAKDIDLVSHRK 616
           L    +DID+ S R+
Sbjct: 577 L----EDIDIDSDRR 587

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  268 bits (686), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/502 (30%), Positives = 254/502 (50%), Gaps = 13/502 (2%)

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
             + ++  +++ +KPRHV                  S L  AGP G +I Y  MGS +Y 
Sbjct: 46  EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYF 105

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           + Q+ GEMA  +  +  +   + +  +  AFG +  ++Y   W     +E+      IQY
Sbjct: 106 VTQSMGEMA-TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 164

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WT  V                     + Y E EF+  S KV+ + G+ + A++I  GG+ 
Sbjct: 165 WTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS- 223

Query: 303 NDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
             G IG +YW NPG +      GDK   RF   ++           +E + I A E +NP
Sbjct: 224 KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANP 283

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417
           R+ +P A   + +RILF ++ S+  VG LVPYN   L    ++   +SP+VI++ S G R
Sbjct: 284 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTR 342

Query: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477
           ++P   NAV+L++++S ANS  Y   RIL+SL+  G AP  F+Y+  +G P   +I +AL
Sbjct: 343 ILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTAL 402

Query: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537
             ++AF        + F WL+ IS L+ L  W+ I +SHIRF + +K +G S D++ FKS
Sbjct: 403 LGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKS 462

Query: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICK 597
           ++  +G+ YAA  + + +  + + +  P          FF  Y+++ +L V++   ++  
Sbjct: 463 KLMPYGAYYAAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISLILLAVVFCLAQLYY 518

Query: 598 RDWKLFIRAKDIDLVSHRKIYD 619
           R  + F R +DID+ S R+  D
Sbjct: 519 RC-RFFNRLEDIDIDSDRREID 539

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  268 bits (686), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 260/512 (50%), Gaps = 16/512 (3%)

Query: 114 ATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGY 173
           +++D Q       ++  +Q+ +KPRHV                  S L  AGP G +I Y
Sbjct: 37  SSQDSQLGSSGHGRNA-VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISY 95

Query: 174 AIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLEL 233
             MGS  YC+ Q+ GEMA  +  +  +F  +    +    G +  ++YC  W     LEL
Sbjct: 96  LFMGSIAYCVTQSLGEMA-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALEL 154

Query: 234 VTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILA 293
                 I+YWT+ V                     K Y E +F+    KV+ + GF +  
Sbjct: 155 SIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYC 214

Query: 294 IVINTGGAGNDGYIGAKYWHNPGAFRGDKSID------RFKDVMSXXXXXXXXXGASEFI 347
           + +   GAG  G +G +YW NPG + GD  I       RF   +S           +E +
Sbjct: 215 LCM-VCGAGKTGPVGFRYWRNPGPW-GDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELV 272

Query: 348 AIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPY 407
            I A E +NPR+ +P A   + +RIL  ++ S+  +G LVP+N  +L  S S  +  SP+
Sbjct: 273 GISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSY-SAGSPF 331

Query: 408 VIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGR 467
           +IA+ + G +++P   NAVIL +++S ANS  Y   R+LY L+++  AP +F   +R G 
Sbjct: 332 IIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGV 391

Query: 468 PARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQG 527
           P  A++  A F  + + + S+     F WLL I+ ++  F+W+ I + H+RF +A+K+QG
Sbjct: 392 PDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQG 451

Query: 528 RSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILI 587
            S D++ FK+++  WG+ Y+A  +TL +I + + S+AP      +  NFF  Y+++ + +
Sbjct: 452 ISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPT----FNVSNFFAAYISVFMFL 507

Query: 588 VLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           V++  ++   R  ++  R + +D+ S R+  D
Sbjct: 508 VIWAVFQCWYRT-RIIHRIEHVDIDSDRREVD 538

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  268 bits (686), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 156/542 (28%), Positives = 266/542 (49%), Gaps = 29/542 (5%)

Query: 94  DAPTNRDIEN-ELTTTLSPLSATK-DPQFAPHAEE---KDDHLQKTIKPRHVXXXXXXXX 148
           D    + I N EL +     S ++ +P+    AEE   +D  +++ +K RH+        
Sbjct: 42  DNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGT 101

Query: 149 XXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFL 208
                     + L  AGP G +I Y  MGS +Y + QA GEMA  +  +  +   +    
Sbjct: 102 IGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMA-TFIPVTSSITVFSQRF 160

Query: 209 VDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGA 268
           +  AFG +  ++Y   W     +E+      IQYWT  V                     
Sbjct: 161 LSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPV 220

Query: 269 KGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSID--- 325
           K Y E EF+    KV+ + G+ + A++I  GG+   G IG +YW NPGA+    + D   
Sbjct: 221 KVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEP 280

Query: 326 --------RFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
                   RF   ++           +E + I A E +NPR+ +P A   +++RI+  ++
Sbjct: 281 IYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYI 340

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            S+  +G LVP+  + L    +    +SP+VI++ + G +++P   NA+++++VLS ANS
Sbjct: 341 MSLFFIGLLVPFTDSRL-SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANS 399

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
             Y   R+LYSL+    AP  F  + R+G P   +I ++L  ++AF    +     F WL
Sbjct: 400 NVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWL 459

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           + IS L+ L  W+ I ++H+RF + +K +G S D++ FK++   WGS YAA  + + +  
Sbjct: 460 VDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFV 519

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG---YKICKRDWKLFIRAKDIDLVSH 614
           + + + +P    H D   FF +Y+++ +L V++ G   Y  C+  WKL    +D+D+ S 
Sbjct: 520 QGFQAFSP----HFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKL----EDVDIDSD 571

Query: 615 RK 616
           R+
Sbjct: 572 RR 573

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  268 bits (684), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/494 (30%), Positives = 255/494 (51%), Gaps = 13/494 (2%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           D  +++ +K RH+                  + L  +GP G +I Y  MGS +Y I Q+ 
Sbjct: 90  DTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSL 149

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+      I+YWT  V
Sbjct: 150 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
                                K Y E EF+    KVL + G+ + A++I  GG+ + G I
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGPI 267

Query: 308 GAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           G +YW NPG +       D +  RF   +S           +E + I A E +NPR+ +P
Sbjct: 268 GFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 327

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            A   +++RI   ++ S+  +G LVPYN  E + S SA   +SP+VI++ + G +V+P  
Sbjct: 328 RAINKVVFRIALFYIMSLFFIGMLVPYND-ERLASTSAVIASSPFVISIQNAGTKVLPDI 386

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
            NA+++++++S ANS  Y   R+LY+L+  G AP  F ++ R G P   +I+++   ++A
Sbjct: 387 FNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLA 446

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           F   ++     F WL+ IS L+ L  W+ I +SHIRF +A+K +G S D++ FK+++  +
Sbjct: 447 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPF 506

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
           G+ YA   +T+ +  + + + +P    H D   FF +Y+++ IL VL+ G +I  R  + 
Sbjct: 507 GAYYATFFVTVIIFIQGFQAFSP----HWDTTAFFTSYISLIILAVLFIGCQIFYRC-RF 561

Query: 603 FIRAKDIDLVSHRK 616
           F R +DID+ S R+
Sbjct: 562 FWRVEDIDIDSDRR 575

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  267 bits (683), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 159/501 (31%), Positives = 260/501 (51%), Gaps = 20/501 (3%)

Query: 124 AEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCI 183
           A  +D H+++ +K RH+                  + L KAGP G +I Y  MG+ +Y I
Sbjct: 100 AHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFI 159

Query: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243
            Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+      IQYW
Sbjct: 160 TQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYW 218

Query: 244 TTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 303
           T  V                     K Y E EF+  S KVL + G+ I A+VI  GG+ +
Sbjct: 219 TDKVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-H 277

Query: 304 DGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPR 358
            G IG +YW NPGA+       DK+  RF   +S           +E + I A E +NPR
Sbjct: 278 QGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 337

Query: 359 RAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRV 418
           + +P A   +++RI+  ++ S+  +G LVPYN   L  S SA   +SP+VI++ + G   
Sbjct: 338 KTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSAS-SAVIASSPFVISIQNAGTYA 396

Query: 419 VPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALF 478
           +P   NAV+L++V+S ANS  Y   R+LYSL+Q G AP  F Y+ ++G P   ++ +A  
Sbjct: 397 LPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 456

Query: 479 SVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQ 538
            ++AF   ++     F WL+ IS L+ L  W+ I ++HIRF +A++ +G S D++ FK++
Sbjct: 457 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAK 516

Query: 539 VGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG---YKI 595
           +  +G+ YAA  +T+ +  + + +  P         +FF +Y+++ +L V++ G   Y  
Sbjct: 517 LMPYGAYYAAFFVTVIIFIQGFQAFCP-----FKVSDFFTSYISLILLAVVFTGCQLYYK 571

Query: 596 CKRDWKLFIRAKDIDLVSHRK 616
           C+  WKL    +DID+ + R+
Sbjct: 572 CRFIWKL----EDIDIDTDRR 588

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  266 bits (680), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 153/500 (30%), Positives = 254/500 (50%), Gaps = 19/500 (3%)

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
           +  D  +++ +K RH+                    L  +GP G +I Y  MGS +Y I 
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +E+      I+YWT
Sbjct: 155 QSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWT 213

Query: 245 TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304
             V                     K Y E EF+    KVL +AG+ + A++I  GG+ + 
Sbjct: 214 KKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQ 272

Query: 305 GYIGAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRR 359
           G IG +YW NPG +       DK+  RF   +S           +E + I A E +NPR+
Sbjct: 273 GPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 332

Query: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVV 419
           ++P A   +++RI   ++ S+  +G LVPY+   L    SA   +SP+VI++ + G +++
Sbjct: 333 SVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSD-SAVVASSPFVISIQNAGTKIL 391

Query: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479
           P   NA+++++V+S ANS  Y   R+LY+L+Q G AP  F Y+ R G P   ++ +A   
Sbjct: 392 PDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALG 451

Query: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539
           ++AF   ++     F WL+ IS L+ L  W+ I +SHIRF +A+K +G S D++ FK++ 
Sbjct: 452 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKF 511

Query: 540 GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---C 596
             W + YA   +T+ +  + + + +P    H D   FF  Y+++ IL VL+ G +I   C
Sbjct: 512 MPWAAYYATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQIYYRC 567

Query: 597 KRDWKLFIRAKDIDLVSHRK 616
           +  WKL    +DID+ + R+
Sbjct: 568 RFFWKL----EDIDIDTDRR 583

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  265 bits (678), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 153/502 (30%), Positives = 255/502 (50%), Gaps = 19/502 (3%)

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
             E ++  +++ +K RH+                    L  AGP G +I Y  MGS  Y 
Sbjct: 76  QGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYS 135

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           + Q+ GEMA  +  +  +F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 136 VTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEF 194

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WT  V                     K Y E EF+  S KVL + GF I    +   GAG
Sbjct: 195 WTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAG 253

Query: 303 NDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
             G +G +YW NPGA+       DK+  RF   +S           +E + I A E +NP
Sbjct: 254 VTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417
           R+ +P A K +++RIL  ++ S+  +G LVPYN  +L  + ++    SP++IA+ + G +
Sbjct: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-TATSYVSVSPFIIAIENSGTK 372

Query: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477
           V+PH  NAVIL +++S ANS  Y   RIL+ LS+   AP + +   + G P  A+ ++A+
Sbjct: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAV 432

Query: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537
           F  +A+   S+  + VF WLL I+G++  F W+ I +SHIRF +A+K +G S DE+ FK+
Sbjct: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKA 492

Query: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-- 595
           ++    + +AA  M + ++ + + + AP      D  +F   Y+++ + + ++  ++I  
Sbjct: 493 KLMPGLAYFAATFMIIIILIQGFTAFAP----KFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 596 -CKRDWKLFIRAKDIDLVSHRK 616
            C+  WK+    +D+D+ S R+
Sbjct: 549 RCRFIWKI----EDVDIDSDRR 566

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  265 bits (678), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 152/509 (29%), Positives = 256/509 (50%), Gaps = 13/509 (2%)

Query: 113 SATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIG 172
           SAT           K   +++ +KPRH+                    L  AGP G +I 
Sbjct: 75  SATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIA 134

Query: 173 YAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLE 232
           Y  +G+ ++ + Q+ GEM V +  +  +F  +    +  AFG +  ++Y   W     +E
Sbjct: 135 YIFVGTIIFSVTQSLGEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVE 193

Query: 233 LVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
           L      IQ+WTT V                     K Y E EF+    KVL + GF I 
Sbjct: 194 LSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIF 253

Query: 293 AIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFI 347
            + I T GAG  G  G +YW +PGA+       D+S  RF   +S           +E +
Sbjct: 254 CLCI-TSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELV 312

Query: 348 AIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPY 407
            I A E +NPR+A+P A K +I RILF ++ S+  +G LVP+N  +L  S ++   +SP+
Sbjct: 313 GITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLT-SATSFVSSSPF 371

Query: 408 VIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGR 467
           +IA+ + GV ++P   N VIL++++S  NS  Y   RIL+ L+    AP +F    + G 
Sbjct: 372 IIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGV 431

Query: 468 PARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQG 527
           P  A++ ++LF  +AF   ++  + VF WLL+I  ++  F W+ I +SHIRF +A++ +G
Sbjct: 432 PFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRG 491

Query: 528 RSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILI 587
            S + + FK+    W + YA   + L ++ + + + AP      +  +F  +Y+++ + +
Sbjct: 492 ISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAP----RFNVSDFVASYISLLLFV 547

Query: 588 VLYFGYKICKRDWKLFIRAKDIDLVSHRK 616
           +++  ++  K+  ++F + +DIDL S RK
Sbjct: 548 IIWGVFQAMKKC-RIFWKVEDIDLDSDRK 575

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  266 bits (679), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 179/599 (29%), Positives = 290/599 (48%), Gaps = 45/599 (7%)

Query: 36  EQDNIVEYFENTTGIPAAVNDSDSDFEY------NGKKKILPSFNIKQPHLRK----LID 85
           EQDN  E         +  +DS +  E+         K +  S + KQ +L+K    ++D
Sbjct: 16  EQDNSEE--------QSIRDDSTNQIEHEMEVIDTSNKPVAYSIDEKQDNLKKKSGLMLD 67

Query: 86  SFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXX 145
                 DI++     I N LT +               A  +D H+++ +K RH+     
Sbjct: 68  G--TIGDINS-----ITNSLTRSQIASHEQGGDDEEEEAHYEDKHVRRALKQRHIGMIAL 120

Query: 146 XXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYP 205
                        + L  AGP G +I Y  MG+ +Y + Q+ GEMA  +  +  +   + 
Sbjct: 121 GGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEMA-TFIPVTSSITVFS 179

Query: 206 SFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXX 265
              +  AFG S  ++Y   W     +E+      I+YWTT V                  
Sbjct: 180 KRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKVPLGVWIAIFWVLITLMNF 239

Query: 266 XGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RG 320
              K Y E EF+  S KVL + G+ I A+VI  GG+   G IG +YW NPGA+       
Sbjct: 240 FPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGPIGFRYWRNPGAWGPGIISS 298

Query: 321 DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 380
           DK+  RF   +S           +E + I A E +NPR+ +P A   +++RI+  ++ S+
Sbjct: 299 DKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSL 358

Query: 381 TLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
             +G LVPY    L  S SA   +SP+VI++ + G   +P   NA++L++V+S ANS  Y
Sbjct: 359 FFIGLLVPYTDPRLSAS-SAVIASSPFVISIQNAGTYALPDIFNAIVLITVISAANSNVY 417

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
              R+LYSL+Q G AP  F Y+ ++G P   ++ +A   ++AF   ++     F WL+ I
Sbjct: 418 VGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINI 477

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           S L+ L  W+ I +SHIRF +A+  +G S D++ FK++   +G+ YA+  +T+ +  + +
Sbjct: 478 STLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGAYYASFFVTVIIFIQGF 537

Query: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFG---YKICKRDWKLFIRAKDIDLVSHRK 616
            S  P         +FF +Y+++ +L V++ G   Y  C+  WKL    +DID+ S R+
Sbjct: 538 QSFCP-----FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKL----EDIDIDSDRR 587

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  264 bits (675), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 179/602 (29%), Positives = 303/602 (50%), Gaps = 36/602 (5%)

Query: 52  AAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSP 111
           A+ ++ + D E  GK               K I SF+R E I  P + D        LS 
Sbjct: 17  ASFHNQEYDSEKGGKAG---------KRFDKFIGSFQRHEAI-IPEDVD--------LSL 58

Query: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVI 171
           L+  +   F    +      QKT+  RH+                  S+L       L+ 
Sbjct: 59  LNDYERSNFILAHQP----YQKTLSQRHLTMISIGGTLGTGLFIGIGSSLASGPGALLLG 114

Query: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231
              +  S ++C+IQA  E++  Y  + G+F+ + S  ++ + GF V+  Y L WL   P 
Sbjct: 115 FLLVGLS-IFCVIQAAAELSCQYP-VSGSFSTHVSRFIEPSVGFMVSTSYALSWLISFPS 172

Query: 232 ELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFI 291
           ELV  ++TI YW  +V+                    +G+AE E++ +  K++ +  F I
Sbjct: 173 ELVGLTLTIGYWNNSVSPGIWVAIFYLLIMAMNLFSVRGFAETEYWLSIIKIIAITIFII 232

Query: 292 LAIVINTGGAGND--GYIGAKYWHNPGAFRGDKSIDRFKDVMSXXXXXXXXXGASEFIAI 349
           + IV+  GG  N+  GY+G KYWH+PGAF+       F  + +         G +E + +
Sbjct: 233 IGIVVICGGGPNNQAGYLGTKYWHDPGAFKKP----YFSGICNTFVSAAFSFGGAELVLL 288

Query: 350 GASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVI 409
            A+E S    +I  AAK   +RI   +++++ ++  LVPY++  L+G+G      SP+VI
Sbjct: 289 TANE-SRKVESISRAAKGTFWRIAIFYISTVAVISCLVPYDNETLLGNGEGVAN-SPFVI 346

Query: 410 AVASHGV--RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGR 467
           ++A+ G   + V HF+NA+IL +VLSV NS+ Y++ R++ +L   G  PS   YID++GR
Sbjct: 347 SLANTGQFGKNVSHFMNAIILAAVLSVCNSSVYAASRVIQALGACGQLPSVCGYIDKKGR 406

Query: 468 PARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQG 527
           P   + +  +F ++AF        +VF WL A+  ++   TW +IC+S +RFRRA+KVQG
Sbjct: 407 PLVGIAICGVFGLLAFLVEYDNVTEVFNWLFALCSIAAFVTWWSICLSQLRFRRALKVQG 466

Query: 528 RSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILI 587
              +EI ++S +G+W      ++ T+ +  E +V+I    ++H  A+ FF+  +++P++I
Sbjct: 467 LGKEEIAYESMMGIWSGVVGIVLNTMLICGEIYVAIHASIDEH-SAKTFFQYCMSIPVMI 525

Query: 588 VLYFGYKICKRDWKL-FIRAKDIDLVSHRKIYDGXXXXXXXXXXXXXXXNGPFWKKVVAF 646
            +Y  ++I  ++W   F+RAKDIDL + +K  D                  P + ++  F
Sbjct: 526 TVYAAHRIYNKNWHTWFVRAKDIDLSTGKKAEDIELMKHEIMVSRAKIAASPLYYRIYRF 585

Query: 647 WC 648
           WC
Sbjct: 586 WC 587

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  264 bits (674), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 161/548 (29%), Positives = 268/548 (48%), Gaps = 20/548 (3%)

Query: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136
           Q H R+   S +  +  +    R   N +       S  +D Q     E ++  +++ +K
Sbjct: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQ-DTFSMEEDIQDEDEGEVQNAEVKRELK 89

Query: 137 PRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196
            RH+                  + L  AGP G +I Y  MGS  Y + Q+ GEMA  +  
Sbjct: 90  QRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIP 148

Query: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXX 256
           +  +F  +    +  AFG +  ++Y   W     LEL      IQ+WT  V         
Sbjct: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIF 208

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316
                       K Y E EF+  S KV+ + GF I    +   GAG  G +G +YW NPG
Sbjct: 209 WVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPG 267

Query: 317 AF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYR 371
           A+       +K+  RF   +S           +E + I A E +NPR+ +P A K +++R
Sbjct: 268 AWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327

Query: 372 ILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSV 431
           IL  ++ S+  +G LVPYN  +L  S ++    SP++IA+ + G +V+PH  NAVIL ++
Sbjct: 328 ILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTI 386

Query: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491
           +S ANS  Y   R+L+ LS+   AP +F+   + G P  A+  +++F  +A+   S+   
Sbjct: 387 ISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGG 446

Query: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551
            VF WLL I+G++  F W+ I VSHIRF +A+K +G S DE+ FK+++    + YA   M
Sbjct: 447 KVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFM 506

Query: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRAKD 608
            + ++ + + S  P      +  NF   Y+++ + + ++  +++   C+  WK+    +D
Sbjct: 507 VVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI----ED 558

Query: 609 IDLVSHRK 616
           +D+ S R+
Sbjct: 559 VDIDSDRR 566

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  263 bits (673), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 255/502 (50%), Gaps = 19/502 (3%)

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
             E ++  +++ +K RH+                  + L  AGP G +I Y  MGS  Y 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
           + Q+ GEMA  +  +  +F  +    +  AFG +  ++Y   W     LEL      IQ+
Sbjct: 136 VTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194

Query: 243 WTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 302
           WT  V                     K Y E EF+  S KVL + GF I    +   GAG
Sbjct: 195 WTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAG 253

Query: 303 NDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
             G +G +YW NPGA+       DK+  RF   +S           +E + I A E +NP
Sbjct: 254 VTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417
           R+++P A K +++RIL  ++ S+  +G LVPYN  +L  S S  +  SP++IA+ + G +
Sbjct: 314 RKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTK 372

Query: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477
           V+PH  NAVIL +++S ANS  Y   RIL+ LS+   AP + +   + G P  A+ ++A 
Sbjct: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAA 432

Query: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537
           F  +A+   S+  + VF WLL I+G++  F W+ I +SHIRF +A+K +G S DE+ FK+
Sbjct: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492

Query: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-- 595
           ++    + YAA  MT+ +I + + + AP      +  +F   Y+++ + + ++  ++   
Sbjct: 493 KLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIF 548

Query: 596 -CKRDWKLFIRAKDIDLVSHRK 616
            C+  WK+     D+D+ S R+
Sbjct: 549 RCRFIWKI----GDVDIDSDRR 566

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  262 bits (670), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 163/560 (29%), Positives = 277/560 (49%), Gaps = 29/560 (5%)

Query: 64  NGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAP--TNRDIENELTTTLSPLSATKDPQFA 121
            GK++   +  IK+   ++L+D+    +D  A    N  IEN+           K  + +
Sbjct: 12  EGKREANSAPTIKE---KELVDAQYEEQDTSAAIAANSSIEND---------GAKGTETS 59

Query: 122 PHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLY 181
           P +      +Q+ +K RH+                    L  AGP G +I Y  MG+ +Y
Sbjct: 60  PRSR---GEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIY 116

Query: 182 CIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQ 241
            + Q+ GEMA  +  +  +F+ +    +  A G +  ++Y L W     LEL      IQ
Sbjct: 117 SVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQ 175

Query: 242 YWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301
           YWT  V                     K Y E EF   S KV+ + GF I +  I  G  
Sbjct: 176 YWTHAVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAG 235

Query: 302 GNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
             DG IG +YW NPGA+       +K+  RF   +S           +E + I A E +N
Sbjct: 236 QPDGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 295

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGV 416
           PR+A+P A K ++ RIL  ++ S+  +G LVPYN  +L   G+  + ASP++I++ + G 
Sbjct: 296 PRKAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVS-ASPFMISIENSGT 354

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
           +V+P   NAV+L+++ S  NS  Y   R+LYSLS+   AP   + + R G P  A+++++
Sbjct: 355 KVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTS 414

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
           LF  +AF   S+     F WLL I+G++  F W+ I  SHIRF +A+K +G S D++ +K
Sbjct: 415 LFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYK 474

Query: 537 SQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIC 596
           +++  + + YA+  + L ++ + + + AP         +F   Y+++ +  +++  +++ 
Sbjct: 475 ARMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPVDFVAAYISVFLFAIIWLSFQLW 530

Query: 597 KRDWKLFIRAKDIDLVSHRK 616
            +  +L  + +DID+ S R+
Sbjct: 531 FKC-RLICKLQDIDIDSDRR 549

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  263 bits (671), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 163/576 (28%), Positives = 282/576 (48%), Gaps = 26/576 (4%)

Query: 53  AVNDSD---SDFEYNGK----KKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENEL 105
           AV DSD   S    +G     + I+P   I+   L+ +        D+ + T     + L
Sbjct: 12  AVGDSDDTRSQTSGDGSPYEMEDIVPDEKIRLQKLKHV----STQADVHSVTGSLTRSRL 67

Query: 106 TTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAG 165
            + +    A  D      AE  +  +++ +K RH+                  + L  AG
Sbjct: 68  NSRVDD-GAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAG 126

Query: 166 PGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQW 225
           P G +I Y  MG+ +Y + Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W
Sbjct: 127 PVGSLIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNW 185

Query: 226 LCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLM 285
                +E+      IQYWT  V                     K Y E EF+    KVL 
Sbjct: 186 AITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLA 245

Query: 286 MAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXX 340
           + G+ I A+VI  GG+ + G IG +YW +PGAF       +K+  +F   ++        
Sbjct: 246 IVGYLIYALVIVCGGS-HQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFT 304

Query: 341 XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSA 400
              +E + I A E +NPR+ +P A   +++RI+  ++ S+  +G L+PYN   L  +  A
Sbjct: 305 YQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL-SAQDA 363

Query: 401 ATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFN 460
              +SP+VI++ +   +V+P   NAV++++V+S ANS  Y   R+LY+L+  G AP  F+
Sbjct: 364 VIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFS 423

Query: 461 YIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFR 520
           Y+ R G P   ++ +A   ++AF   ++     F WL+ IS L+ L  W+ I ++HIRF 
Sbjct: 424 YVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFM 483

Query: 521 RAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENY 580
           +A+K +G S D++ FK+++  WG+ YAA  +T+ +  + + +  P      D   FF +Y
Sbjct: 484 QALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-----WDVSTFFTSY 538

Query: 581 LAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRK 616
           +++ +L VL  G ++  R  +  ++ +DID+ + R+
Sbjct: 539 ISLILLAVLVVGCQLYYRG-RFLLKLEDIDIDTDRR 573

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  263 bits (671), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 157/504 (31%), Positives = 259/504 (51%), Gaps = 18/504 (3%)

Query: 126 EKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQ 185
           +  D L+K ++ RHV                  ++L  AGP  + I Y+ +G  ++  + 
Sbjct: 94  KHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMA 153

Query: 186 ACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT 245
           A GEMA +Y  + G F +Y S  VD A GF+V + Y  ++L + P +L  AS+ IQYW  
Sbjct: 154 AIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 246 --TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 303
             TVN                  G K + E EF+ +S KVL+M G  +L  ++  GG  +
Sbjct: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPD 271

Query: 304 DGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPR 358
              +G +YW +PGAF+      D S+ +F   +S            E   I A+E  NPR
Sbjct: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331

Query: 359 RAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA--SPYVIAVASHGV 416
           +++P A K  ++RI+  +L +I L+G  V YN   L+ +  A T A  SP+V+A+ + G+
Sbjct: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGI 391

Query: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476
           RV+PH  NA +L+ V S  NS  Y   R LYSL+  G AP+ F      G P  ++ +  
Sbjct: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451

Query: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536
           LF+++A+   SS    VF + + +  +  L +WI I +++I F RA+KVQG    +  + 
Sbjct: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511

Query: 537 SQVGVWGSSYA-AIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595
           +    +G+ ++ A  + +A I  F V +        D +NF   Y+ +P+ ++ YFGYK 
Sbjct: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKF 567

Query: 596 CKRDWKLFIRAKDIDLVSHRKIYD 619
            K+     +++ ++DL + ++++D
Sbjct: 568 IKK--TKIVKSHEVDLFTGKEVFD 589

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  261 bits (666), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 155/528 (29%), Positives = 266/528 (50%), Gaps = 30/528 (5%)

Query: 97  TNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXX 156
           T R +E++         A K+ + +P   ++   +++ +K RH+                
Sbjct: 44  TERKVEDD---------AAKETESSP---QERREVKRKLKQRHIGMIALGGTIGTGLIIG 91

Query: 157 XXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS 216
               L  AGP G +I Y  MG+ +Y + Q+ GEM V +  +  +F+ +    +  A G +
Sbjct: 92  IGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGAT 150

Query: 217 VAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEF 276
             ++Y L W     LEL      IQYWT  V                     K Y E EF
Sbjct: 151 NGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEF 210

Query: 277 FFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVM 331
              S KV+ + GF I +  +  G   +DG IG +YW NPGA+       DK+  RF   +
Sbjct: 211 CIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWV 270

Query: 332 SXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNS 391
           S           +E + I A E +NPR+A+P A K ++ RIL  ++ S+  +G LVPYN 
Sbjct: 271 SSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYND 330

Query: 392 TELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQ 451
            +L   G   + +SP++I++ + G +V+P   NAV+L+++LS  NS  Y   R+LYSLS+
Sbjct: 331 PKLDSDGIFVS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389

Query: 452 QGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIA 511
              AP + + + R G P  +++ +++F  +AF   S+     F WLL I+G++  F W+ 
Sbjct: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449

Query: 512 ICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHL 571
           I  SHIRF +A++ +G S D++ +K+Q+  + + YA+  + L ++ + + + AP      
Sbjct: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TF 505

Query: 572 DAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
              +F   Y+++ + + ++  +++   C+  WKL    +DID+ S R+
Sbjct: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL----QDIDIDSDRR 549

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  259 bits (662), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 250/508 (49%), Gaps = 17/508 (3%)

Query: 100 DIENELTTTLSPLSATKDPQ----FAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXX 155
           D +  + + +SP+  T  P     +      +D  +++ +KPRH+               
Sbjct: 48  DEKTRVVSQVSPMR-TGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFI 106

Query: 156 XXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGF 215
              S L  AGP G +I Y  MG+  Y + Q+ GEMA  +  +  +F  +    +  AFG 
Sbjct: 107 GISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMA-TFIPVTSSFTVFTQRFLSPAFGV 165

Query: 216 SVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAE 275
           +  ++Y   W     LEL      IQ+WT  V                     K Y E E
Sbjct: 166 ANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVE 225

Query: 276 FFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDV 330
           F+    KVL + GF I A ++   GAG  G +G +YW NPG +       D +  RF   
Sbjct: 226 FWIACIKVLAIVGFIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 284

Query: 331 MSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390
           +S           +E + I A E  NPRR +P A   + +RILF ++ S+  +G LVP+N
Sbjct: 285 VSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFN 344

Query: 391 STELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLS 450
             +L    S  + +SP+VIA+ + G +V+PH  NAVIL +++S  NS  Y   R+LY L+
Sbjct: 345 DPKLKSEDSYIS-SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLA 403

Query: 451 QQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWI 510
           +   AP  F    ++G P  +++ +A F  +A+   S+  + VF WLL I+ ++  F W+
Sbjct: 404 KNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWL 463

Query: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDH 570
            I ++HIRF + +K +  S +++ FK++   WG+ Y+A  ++L +I + + + AP     
Sbjct: 464 FISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAP----K 519

Query: 571 LDAQNFFENYLAMPILIVLYFGYKICKR 598
            +  NFF  Y+++ + + ++  ++I  R
Sbjct: 520 FNVSNFFAAYISVFLFLAIWVVFQIRFR 547

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  258 bits (659), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 159/559 (28%), Positives = 277/559 (49%), Gaps = 22/559 (3%)

Query: 68  KILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEK 127
           +I PS ++K+  + + ID+     D D+  +   E       + +S+T+    A   +E 
Sbjct: 2   EIGPS-DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60

Query: 128 DDH--LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQ 185
            +H  +++++K RH+                  + L  AGP G ++ Y  MG+ ++ + Q
Sbjct: 61  LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 186 ACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT 245
           + GEMA  +  +  +F+ +    +  A G +  ++Y L W     LEL      IQ+WT 
Sbjct: 121 SLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179

Query: 246 TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDG 305
            V                     K Y E EF+  S KVL + GF I ++ I   GAG  G
Sbjct: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTG 238

Query: 306 YIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRA 360
            IG +YW NPGA        +    RF   +S           +E + I A E +NPR+A
Sbjct: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298

Query: 361 IPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVP 420
           +P A + ++ RIL  ++ S+  +G  VPYN  +L  + S  + +SP++I + + G RV+P
Sbjct: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS-SSPFIITIQNAGTRVLP 357

Query: 421 HFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSV 480
           H  NAVIL +++S  NS  Y   RIL+S+++ G AP +      +G P  +++  + F  
Sbjct: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417

Query: 481 IAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVG 540
           +++   S+     F WLL I+G++  F W+ I  SH+RF +A+K +G S D++ +K+   
Sbjct: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477

Query: 541 VWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CK 597
            W + YA   M + ++ + + S AP    H   ++F   Y+++ + +V +  ++I   C+
Sbjct: 478 PWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533

Query: 598 RDWKLFIRAKDIDLVSHRK 616
             WKL    +D+D+ + R+
Sbjct: 534 IIWKL----EDVDIDTDRR 548

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  258 bits (659), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 155/517 (29%), Positives = 258/517 (49%), Gaps = 15/517 (2%)

Query: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXX 152
           ID P     +N LT  L  +       F P        +++ +KPRHV            
Sbjct: 37  IDDPLRFSKDNNLT--LEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTG 94

Query: 153 XXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEA 212
                   L  AGP G +I + ++G+  Y + Q+ GEMA  +  +  +F  +    +  A
Sbjct: 95  LFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPA 153

Query: 213 FGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYA 272
            G +  ++Y   W     LEL      IQYWT  V  +                  K Y 
Sbjct: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213

Query: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD---KSID--RF 327
           E EF+  S KV+ + GF I ++ +   GAG +G IG +YW  PG +      K+++  RF
Sbjct: 214 EFEFWVASIKVIAIIGFLIYSLCM-VCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARF 272

Query: 328 KDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLV 387
              +S           +E + I A E  NPR+A+P A   + +RIL  ++ S+  +G LV
Sbjct: 273 LGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLV 332

Query: 388 PYNSTELMGSGSAATKA-SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRIL 446
           PYN  +L GS + +  A SP++IA+ +    V+PH  NAVIL +++S  NS  Y   RIL
Sbjct: 333 PYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL 392

Query: 447 YSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQL 506
           + LS+   AP +F+   + G P  A++++A+F  +A+   S+  ++VF WLL I+ ++  
Sbjct: 393 FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGF 452

Query: 507 FTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI 566
            TW+ I +SHIRF + +K +G S D++ +K++   + + YAA  +T+ +I + + + AP 
Sbjct: 453 ITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAP- 511

Query: 567 GEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF 603
              H +  +FF  Y+++ +  +++  ++   R  KLF
Sbjct: 512 ---HFNVSDFFAAYISVFLFFIVWAIFQTIYRT-KLF 544

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  256 bits (655), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 158/539 (29%), Positives = 267/539 (49%), Gaps = 16/539 (2%)

Query: 84  IDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXX 143
           + SF +   +     + +E   +++L+     +  Q    A  ++  +Q+ +KPRHV   
Sbjct: 3   MQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQI-DTASSQERGIQRALKPRHVSMI 61

Query: 144 XXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNA 203
                          + L  AGP G +I Y  MGS  + + Q+ GEMA  +  +  +F  
Sbjct: 62  ALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMA-TFIPVASSFTV 120

Query: 204 YPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXX 263
           +    +  A G +  ++YC  W     LEL      IQYWT  V                
Sbjct: 121 FTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLS 180

Query: 264 XXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD-- 321
                K Y E +F+    KV+ + GF I  + +   GAG  G +G +YW NPG + GD  
Sbjct: 181 NLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCM-VCGAGKTGPVGFRYWRNPGPW-GDGI 238

Query: 322 ----KSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377
               KS  RF   +S           +E + + A E +NPR+ +P A + +  RIL  ++
Sbjct: 239 ISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYV 298

Query: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437
            S+  +G LVP+N  +L  S +  + +SP++IA+ + G R +P   NAVIL +++S ANS
Sbjct: 299 GSLFFIGLLVPFNDPKL-DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANS 357

Query: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497
             Y   R+LY L+++G AP     I+R G P   + + +LF  + + + SS     F WL
Sbjct: 358 NVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWL 417

Query: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557
           L I+ ++  F W+ I + HIRF +A+K QG S D++ FK+++  WG+ YAA  + L +I 
Sbjct: 418 LNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIII 477

Query: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRK 616
           + + + AP      +  NFF  Y+++ + I ++  +++  +  +L  + +D+D+ S R+
Sbjct: 478 QGFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFKS-RLIHKVEDVDIDSDRR 531

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  255 bits (652), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/511 (29%), Positives = 259/511 (50%), Gaps = 21/511 (4%)

Query: 114 ATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGY 173
           + K+ + +P    K   +++ +K RH+                    L  AGP G +I Y
Sbjct: 52  SAKETETSPR---KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISY 108

Query: 174 AIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLEL 233
             MG+ +Y + Q+ GEMA  +  +  +F+ +    +  A G +  ++Y L W     LEL
Sbjct: 109 LFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167

Query: 234 VTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILA 293
                 IQYWT  V                     K Y E EF   S KV+ + GF   +
Sbjct: 168 SVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFS 227

Query: 294 IVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIA 348
             I  G   + G IG +YW NPGA+       +K+  RF   +S           +E + 
Sbjct: 228 FCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVG 287

Query: 349 IGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYV 408
           I A E +NPRRA+P A K ++ RIL  ++ S+  +G LVPYN  +L   G+  + +SP++
Sbjct: 288 ITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVS-SSPFM 346

Query: 409 IAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRP 468
           I++ + G +V+P   NAV+L+++LS  NS  Y   R+LYSLS+   AP + + + + G P
Sbjct: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVP 406

Query: 469 ARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGR 528
             A++ ++ F  +AF   S+    VF WLL I+G++  F W+ I +SHIRF +A+K +G 
Sbjct: 407 YFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGI 466

Query: 529 SVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIV 588
           S D++ +++++  + + YA+  + L ++ + + + AP         +F   Y+++ + I 
Sbjct: 467 SRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFIAAYISVFLFIA 522

Query: 589 LYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
           ++  +++   C+  WKL    +D+D+ S R+
Sbjct: 523 IWLLFQVWFKCRFVWKL----QDVDIDSDRR 549

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  256 bits (654), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 159/538 (29%), Positives = 267/538 (49%), Gaps = 22/538 (4%)

Query: 94  DAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXX 153
           D     D++N  T +     + K   +    +++   L+K +K RH+             
Sbjct: 49  DGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGL 108

Query: 154 XXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAF 213
                ++L+ AGP  + I YA +G  ++  + A GEMA +Y  L G F +Y S   D A 
Sbjct: 109 LIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPAL 166

Query: 214 GFSVAWVYCLQWLCVMPLELVTASMTIQYWT--TTVNADXXXXXXXXXXXXXXXXGAKGY 271
           GF+V + Y  ++L + P +L  A++ IQYW     VN                  G K +
Sbjct: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226

Query: 272 AEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG-DKSID----R 326
            E EF+ ++ KV++M G  IL  VI  GG      +G +++ +PGAF+   KSID    +
Sbjct: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286

Query: 327 FKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFL 386
           F   ++            E   I A+E +NPR++IP A K  +YRI+  +L +I L+G  
Sbjct: 287 FVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMC 346

Query: 387 VPYNSTELMGSGSAAT--KASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCR 444
           V Y+   L  + ++ T   ASPYV+A+ + G++ +PH  NA +L+ V S  NS  Y + R
Sbjct: 347 VAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406

Query: 445 ILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLS 504
            LY L+    AP  F   +R G P  +++MS+ F ++A+ + SS    +F + + +  + 
Sbjct: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466

Query: 505 QLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYA-AIMMTLALIAEFWVSI 563
            L +WI+I ++++ F RA+K Q        +++    +GS +  A  + +A I  F V +
Sbjct: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526

Query: 564 APIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD--WKLFIRAKDIDLVSHRKIYD 619
                 H D +NF   Y+ +P+ ++ YFGYK  K+   WK     +++DL + +   D
Sbjct: 527 ----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAID 576

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  254 bits (650), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 151/531 (28%), Positives = 267/531 (50%), Gaps = 20/531 (3%)

Query: 94  DAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXX 153
           D P +R   N + +  S ++     +   + + ++  +++ +K RH+             
Sbjct: 23  DYPLHRR-TNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGL 81

Query: 154 XXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAF 213
                + L  AGP G +I Y  MG+ +Y + Q+ GEMA  +  +  +F  +    +  +F
Sbjct: 82  FIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPSF 140

Query: 214 GFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAE 273
           G +  ++Y   W     LEL      IQ+WT+ V                     + Y E
Sbjct: 141 GAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGE 200

Query: 274 AEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGD---KSID--RFK 328
            EF+  S KVL + GF I  + +   GAG  G +G +YW NPG        K+++  +F 
Sbjct: 201 FEFWVASIKVLAIMGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFL 259

Query: 329 DVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVP 388
             +S           +E + I A E +NPR+++P A K +++RILF ++ S+  +G LVP
Sbjct: 260 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVP 319

Query: 389 YNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYS 448
           YN  +L  S  +   ASP++I++ + G  ++PH  NAVIL +++S ANS  Y   RI++ 
Sbjct: 320 YNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFG 378

Query: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508
           LS+   AP   +  ++ G P  ++I + LF  +A+   S+  E  F WLL I+G++  F+
Sbjct: 379 LSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFS 438

Query: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGE 568
           W+ I +SH+RF +A++ +G S D++ FK++     + YA   MTL +I + + S  P   
Sbjct: 439 WLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP--- 495

Query: 569 DHLDAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
              D  +F   Y++  + I ++  +++   C+  WK+    +D+D+ + R+
Sbjct: 496 -SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI----EDVDIDTDRR 541

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  254 bits (649), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 151/513 (29%), Positives = 257/513 (50%), Gaps = 19/513 (3%)

Query: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVI 171
            S  ++ Q     E ++  +++ +K RH+                  + L  AGP G +I
Sbjct: 65  FSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALI 124

Query: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231
            Y  MGS  + + Q+ GEMA  +  +  +F  +    +  AFG +  ++Y   W     L
Sbjct: 125 AYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFAL 183

Query: 232 ELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFI 291
           EL      IQ+WT  V                     K Y E EF+  S KV+ + GF I
Sbjct: 184 ELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLI 243

Query: 292 LAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEF 346
               +   GAG  G +G +YW NPGA+       +K+  RF   +S           +E 
Sbjct: 244 YCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTEL 302

Query: 347 IAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASP 406
           + I A E +NPR+ +P A K +++RIL  ++ S+  +G LVPYN  +L    ++    SP
Sbjct: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EATSYVSTSP 361

Query: 407 YVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREG 466
           +++A+ + G +V+PH  NAVIL +++S ANS  Y   RIL+ LS+   AP + +   + G
Sbjct: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421

Query: 467 RPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQ 526
            P  A+  +A+F  +A+   S+  + VF WLL I+G++  F W+ I +SHIRF +A+K +
Sbjct: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481

Query: 527 GRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPIL 586
           G S DE+ FK+++    + Y++  M + +I + + + AP      +  +F   Y+++ + 
Sbjct: 482 GISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAP----KFNGSSFLAAYISIFLF 537

Query: 587 IVLYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
           I ++  ++    C+  WK+    +D+D+ S R+
Sbjct: 538 IAVWILFECIFRCRFIWKI----EDVDIDSDRR 566

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  252 bits (644), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 150/532 (28%), Positives = 258/532 (48%), Gaps = 25/532 (4%)

Query: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXX 152
           ++ P     + +   T + +S   D Q      EK   +++ +K RH+            
Sbjct: 3   LNQPQVHSFQVDSNDTPTTISTLDDDQ------EKQQDVKRELKKRHISMIALGGTIGTG 56

Query: 153 XXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEA 212
                   L  AGP G +I Y  MG+ ++ + Q+ GEM   +  +  +F  +    +  A
Sbjct: 57  LFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPA 115

Query: 213 FGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYA 272
           FG +  ++Y   W     LEL      IQ+WT  V                     + Y 
Sbjct: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYG 175

Query: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRF 327
           E EF+  S KVL + GF I+  +    GAG  G +G +YW NPG +       + +  RF
Sbjct: 176 EIEFWIASVKVLAILGF-IIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARF 234

Query: 328 KDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLV 387
              +S           +E + I A E   PR+ +P A K +++RIL  ++ S+ ++G LV
Sbjct: 235 FGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV 294

Query: 388 PYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILY 447
           PYN  +L  S  +   +SP++I + + G +++PH  NAVIL++++S  NS  Y   RILY
Sbjct: 295 PYNDPKLQ-SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILY 353

Query: 448 SLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLF 507
            L++   AP +F    + G P   ++ +++F  +A+   ++  +  FTWLL I G++  F
Sbjct: 354 GLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFF 413

Query: 508 TWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG 567
            W+ I  SHIRF +A+K +G S +++ +K+ +  W + YA   M + ++ + + S AP  
Sbjct: 414 AWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-- 471

Query: 568 EDHLDAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
                  NFF  Y+++ + I+ +  ++I   C+  WKL    +D+DL + R+
Sbjct: 472 --KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKL----QDVDLDTDRR 517

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  252 bits (644), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 177/581 (30%), Positives = 284/581 (48%), Gaps = 43/581 (7%)

Query: 56  DSDSDFEYNGKKKILPSFNIKQPHLRKLI---DSFRRAEDIDAPTNRDIENELTTTLSPL 112
           D+D D E   K+++    NI      +L     S  +   I +    D++N +T T S  
Sbjct: 15  DTDEDIE---KQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHT-SEF 70

Query: 113 SATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIG 172
               D             L+K ++ RHV                  S+L  AGP  ++I 
Sbjct: 71  DGKHD----------GIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIA 120

Query: 173 YAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLE 232
           YA +G  ++ ++   GEMA AY  L G F +Y +   D A GF+V + Y  ++  ++P +
Sbjct: 121 YAFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQ 178

Query: 233 LVTASMTIQYWTT--TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFF 290
           L   ++ IQYW     VN                  G + + E E++ ++ K+ +M G  
Sbjct: 179 LTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLI 238

Query: 291 ILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSXXXXXXXXXGA 343
           IL +V+  GG  N   +G KYW NPGAF+       G K   RF    S           
Sbjct: 239 ILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLALFAYLG 296

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATK 403
           +E   I  SE  NPR+A+P A K  +YRI+  +L SI L+G  VP+N   L+ + SA T 
Sbjct: 297 TELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTS 356

Query: 404 AS--PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNY 461
           AS  P+V+A+ + G+ V+PH +NA IL+ V S ANS  Y + R LY L+    AP  F  
Sbjct: 357 ASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416

Query: 462 IDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRR 521
            +++G P  ++++  LF+++A+   SS   +VFT+ +    +  L +WI+I +++IRF +
Sbjct: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476

Query: 522 AMKVQGRSVDEIGFKSQV---GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFE 578
           A +VQG     + ++S +   G W S +  I+  + LI  F   +     D  D ++F  
Sbjct: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCIL--IGLIKNFPAFLG----DTFDYKSFIT 530

Query: 579 NYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
            Y+ +P  I+ Y GYK+  +     I ++++DLVS ++  D
Sbjct: 531 GYIGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVD 569

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 149/497 (29%), Positives = 249/497 (50%), Gaps = 14/497 (2%)

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
           E + + +++ +K RH+                  + L  AGP G +I Y  M +  Y + 
Sbjct: 21  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 80

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           Q+ GEMA  +  +  +F  +    V  AFG +  ++Y   W     LEL      IQ+WT
Sbjct: 81  QSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 139

Query: 245 TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304
             V                     K Y E EF+    KV+ + GF I    +   GAG  
Sbjct: 140 FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAGVT 198

Query: 305 GYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRR 359
           G +G +YW +PGAF       DK+  RF   +S           +E + I A E +NPR+
Sbjct: 199 GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 258

Query: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVV 419
            +P A K +++RILF ++ S+  +G LVPY+  +L  + S  + ASP++IA+ + G  V+
Sbjct: 259 TVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVS-ASPFIIAIENSGTHVL 317

Query: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479
           PH  NAVI+ +++S  NS  Y   RI+Y LS    AP   +   + G P  A+++++LF 
Sbjct: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377

Query: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539
            +A+   S+  +  F WLL I+G++  FTW+ I +SHIRF +A++++G S D++ FK++ 
Sbjct: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437

Query: 540 GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD 599
               + Y    MTL +I + + S  P      +  +F   Y+++ + I ++  ++   R 
Sbjct: 438 MPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC 492

Query: 600 WKLFIRAKDIDLVSHRK 616
            +L  R +D+D+ + R+
Sbjct: 493 -RLIWRVEDVDIDTDRR 508

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  249 bits (635), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 248/502 (49%), Gaps = 13/502 (2%)

Query: 120 FAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSC 179
           F    +  +  +++ +K RH+                  + L  AGP G +I Y  M + 
Sbjct: 66  FVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATL 125

Query: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239
           +Y ++Q+ GEMA  +  +   F  + S  +  AFG +  ++Y   W     LEL      
Sbjct: 126 VYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQI 184

Query: 240 IQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299
           I++WTT V                     K Y E EF+    KV+ + GF I  + +   
Sbjct: 185 IEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VC 243

Query: 300 GAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQ 354
           GAG  G +G +YW NPGA+       DK+  RF   +S           +E + I A E 
Sbjct: 244 GAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303

Query: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASH 414
           +NPR+++P A K +++RIL  +      +G LVPYN  +L  S  +   +SP++IA+ + 
Sbjct: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENS 362

Query: 415 GVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIM 474
           G +V+PH  NAV+L +++S  NS  Y   RI+Y L++   APS+F   +  G P  A+  
Sbjct: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422

Query: 475 SALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIG 534
           ++ F  +A+   S+     F WLL I+G++  FTW+ I   HIRF +A+K +G S D++ 
Sbjct: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482

Query: 535 FKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK 594
           FK++   W + YA   M + ++ + + + AP         +F   Y+++ + I ++ G +
Sbjct: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQ 538

Query: 595 ICKRDWKLFIRAKDIDLVSHRK 616
           I  R  ++F R  ++D+ + R+
Sbjct: 539 IWFRC-RIFHRLDEVDIDTDRR 559

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  246 bits (627), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 141/461 (30%), Positives = 243/461 (52%), Gaps = 12/461 (2%)

Query: 161 LHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWV 220
           L  AGP G +I Y  MG+ +Y + Q+ GEMA  +  +  +F+ +    +  A G +  ++
Sbjct: 20  LAHAGPVGALISYIFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 221 YCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNS 280
           Y L W     LEL      IQYWT  V                     K Y E EF   S
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 281 CKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXX 335
            KV+ + GF I +  +  G    DG IG +YW NPGA+       DK+  RF   +S   
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 336 XXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM 395
                   +E + I A E +NPR+A+P A K ++ RIL  ++ S+  +G LVPYN  +L 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 396 GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYA 455
             GS  + ASP++I++ + G +V+P   NAV+L++++S  NS  Y   R+LYSLS+   A
Sbjct: 259 SDGSFVS-ASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 456 PSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVS 515
           P + + + + G P  A++ +++F  +AF   S+     F WLL I+G++  F W+ I  S
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 516 HIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQN 575
           HIRF +A+  +G S +++ +K+++  + + YA+  + L ++ + + + AP         +
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SFQPVD 433

Query: 576 FFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRK 616
           F   Y+++ + + ++F +++  +   + ++ +D+D+ S R+
Sbjct: 434 FVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDRR 473

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  249 bits (635), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 160/499 (32%), Positives = 249/499 (49%), Gaps = 19/499 (3%)

Query: 130 HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGE 189
            L+K +K RH+                   +L  AGP   +I Y  +G  ++  +   GE
Sbjct: 64  RLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGE 123

Query: 190 MAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT--TTV 247
           MA  +  L G F +Y S   D A GF+V + Y +++  + P +L  A+M +QYW    TV
Sbjct: 124 MA-TFIPLDG-FTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTV 181

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
           N                  G + + E EF+ +S KVL+M G  IL  VI  GGAG+   +
Sbjct: 182 NPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRL 241

Query: 308 GAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           G +YW +PGAF         S+ +F   ++            E   I A+E SNPRR++P
Sbjct: 242 GFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVP 301

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            A K   YRIL  ++ SI L+G  VPYN  +L+ +   +  ASP+ IA+ + G+ V+P  
Sbjct: 302 KAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLPDI 361

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
            N  +L+ V S ANS  Y + R LYSL+    AP  F + +R G P  ++ +S LF ++A
Sbjct: 362 FNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLA 421

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           +   SS    VF + + +  ++ L TWI+I +++I F RA++ Q        + +    +
Sbjct: 422 YMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPY 481

Query: 543 GSSYAAIMMTL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-CKRDW 600
           G+  +     L A+I  F V +      H D + F   Y+ +PI ++ YFGYKI CK + 
Sbjct: 482 GAYVSLFFCCLIAIIKNFTVFLG-----HFDYKTFITGYIGLPIFVLCYFGYKITCKSEI 536

Query: 601 KLFIRAKDIDLVSHRKIYD 619
           +    A+ +DLVS + + D
Sbjct: 537 R---SARYVDLVSQKSLVD 552

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  247 bits (631), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 257/510 (50%), Gaps = 22/510 (4%)

Query: 123 HAE----EKDDH---LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
           HAE    E D H   +++ +KPRHV                    L  +GP G +I Y  
Sbjct: 58  HAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIF 117

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           MGS +Y + Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +EL  
Sbjct: 118 MGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSV 176

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
               I YWT  V                     K Y E EF   S KV+ + G+ + A++
Sbjct: 177 LGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALI 236

Query: 296 INTGGAGNDGYIGAKYWHNPGAFRGDKSID------RFKDVMSXXXXXXXXXGASEFIAI 349
           I  GG+ + G IG +YW NPG + G  +I       RF   +            +E + I
Sbjct: 237 IVCGGS-SQGPIGFRYWRNPGPW-GTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGI 294

Query: 350 GASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVI 409
            A E SNPR+ +P A   + +RIL  ++ S+  VG LVPYNS +L  S SA   +SP+VI
Sbjct: 295 TAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLE-SNSAVIASSPFVI 353

Query: 410 AVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPA 469
           ++ + G +V+P   NAV+L+++LS  NS  Y   R+LYSL+  G AP  F+Y+ ++G P 
Sbjct: 354 SIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPY 413

Query: 470 RAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRS 529
             +I +AL  ++AF A +      F WL+ IS L+ L  W  I V+HIRF + +K++G S
Sbjct: 414 LGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGIS 473

Query: 530 VDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589
            D + FK+++  WG+ YAA  + L +  + + + AP      D   FF  Y+++ +L+VL
Sbjct: 474 RDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP----RFDVSEFFTAYISLILLVVL 529

Query: 590 YFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           +   ++  R  +   + +DID+ S R+  D
Sbjct: 530 FILCQLYYRC-RFLTKIEDIDIDSDRREID 558

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  246 bits (628), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 156/532 (29%), Positives = 253/532 (47%), Gaps = 23/532 (4%)

Query: 100 DIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXS 159
           D+E   T++L+      D       +E    L+K +K RH+                  +
Sbjct: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGT 78

Query: 160 ALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAW 219
           AL   GP  ++I Y+ +G  ++ ++   GEMA  Y  L G F +Y +   D A GF+V +
Sbjct: 79  ALRTGGPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGY 136

Query: 220 VYCLQWLCVMPLELVTASMTIQYWT--TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFF 277
            Y  ++  + P +L   ++ IQYW    TVN                  G + + E EF+
Sbjct: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196

Query: 278 FNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDV 330
            +S K+++M G  +   +I  GG  N   +G +YW NPGAF+       G K   +F   
Sbjct: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSF 254

Query: 331 MSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390
           ++            E   I A+E  NPRR IP A K  +YRI+  ++ +I L+G  V YN
Sbjct: 255 VAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYN 314

Query: 391 STELMGSGSAATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYS 448
              L+ +  A+T A+  P+V+A+ + GVR +PH  N  +L+ V S  NS  Y   R LYS
Sbjct: 315 DPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYS 374

Query: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508
           L+  G AP  F   +R G P  A+    LF ++A+   SS    +F + + +  +  + +
Sbjct: 375 LAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILS 434

Query: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIG 567
           WI+I +++I F RA   Q    +   +++    +G+        L A I  F V I    
Sbjct: 435 WISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG--- 491

Query: 568 EDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
               D ++F   Y+ +P+ ++ YFGYKI  +  KL ++A++ DL S ++  D
Sbjct: 492 --EFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAID 539

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  246 bits (628), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 143/469 (30%), Positives = 238/469 (50%), Gaps = 13/469 (2%)

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
           ++  +++ +KPRH+                  + +  AGP G +I Y  MG+ ++ + Q+
Sbjct: 98  EEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQS 157

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GEMA  +  +  +F  + S  V + FG +  ++Y   W     LEL      I++WT  
Sbjct: 158 LGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           V                     K Y E EF+  S KV+ + GF I  + +   GAG  G 
Sbjct: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGP 275

Query: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAI 361
           +G +YW +PG +       DK+  RF   +S           +E + I A E +NPR+++
Sbjct: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335

Query: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421
           P A K +  RIL  ++ S+  +G LVPYN  +L  + S  + ASP++IA+ + G +V+PH
Sbjct: 336 PRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVS-ASPFIIAIQNSGTKVLPH 394

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
             NAVIL +++S ANS  Y   RILY LS    AP +F    R G P  A++ +A F  +
Sbjct: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           A+   S+  ++ F WLL I+G++  F W++I +SHIRF + +K +G S D++ +K+ +  
Sbjct: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLY 590
             + Y A  +TL ++ + + + AP      D+  F   Y++  + + +Y
Sbjct: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIY 558

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  244 bits (622), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 154/574 (26%), Positives = 274/574 (47%), Gaps = 43/574 (7%)

Query: 53  AVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPL 112
           ++ D +++    GK KI+             I S    E  D   N D +N  TTT S  
Sbjct: 2   SILDINTEETLEGKSKIV-------------IKSTESLEQHDLQGNED-KNTPTTTPSKE 47

Query: 113 SATKDPQFAPHAEEKDDH--LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLV 170
           + +++        EKD++  +++ +  RH+                  + L  +GP G +
Sbjct: 48  NVSEN--------EKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSL 99

Query: 171 IGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMP 230
           I Y  +G+ +Y + Q+ GEMA  +  +  +F  +    +  A G +  ++Y   W     
Sbjct: 100 IAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFA 158

Query: 231 LELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFF 290
           LEL      IQ+WT  V                     + Y E EF+    KV  + GF 
Sbjct: 159 LELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFI 218

Query: 291 ILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASE 345
           I    I   GAG  G +G +YW NPG +       + +  RF    S           +E
Sbjct: 219 IYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTE 277

Query: 346 FIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS 405
            + I A E +NPR+ +P A + +++RIL  ++ S+  +G LVPY+  +L    S  + +S
Sbjct: 278 LVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVS-SS 336

Query: 406 PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDRE 465
           P++IA+ + G +++PH  N VIL++++S  NS  Y   R+L+ L++ G  P  F    + 
Sbjct: 337 PFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKS 396

Query: 466 GRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKV 525
           G P  A++ ++LF  +AF   S+  ++ F WLL + G++  F+W+ I  +HIRF + ++ 
Sbjct: 397 GVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQS 456

Query: 526 QGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPI 585
           +G S +++ FK++   + + YA I+M + +  + + + AP      D  NFF +Y+++ +
Sbjct: 457 RGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFL 512

Query: 586 LIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
             + +  +++   C+  WKL     DID+   R+
Sbjct: 513 FFIFWGSFQLWFKCRYVWKLV----DIDIDKDRR 542

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  244 bits (624), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 164/572 (28%), Positives = 270/572 (47%), Gaps = 32/572 (5%)

Query: 63  YNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAP 122
           YN + + +PS    +  L++L D   +  ++D   +     + +     L+ + D     
Sbjct: 10  YNYELEDIPS---SKNELKELGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDTSTNS 66

Query: 123 HAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
             E+  + L++ +K RHV                  S LH  GP GL I Y I+ S +Y 
Sbjct: 67  LEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYP 126

Query: 183 IIQACGEMAVAYSG----LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASM 238
           I+ A GEM     G      G+        VDE+  F+  W Y   ++ ++  E   A+ 
Sbjct: 127 IMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAG 186

Query: 239 TIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINT 298
            ++YWT  V                     K + E EF+F S K+L + G  IL+ ++  
Sbjct: 187 VVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFW 246

Query: 299 GGAGNDGYIGAKYWHNPGAFR---GDKSIDRFKDVMSXXXXXXXX-XGASEFIAIGASEQ 354
           GG  +   +G +YW NPGAF     D S+  F D+ S             E +A+ +SE 
Sbjct: 247 GGGPSHDRLGFRYWKNPGAFAHHVTDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSEC 306

Query: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTEL---MGSGSAATKASPYVIAV 411
           S+ RR I  A+K  IYR++F ++     +G +V +N   L   + + +    +SP+VI +
Sbjct: 307 SDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGI 366

Query: 412 ASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARA 471
            + G+ V+PH INA IL S  S  N+  ++S R L++++Q G AP  F  I++ G P  A
Sbjct: 367 QNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMA 426

Query: 472 MIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVD 531
           +I+S L S +A+   SS    VFTWL  IS +S    WI  C++++RFR+A+       D
Sbjct: 427 VILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAI-FYNNLYD 485

Query: 532 EIGFKSQVGVWGSSYAAI----MMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILI 587
            + FK+    WG  Y  +    ++++  I   + +  P      +  +F   Y+ +PI +
Sbjct: 486 RMPFKT----WGQPYLILWSLTVVSIITITNGYQTFIP---KFWNVSDFIAAYITLPIFL 538

Query: 588 VLYFGYKI---CKRDW---KLFIRAKDIDLVS 613
            LY G+K+    K D+   KL    +DID+++
Sbjct: 539 ALYVGHKVYNHFKNDYPLMKLAYSVEDIDVIT 570

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  242 bits (618), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 143/494 (28%), Positives = 248/494 (50%), Gaps = 13/494 (2%)

Query: 128 DDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187
           D  +++ +K RH+                  + L +AGP G +I Y  MG+ +Y + Q+ 
Sbjct: 70  DAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSL 129

Query: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247
           GEMA  +  +  +F  +    +  + G +  ++Y   W     LEL      IQYWT  V
Sbjct: 130 GEMA-TFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 248 NADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307
                                K Y E EF+    KV+ + GF +  + +   GAG  G +
Sbjct: 189 PLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCM-VCGAGVTGPV 247

Query: 308 GAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIP 362
           G +YW NPG +       DK+  RF   +S           +E + I A E +NPR+A+P
Sbjct: 248 GFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVP 307

Query: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422
            A K +++RILF ++ S+  +G LVPYN   L  + S    +SP++IA+ + G  V+PH 
Sbjct: 308 RAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVA-SSPFIIAIKNSGTPVLPHI 366

Query: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482
            NAVI  +++S  NS  Y   RIL+ LS+   AP   +   + G P  A++++++   +A
Sbjct: 367 FNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALA 426

Query: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542
           +   S+  ++ F WLL I+ ++  FTW+ I +SHIRF +A+K +G S D++ FK+ +   
Sbjct: 427 YMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPG 486

Query: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602
            + YA+ +M + +I + + + AP         +F   Y+++ + I ++  ++I  R  + 
Sbjct: 487 LAYYASFLMFVIIIIQGFTAFAP----KFSGSDFAAAYISIFLFIGIWCLFQIIFRC-RF 541

Query: 603 FIRAKDIDLVSHRK 616
             + +D+D+ + R+
Sbjct: 542 IHKVEDVDIDTDRR 555

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  242 bits (617), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 146/511 (28%), Positives = 247/511 (48%), Gaps = 24/511 (4%)

Query: 123 HAEEKD---DHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSC 179
           H EE D     +++ +K RH+                  S L  AGP G ++ Y  +G+ 
Sbjct: 44  HTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTV 103

Query: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239
           +Y I Q+ GEMA  +  +  +   +    +  AFG +  ++Y   W     +EL      
Sbjct: 104 VYSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQI 162

Query: 240 IQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299
           IQYWT  V                     + Y E EF+  S KVL + G+ I A +I  G
Sbjct: 163 IQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCG 222

Query: 300 GAGNDGYIGAKYWHNPGAFRGDKSIDR-------FKDVMSXXXXXXXXXGASEFIAIGAS 352
           G+   G IG        A RG ++  R       F   +S           +E + I A 
Sbjct: 223 GS-KQGPIGLPATGGIPA-RGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAG 280

Query: 353 EQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVA 412
           E +NPR+ +P A   + +RILF ++ S+  VG LVPY+   L    S    ASP+VI++ 
Sbjct: 281 ESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIK 340

Query: 413 SHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAM 472
           + G +++P   NAV+L++V+S ANS  Y   R+ YSL+  G AP    ++ ++G P   +
Sbjct: 341 NAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGV 400

Query: 473 IMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDE 532
           ++++L  +++F   +      F WL+ IS L+ L  W+ I ++HIRF + +K +G S D+
Sbjct: 401 LITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDD 460

Query: 533 IGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG 592
           + FK++   W + YA   +T+ +  + + +  P      D   FF +Y+++ ++++++ G
Sbjct: 461 LPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISLFLMLLVFIG 516

Query: 593 YKI---CKRDWKLFIRAKDIDLVSHRKIYDG 620
            +I   C+  W +    +DID+ S R+  D 
Sbjct: 517 CQIYYKCRFLWAV----EDIDIDSDRREIDA 543

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  242 bits (617), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 157/517 (30%), Positives = 256/517 (49%), Gaps = 23/517 (4%)

Query: 116 KDPQFA-PHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYA 174
           +D  FA P  ++++  L+K +K RH+                  +AL   GP  ++I YA
Sbjct: 66  RDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYA 125

Query: 175 IMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELV 234
            +G  ++  +   GEMA +Y  L G F +Y S  VD A GF++ + Y  ++  + P +L 
Sbjct: 126 FVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183

Query: 235 TASMTIQYWTTT--VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
            A++ IQYW +   VN                  G K + E EF+ +S KV++M G  +L
Sbjct: 184 AAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILL 243

Query: 293 AIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSXXXXXXXXXGASE 345
             +I  GG  N   +G +YW +PGAF+       G K   +F   ++            E
Sbjct: 244 LFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKG--KFVSFVAVFVYSLFSYTGIE 301

Query: 346 FIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG--SAATK 403
              I  SE  NPR+++P A K  +YRI+  +L ++ L+G  V YN   L+ +   S +  
Sbjct: 302 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA 361

Query: 404 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
           ASP+V+A+ + G+ V+PH  NA +L+ V S  NS  Y S R LY+L+  G AP  F    
Sbjct: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           R G P  A+I+S LF  +A+   SS    +F + + +  +  + +WI I + +I F +A 
Sbjct: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIGEDHLDAQNFFENYLA 582
           + QG    +  + +    +G+ +A     L ALI  F V +        D + F   Y+ 
Sbjct: 482 RAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIG 537

Query: 583 MPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           +P+ I+ + GYK+  +     I++ D+DL + ++IYD
Sbjct: 538 LPVYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYD 572

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  242 bits (617), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 168/576 (29%), Positives = 281/576 (48%), Gaps = 36/576 (6%)

Query: 56  DSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSAT 115
           DSD D  Y+  K+   SF +K+  +           +ID   N ++ +  +T  SP SA 
Sbjct: 20  DSDRDAYYS--KQNPDSFPVKEQEIY----------NIDLEEN-NVSSRSSTFTSP-SAR 65

Query: 116 KDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAI 175
            D    P  +++   L+K +K RH+                  +AL   GP  ++I YA 
Sbjct: 66  DDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAF 125

Query: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235
           +G  ++  +   GEMA +Y  L G F +Y S  VD A GF++ + Y  ++  + P +L  
Sbjct: 126 VGLLVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 183

Query: 236 ASMTIQYWTTT--VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILA 293
           A++ IQYW +   VN                  G K + E EF+ +S KVL+M G  +L 
Sbjct: 184 AALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLL 243

Query: 294 IVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSXXXXXXXXXGASEF 346
            +I  GG  +   +G +YW +PGAF+       G K   +F   ++            E 
Sbjct: 244 FIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKG--KFVSFLAVFVYSLFSYTGIEL 301

Query: 347 IAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAA--TKA 404
             I  SE  NPR+++P A K  +YRI+  +L ++ L+G  V YN   L+ +   A    A
Sbjct: 302 TGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAA 361

Query: 405 SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDR 464
           SP+V+A+ + G++V+PH  NA +L+ V S  NS  Y S R LY+L+  G AP  F+  ++
Sbjct: 362 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNK 421

Query: 465 EGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMK 524
            G P  A+I S LF  +A+   S+    +F + + +  +  + +WI I + +I F +A +
Sbjct: 422 WGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 481

Query: 525 VQGRSVDEIGFKSQVGVWGSSYAAIM-MTLALIAEFWVSIAPIGEDHLDAQNFFENYLAM 583
            QG    +  + +    +G+ +A +  + +ALI  F V +        D + F   Y+ +
Sbjct: 482 AQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLG----HKFDYKTFITGYIGL 537

Query: 584 PILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           P+ +  + GYK+  +     I++ D+DL + ++IYD
Sbjct: 538 PVYVFSWVGYKLIYK--TKVIKSTDVDLYTFKEIYD 571

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  240 bits (613), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 165/553 (29%), Positives = 270/553 (48%), Gaps = 30/553 (5%)

Query: 83  LIDSF-RRAEDID---APTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138
           ++ SF   +++ID    P   DIE E T ++    A  D       +  D  L+K +K R
Sbjct: 14  IVPSFSNHSDNIDNKKEPFQIDIEKESTESV----ALDDTNEQFDGKCSDQRLKKDLKAR 69

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           HV                  ++L  AGP  ++I Y+ +G  ++ ++   GEMA AY  L 
Sbjct: 70  HVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMA-AYIPLD 128

Query: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT--TTVNADXXXXXX 256
           G F +Y S   D A GF+V + Y +++  + P +L  A++ IQYW     VN        
Sbjct: 129 G-FTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIV 187

Query: 257 XXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316
                     G K + E EF+ +S KV++M G  IL  +I  GG      +G +YW +PG
Sbjct: 188 LVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPG 247

Query: 317 AFR-------GDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMI 369
           AF+       GD  I RF   +S            E   I A+E  NPR+ IP A K  +
Sbjct: 248 AFKEYSKSIHGD--IGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTM 305

Query: 370 YRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA--SPYVIAVASHGVRVVPHFINAVI 427
           +RI+  ++ +I L+G  V  N   L+ + + +T A  SP+V+A+ + G+  +PH  NA +
Sbjct: 306 WRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACV 365

Query: 428 LLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACS 487
           L+ V S  NS  Y + R LYSL+    AP  F   +R G P  ++ ++ LF ++A+ + S
Sbjct: 366 LMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVS 425

Query: 488 SKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYA 547
           S    +F + + +  ++ + TWI+I +++I F RA++ QG       + + +  +G+ ++
Sbjct: 426 SGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFS 485

Query: 548 AIMMT-LALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRA 606
                 LALI  F V +        D +NF   Y+ +P+  + YFGYK  K+      + 
Sbjct: 486 LFFCCLLALIKNFTVFL----NHKFDYRNFITGYIGLPLFFICYFGYKFVKK--TKIRKP 539

Query: 607 KDIDLVSHRKIYD 619
           +++DL S +   D
Sbjct: 540 EEVDLFSFKAAID 552

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  239 bits (611), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 161/549 (29%), Positives = 271/549 (49%), Gaps = 23/549 (4%)

Query: 85  DSFRR-AEDIDAPTN---RDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140
           DS+R+  E I + +N   +D+EN   +    +S +++       +     L+K ++ RHV
Sbjct: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDIS-SQESHLNIDGKHDGIRLKKELEARHV 64

Query: 141 XXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200
                             ++L  AGP  ++I Y+ +G  +Y ++   GEMA  Y  L G 
Sbjct: 65  SMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG- 122

Query: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT--TVNADXXXXXXXX 258
           F +Y S   D A GF+V + Y  ++L + P +L  A++ +QYW +   VN          
Sbjct: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182

Query: 259 XXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318
                   G K + E EF+ +S KVL+M    +L  VI  GG  +   +G +++ +PGAF
Sbjct: 183 IIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242

Query: 319 RG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRIL 373
           R        S  +F   ++           +E   I A+E  NPRR +P A K  +YRI+
Sbjct: 243 RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302

Query: 374 FIFLTSITLVGFLVPYNSTELMGSGSAATKA--SPYVIAVASHGVRVVPHFINAVILLSV 431
             +L +I L+G  V YN   L+ +   +T A  SP+V+A+ + G+ V+PH  NA +L+ V
Sbjct: 303 VFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFV 362

Query: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491
            S  NS  Y + R LY L+    AP  F   ++ G P  ++I+  LF ++A+   SS   
Sbjct: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422

Query: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551
            VF + + +  +  L +WIAI +++I F RA++ QG     + + + +   G+ +A    
Sbjct: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482

Query: 552 TL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDID 610
            L ALI  F V +        D +NF   Y+ +P+ I+ +FGYK  +     F++ ++ D
Sbjct: 483 CLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYKYIRGT--KFVKPEEAD 536

Query: 611 LVSHRKIYD 619
           L + +++ D
Sbjct: 537 LYTFKELID 545

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  239 bits (611), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 165/585 (28%), Positives = 269/585 (45%), Gaps = 42/585 (7%)

Query: 48  TGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTT 107
           +G+ +  N ++S FE                 L+K  D    + D++       +N ++ 
Sbjct: 2   SGLKSVGNSNNSKFE--------------MTDLQKQSDQVTISSDLE-------QNSISI 40

Query: 108 TLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPG 167
             S  S+  D       + +   L+K +K RHV                  ++L  AGPG
Sbjct: 41  ASSRNSSIGDRDIFDDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPG 100

Query: 168 GLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLC 227
            L I Y+ +G  ++  +   GEMA A+  L G F +Y S  VD A GF+V + Y  ++L 
Sbjct: 101 SLFITYSFVGVLVFFTMSCLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYSYLCKYLI 158

Query: 228 VMPLELVTASMTIQYWTT--TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLM 285
           +   +L   +M +QYW    T+N                  G K + E EF+ +S KVL+
Sbjct: 159 LPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLV 218

Query: 286 MAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR--------GDKSIDRFKDVMSXXXXX 337
           M G  +L  +I  GG  N   +G +YW +PG+F+           S  +F    S     
Sbjct: 219 MLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYA 278

Query: 338 XXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGS 397
                  E   I A+E  NPR+ IP A K  +YRI+  ++ +I L+   V YN   L+ +
Sbjct: 279 LFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKA 338

Query: 398 GSAATKA--SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYA 455
              +T A  SP+V+A+ + G+ ++PH  N  +L  VLS ANS  Y + R LYSL+    A
Sbjct: 339 TGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKA 398

Query: 456 PSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVS 515
           P +F   ++ G P  ++  S  FS +A+   SS   +VF + +    +  + +WI I V+
Sbjct: 399 PKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVT 458

Query: 516 HIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIM-MTLALIAEFWVSIAPIGEDHLDAQ 574
           +I F +A K QG       + +    +G+ +A      LAL+  F V +        D +
Sbjct: 459 YIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLG----GQFDYK 514

Query: 575 NFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           NF   Y+ +P+  + + GYKI  +      R +++DLV+ + + D
Sbjct: 515 NFITGYIGIPVFFICFVGYKIVYKTKTH--RPEEVDLVTLKALID 557

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  239 bits (610), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 150/516 (29%), Positives = 251/516 (48%), Gaps = 21/516 (4%)

Query: 114 ATKDPQFAPHAEEKDDH-LQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIG 172
           ++   + +PH  +   H L++ +K RHV                  S LH  GP GL I 
Sbjct: 57  SSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFIS 116

Query: 173 YAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLV----DEAFGFSVAWVYCLQWLCV 228
           Y I+ S +Y I+Q  GEM     G       + ++LV    DE+ GF+ AW Y   ++ +
Sbjct: 117 YCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVIL 176

Query: 229 MPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAG 288
           +  E   AS  ++YWTT+V                     K Y E+EF+F S K+L + G
Sbjct: 177 VAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVG 236

Query: 289 FFILAIVINTGGAGNDGYIGAKYWHNPGAF----RGDKSIDRFKDVMSXXXXXXXX-XGA 343
             IL+ ++  GG  N   +G +YW NPG F    RG  S   F D+ +            
Sbjct: 237 LIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGG-SFGSFLDIYTGIIKGGFAFILG 295

Query: 344 SEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTEL---MGSGSA 400
            E IA+ +SE  + RR I  AA+  ++R++F ++     +  +V YN   L   +     
Sbjct: 296 PEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKP 355

Query: 401 ATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFN 460
              +SP+VI + + G++V+PH INA IL S  S  N+  ++S R L +++Q G AP  F 
Sbjct: 356 GAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFA 415

Query: 461 YIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFR 520
            ++R G P  A+ +S+  S +A+  CSS   DVF W   IS +S    WI +C+++IRF 
Sbjct: 416 KVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFH 475

Query: 521 RAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENY 580
           +A+   G     + + ++   +   +  +++++  +   +    P      DA+NF   Y
Sbjct: 476 KAILFHGMQ-SRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIP---RFWDAKNFVAAY 531

Query: 581 LAMPILIVLYFGYKICKRD---WKLFIRAKDIDLVS 613
           + +P+  VL+ G+++ +R     K +   ++ID+V+
Sbjct: 532 ITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVT 567

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/483 (28%), Positives = 238/483 (49%), Gaps = 14/483 (2%)

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
           +     +++ +KPRHV                  S +  AGP G ++ Y  + +  YC+ 
Sbjct: 43  KPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVT 102

Query: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244
           Q+ GEMA  +  +  +F  + S  V  A G +  ++Y L W     LE+      I YW+
Sbjct: 103 QSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS 161

Query: 245 TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304
             V                     K Y E EF+  S KV+ +  F    +V+  GG+   
Sbjct: 162 DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KL 220

Query: 305 GYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRR 359
           G IG +YW +PG +       +    +F   +S           +E + + A E  NPRR
Sbjct: 221 GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRR 280

Query: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAAT-KASPYVIAVASHGVRV 418
            +P A  T+ +RIL  ++ S+ ++G LV Y+  +L+  GS     ASP+V+A+ + G +V
Sbjct: 281 TVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKV 340

Query: 419 VPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALF 478
           +P  +N VI+++++S  NS  Y   R+LY L + G AP++ +     G P  A++ +++F
Sbjct: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400

Query: 479 SVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQ 538
             + +   SSK   VF WLL+I+ +S  FTW+ I VSHIRF + +K +G S D++ FK++
Sbjct: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460

Query: 539 VGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK-ICK 597
              +G+ YAA  + + ++ + + +  P       A +F   Y++  I +V++  ++ + K
Sbjct: 461 FMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQFLFK 515

Query: 598 RDW 600
             W
Sbjct: 516 GRW 518

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  238 bits (607), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 145/502 (28%), Positives = 244/502 (48%), Gaps = 15/502 (2%)

Query: 124 AEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCI 183
            E +   +++ +KPRH+                    L  AGP G++I Y  M +  + +
Sbjct: 67  GEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSV 126

Query: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243
           +Q+ GEMA  Y  +   F+ +    +  AFG +  ++Y   W     LEL      +QYW
Sbjct: 127 MQSLGEMA-TYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYW 185

Query: 244 TTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 303
           T  V                     K Y E EF+    KV+ + GF I   ++   GAG 
Sbjct: 186 TFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIM-VCGAGK 244

Query: 304 DGYIGAKYWHNPGAFRGDKSID------RFKDVMSXXXXXXXXXGASEFIAIGASEQSNP 357
            G +G +YW +  AF GD  I       RF   +S           +E + I A E +NP
Sbjct: 245 TGPVGFRYWRHGYAF-GDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 303

Query: 358 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVR 417
           R+ +P + K  ++RIL  ++ S+  VG LVP+N   L  S S A  +SP+++A+ + G +
Sbjct: 304 RKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAA-SSPFILAIKNSGTK 362

Query: 418 VVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSAL 477
            +P   NAVIL +V+S ANS  Y   R++YS+++   AP       + G P  A++ ++ 
Sbjct: 363 ALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSA 422

Query: 478 FSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKS 537
              +A+   SS   +VF WL+ I+G++  F+W  I  SH+RF +A+K +G S +++ FK+
Sbjct: 423 IGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKA 482

Query: 538 QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICK 597
               W + Y+   MTL ++ + +    P    H  A +F  +Y+++ +  V++  ++I  
Sbjct: 483 SFMPWIAIYSFFFMTLIILVQGFTCFTP----HFQASDFVASYISVGLFFVIWAVFQIWF 538

Query: 598 RDWKLFIRAKDIDLVSHRKIYD 619
           R   L +   +ID+ + R+  D
Sbjct: 539 RC-PLLVPIAEIDIDTDRRDVD 559

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  238 bits (608), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 168/540 (31%), Positives = 253/540 (46%), Gaps = 42/540 (7%)

Query: 100 DIENELTT---TLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXX 156
           D+E++ +T   T+S      D    P A E    LQ+ +K RH+                
Sbjct: 45  DVESQQSTSSATISEKLGDGDGDADPFANEGS--LQQGLKSRHIQMIALGGAIGTGLFVG 102

Query: 157 XXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFN-------AYPSFLV 209
             S L   GP GL I Y I+ S +Y I+   GEM V Y  LPGN N          +  V
Sbjct: 103 TSSTLALCGPAGLFISYIIISSVVYPIMCGFGEM-VCY--LPGNGNDASGSAAHLVARYV 159

Query: 210 DEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAK 269
           D++ GF+ AW Y   ++ ++  E   AS  ++YWT  V                     K
Sbjct: 160 DKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVK 219

Query: 270 GYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG---DKSIDR 326
            Y EAEF+F S K+L + G  IL+ ++  GG  N   +G +YW  PGAF          R
Sbjct: 220 YYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMKGGFGR 279

Query: 327 FKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGF 385
           F D+ S             E + + ++E  + RR I  AA+  I+R++F ++     +  
Sbjct: 280 FLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISV 339

Query: 386 LVPYNSTEL---MGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSS 442
           +V YN   L   + SG     +SP+VI + + G+RV+PH INA IL S  S  N+  ++S
Sbjct: 340 IVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFAS 399

Query: 443 CRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISG 502
            R L ++++ G AP  F  I+R G P  A+ +S   S +AF   SS   DVF W   IS 
Sbjct: 400 TRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNIST 459

Query: 503 LSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA----IMMTLALIAE 558
           +S    WI  CV++IRFR+A+   G   D + FK+    WG  YA      +++L  +  
Sbjct: 460 ISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKT----WGQPYAVYYSLFVISLITLTN 514

Query: 559 FWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI-----CKRDWKLFIRAKDIDLVS 613
            + +  P    +    +F   Y+ +PI +VL+ G+K+      KR W+   R   ID+ +
Sbjct: 515 GYATFIP---KNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWR---RVDQIDVTT 568

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  238 bits (606), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 157/510 (30%), Positives = 246/510 (48%), Gaps = 23/510 (4%)

Query: 125 EEKDD--HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYC 182
           + KDD   L+K +K RH+                  +AL  AGP  ++I Y  +G+ ++ 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 183 IIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQY 242
            + A GEMA AY  L G F +Y S   D A GF+V + Y  ++  + P +L  A++ IQY
Sbjct: 134 TMAALGEMA-AYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQY 191

Query: 243 WTT--TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGG 300
           W    TVN                  G K + E EF+ +S K+++M G  I   VI  GG
Sbjct: 192 WVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGG 251

Query: 301 AGNDGYIGAKYWHNPGAFRG--------DKSIDRFKDVMSXXXXXXXXXGASEFIAIGAS 352
             N   +G +YW  PGAF+         + S  +F   ++            E   I A+
Sbjct: 252 GPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAA 311

Query: 353 EQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA--SPYVIA 410
           E  NPRR IP A K  ++RILF ++ +I L+G  V Y+   L+ + +A T A  SP+V+A
Sbjct: 312 EAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVA 371

Query: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470
           + + GV V+PH  N  +L+ V S  NS  Y   R LYSL+  G AP  F   +R G P  
Sbjct: 372 IQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYN 431

Query: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530
           AM    LF ++A+   SS   ++F + + +  +  + +W +I ++ I F RA++ QG   
Sbjct: 432 AMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDR 491

Query: 531 DEIGFKSQVGVWGSSYAAIM-MTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589
               + +    +GS +A    + LALI  F V +     +  D + F   Y+ +P+    
Sbjct: 492 STFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLG----NEFDYKTFITGYIGLPVYAFS 547

Query: 590 YFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           + GYK+  +     ++  + DL S++   D
Sbjct: 548 FIGYKLYYKTKT--VKPHEADLNSYKAAVD 575

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  238 bits (606), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 152/515 (29%), Positives = 257/515 (49%), Gaps = 19/515 (3%)

Query: 116 KDPQFA-PHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYA 174
           +D  FA    ++++  L+K +K RH+                  +AL   GP  ++I YA
Sbjct: 64  RDDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYA 123

Query: 175 IMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELV 234
            +G  ++  +   GEMA +Y  L G F +Y S  VD A GF++ + Y  ++  + P +L 
Sbjct: 124 FVGLLVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181

Query: 235 TASMTIQYWTTT--VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
            A++ IQYW +   VN                  G K + E EF+ +S KV++M G  +L
Sbjct: 182 AAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILL 241

Query: 293 AIVINTGGAGNDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFI 347
             +I  GG  +   +G +YW +PGAF+        S  +F   ++            E  
Sbjct: 242 LFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELT 301

Query: 348 AIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG--SAATKAS 405
            I  SE  NPR+++P A K  +YRI+  +L ++ L+G  V YN   L+ +   S +  AS
Sbjct: 302 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 361

Query: 406 PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDRE 465
           P+V+A+ + G++V+PH  NA +L+ V S  NS  Y S R LY+L+  G AP  F    + 
Sbjct: 362 PFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421

Query: 466 GRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKV 525
           G P  A+I+S LF  +A+   SS    +F + + +  +  + +WI I + +I F +A + 
Sbjct: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481

Query: 526 QGRSVDEIGFKSQVGVWGSSYA-AIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMP 584
           QG    +  + +    +G+ +A +  + +ALI  F V +        D + F   Y+ +P
Sbjct: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLP 537

Query: 585 ILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           + I+ + GYK+  +     I++ D+DL + ++IYD
Sbjct: 538 VYILSWAGYKLIYK--TKVIKSTDVDLYTFKEIYD 570

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  236 bits (602), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 140/519 (26%), Positives = 256/519 (49%), Gaps = 27/519 (5%)

Query: 113 SATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIG 172
           S T+D +        D  +++ +K RH+                  + L  +GP G +I 
Sbjct: 44  STTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIA 103

Query: 173 YAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLE 232
           Y  +G+  Y + Q+ GEMA  +  +  +F  + S  +  + G +V ++Y   W     LE
Sbjct: 104 YIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALE 162

Query: 233 LVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
           L      + YWT  V                     K Y E EF+  + KV+ + GF I 
Sbjct: 163 LSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222

Query: 293 AIVINTGGAGNDGYIGAKYWHNPGAFRGD------------KSIDRFKDVMSXXXXXXXX 340
            + +   GAG  G +G +YW NPG + GD            K+  RF    +        
Sbjct: 223 CLCM-VCGAGVTGPVGFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFT 280

Query: 341 XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSA 400
              +E + I A E +NPR+ +P A K +++RIL  ++ S+  +G LVP++  +L     +
Sbjct: 281 YQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSD-DS 339

Query: 401 ATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFN 460
              +SP++IA+ + G +++P   NA+IL++++S  NS  Y   RIL+SL++ G AP   +
Sbjct: 340 YVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILS 399

Query: 461 YIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFR 520
              ++G P  +++ +A+F V+A+   +   + VF WL+ I+ ++  + W+ I +SHIRF 
Sbjct: 400 RTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFM 459

Query: 521 RAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENY 580
           + +K +G S D++ FK+ +    + YA   M + +I + + +  P      D  +FF  Y
Sbjct: 460 QVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAY 515

Query: 581 LAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRK 616
           +++ +  +++  +++   C+  WKL    +D+D+ S+R+
Sbjct: 516 ISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR 550

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  236 bits (601), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 155/532 (29%), Positives = 259/532 (48%), Gaps = 29/532 (5%)

Query: 100 DIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXS 159
           DIE+    +   +S++  PQ        D  L+K +K RH+                  S
Sbjct: 27  DIESYSQISGPKVSSSDAPQ-------GDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSS 79

Query: 160 ALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYP-------SFLVDEA 212
            LH  GP GL   Y I+   +Y ++ A GEM V Y  LPG+ ++         +  VD +
Sbjct: 80  TLHACGPAGLFTSYCIISVIIYPVMNALGEM-VCY--LPGDGSSSGGSISKLVTRYVDPS 136

Query: 213 FGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYA 272
            GF+  W Y   ++ ++  E   AS  +QYWTT V                     K Y 
Sbjct: 137 LGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFLGVVVLLNFCAVKFYG 196

Query: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR---GDKSIDRFKD 329
           E+EF+F S K+L + G   ++ ++  GG  +   +G +YW  PGAF       +  RF D
Sbjct: 197 ESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAYHITSGNTGRFLD 256

Query: 330 VMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVP 388
           + +             E +A+ ++E  + RR I  A++  +YR++F +++S   +G +V 
Sbjct: 257 IWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVA 316

Query: 389 YNSTEL---MGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRI 445
           YN   L   +  G     +SP+VI + + G++V+PH IN  IL S  S  NS  +++ R 
Sbjct: 317 YNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRS 376

Query: 446 LYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQ 505
           L S+SQ+G+AP     ++R G P  A+ +++L S IA+   SS   DVFTW   IS +S 
Sbjct: 377 LLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISG 436

Query: 506 LFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAP 565
              WI I ++++RFR+A+  Q    + + FK+    +G+ +  I +++  +   +    P
Sbjct: 437 FIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIP 495

Query: 566 IGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLF-IRAKDIDLVSHRK 616
               + +  +F   Y+ +PI +VL+ G+K+  R WK + I   +ID+ +  K
Sbjct: 496 ---ANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEIDVTTGLK 544

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  236 bits (603), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 166/600 (27%), Positives = 275/600 (45%), Gaps = 36/600 (6%)

Query: 33  KSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRR--- 89
           K+  Q   V  F +  G  +A +  D +     +     S N  Q +  +  D  R    
Sbjct: 9   KNNRQSAGVVTFTDDVGGSSAGDKKDDNVVQVTESASSGSRNNHQRYDNEKDDDIRMEKI 68

Query: 90  AEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDD--HLQKTIKPRHVXXXXXXX 147
           ++D  A +N  I  EL   +       D + +P A+  ++   L++ ++ RHV       
Sbjct: 69  SKDQSASSNGTIHEELVMDV-------DLEKSPSADGDNEPRKLKQGLQSRHVQLIALGG 121

Query: 148 XXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG----LPGNFNA 203
                      S LH  GPGGL I Y I+ + +Y I+ A GEM     G      G+   
Sbjct: 122 AIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTAN 181

Query: 204 YPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXX 263
             +  VD + GF+  W Y   ++ ++  E   AS  ++YWTT V                
Sbjct: 182 LVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLL 241

Query: 264 XXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR---G 320
                K Y E+EF+F S K+L + G  IL+ ++  GG      +G +YW +PGAF     
Sbjct: 242 NFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLT 301

Query: 321 DKSIDRFKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTS 379
             S+  F D+ +             E + + ++E ++ RR I  A++  ++R++F ++  
Sbjct: 302 GGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLG 361

Query: 380 ITLVGFLVPYNSTEL---MGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVAN 436
              +  +VPYN   L   +  G     +SP+VI + + G++V+PH IN  IL S  S AN
Sbjct: 362 TLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAAN 421

Query: 437 SAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTW 496
           +  ++S R L +++Q G AP     I+R G P  A+  S L S +A+   SS   DVF W
Sbjct: 422 AFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNW 481

Query: 497 LLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA----IMMT 552
              IS +S    WI  C++++RFR+A+   G   D + FK+    WG  Y      I+++
Sbjct: 482 FSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPYTVWFSLIVVS 536

Query: 553 LALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW-KLFIRAKDIDL 611
           +  I   +    P    +    +F   Y+ +PI +VL+ G+K+  R W + ++   +ID+
Sbjct: 537 IITITNGYAIFIP---KYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWLPVSEIDV 593

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  236 bits (601), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 245/498 (49%), Gaps = 13/498 (2%)

Query: 127 KDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQA 186
           K+  +++ +K RH+                  + L  AGP G +I Y  M + ++ + Q+
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246
            GEMA  +  +  +F  + S  +  A G +  ++Y   W     LEL      IQ+WT  
Sbjct: 153 LGEMA-TFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHA 211

Query: 247 VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306
           V                     K Y E EF+  S KVL + GF I  + +   GAG  G 
Sbjct: 212 VPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCM-VCGAGVTGP 270

Query: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAI 361
           +G +YW NPG +       D +  RF   +S           +E + I A E +NPR+ +
Sbjct: 271 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 330

Query: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421
           P A K + +RIL  ++ S+  +G LVPY+  +L  + S  + ASP++IA+ + G +++PH
Sbjct: 331 PRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYIS-ASPFIIAIENSGTKILPH 389

Query: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481
             NAVIL +++S  NS  Y   RIL+ L++   AP WF Y  R G P  ++  ++ F  +
Sbjct: 390 IFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGAL 449

Query: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541
           AF   SS     F WLL I  ++  F W+ I ++H+RF +A+K +G S D++ FK++   
Sbjct: 450 AFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMP 509

Query: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
             + Y+   MT+ +I + + + AP      +  +F   Y+++ +   L+  +++  R  K
Sbjct: 510 HLAYYSIFFMTIIIIIQGFTAFAP----TFNGSDFVAAYISIFLFFFLWLCFQLYFRS-K 564

Query: 602 LFIRAKDIDLVSHRKIYD 619
           L    +++D+ + R+  D
Sbjct: 565 LLWTVEEVDIDTDRRDVD 582

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  237 bits (605), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 166/590 (28%), Positives = 263/590 (44%), Gaps = 42/590 (7%)

Query: 28  KNSDAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSF 87
           ++S   SP Q  +V + +     P  V  ++S           PS   +  H     D  
Sbjct: 76  RHSAGISPAQ-TVVTFTDAADKDPNVVQVTES-----------PSSGSRTHHYEAEKDDA 123

Query: 88  RRAEDID----APTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXX 143
            R E I     A +N  +  EL    SP   + D    PH       L++ ++ RHV   
Sbjct: 124 IRMEKISKNQSASSNGTVREELDLEKSP---SADGDAGPH------RLKQGLQSRHVQLI 174

Query: 144 XXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG----LPG 199
                          S LH  GP GL I Y I+ + +Y I+ A GEM     G      G
Sbjct: 175 ALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAG 234

Query: 200 NFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXX 259
           +     +  VD + GF+  W Y   ++ ++  E   AS  ++YWTT V            
Sbjct: 235 SSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCV 294

Query: 260 XXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 319
                    K Y E+EF+F S K+L + G  IL+ ++  GG      +G +YW +PG+F 
Sbjct: 295 VVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFA 354

Query: 320 ---GDKSIDRFKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFI 375
                 S+  F D+ +             E + + ++E ++ RR I  A++  ++R++F 
Sbjct: 355 HHLAGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFF 414

Query: 376 FLTSITLVGFLVPYNSTEL---MGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVL 432
           ++     +  +VPYN   L   +  G     +SPYVI + + G++V+PH IN  IL S  
Sbjct: 415 YVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAW 474

Query: 433 SVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEED 492
           S AN+  ++S R L +++Q G AP     I+R G P  A+ +S L S +A+   SS   D
Sbjct: 475 SAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTAD 534

Query: 493 VFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA-IMM 551
           VF W   IS +S    WI  C++++RFR+A+   G   D + FK+    WG  Y     +
Sbjct: 535 VFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKT----WGQPYTVWFSL 589

Query: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601
           T+  I       A     + +  +F   Y+ +PI +VL+ G+K+  R W 
Sbjct: 590 TVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWN 639

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  234 bits (598), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 143/496 (28%), Positives = 243/496 (48%), Gaps = 26/496 (5%)

Query: 125 EEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCII 184
           E    +L+  ++ RH+                  S L   GP  LVI Y ++ + +Y I+
Sbjct: 50  ESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIM 109

Query: 185 QACGEMAVAYSGLPGNFN-----AYPSFLV----DEAFGFSVAWVYCLQWLCVMPLELVT 235
              GEM V Y  LPGN +      Y ++LV    DE+ GF+ +W Y   ++ ++  E   
Sbjct: 110 NMFGEM-VCY--LPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTA 166

Query: 236 ASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295
           AS  ++YWT+ +                     K Y EAEF+F   K+  + G  I+A V
Sbjct: 167 ASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFV 226

Query: 296 INTGGAGND---GYIGAKYWHNPGAFRG---DKSIDRFKDVMSXXXX-XXXXXGASEFIA 348
           I  GGA N+    ++G  YW NP +FR    + S+  F DV +             E ++
Sbjct: 227 IFCGGAPNNEDNSFVGFHYWKNPSSFRDYVTNGSLGNFLDVYNALIKGAFAFILGPELVS 286

Query: 349 IGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGS---GSAATKAS 405
           + +SE  + RR I  A++  +YR++F ++     +  +VPYN   L+ +         +S
Sbjct: 287 LTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSS 346

Query: 406 PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDRE 465
           P+VI + + G+ ++PH IN  IL S +S  N+  ++S R L ++ + G AP  F+ I+R 
Sbjct: 347 PFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRH 406

Query: 466 GRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKV 525
           G P  A+ +S + + +AF  CS+    VF W   IS +S    W   C++++RFRR +  
Sbjct: 407 GVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDY 466

Query: 526 QGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPI 585
            G   D + FK++  V+ + Y+ + + + ++   ++ I P      + Q+F   Y+ +P+
Sbjct: 467 NGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIP---KFWNYQDFIAAYITLPV 522

Query: 586 LIVLYFGYKICKRDWK 601
            +VLYFG+ I    W+
Sbjct: 523 FLVLYFGHIIYSGRWR 538

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  232 bits (592), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 246/515 (47%), Gaps = 26/515 (5%)

Query: 117 DPQFAPHAEEKDD--HLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYA 174
           D + +P  E  ++   L++ ++ RHV                  S LH  GP GL I Y 
Sbjct: 94  DVEKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYI 153

Query: 175 IMGSCLYCIIQACGEMAVAYSG----LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMP 230
           I+ + +Y I+ A GEM     G      G+     +  VD + GF+  W Y   ++ ++ 
Sbjct: 154 IISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVA 213

Query: 231 LELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFF 290
            E   AS  ++YWTT V                     K Y E+EF+F S K+L + G  
Sbjct: 214 AECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLI 273

Query: 291 ILAIVINTGGAGNDGYIGAKYWHNPGAFR---GDKSIDRFKDVMSXXXXXXXX-XGASEF 346
           IL+ ++  GG  N   +G +YW +PGAF       S+  F D+ +             E 
Sbjct: 274 ILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPEL 333

Query: 347 IAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTEL---MGSGSAATK 403
           + + ++E ++ RR I  A++  ++R++F ++     +  +VPYN   L   +  G     
Sbjct: 334 VCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAG 393

Query: 404 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
           +SP+VI + + G++V+PH IN  IL S  S AN+  ++S R L +++Q G AP     I+
Sbjct: 394 SSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRIN 453

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           R G P  A+ +S L S +A+   SS   DVF W   IS +S    W+  C++++RFR+A+
Sbjct: 454 RWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAI 513

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAA----IMMTLALIAEFWVSIAPIGEDHLDAQNFFEN 579
              G   D + FK+    WG  Y      I++ +  +   +    P    +    +F   
Sbjct: 514 FYNGL-FDRLPFKT----WGQPYTVWASLIVVGIITLTNGYAIFIP---KYWKIADFIAA 565

Query: 580 YLAMPILIVLYFGYKICKRDW-KLFIRAKDIDLVS 613
           Y+ +PI +VL+FG+K+  R W + ++   +ID+ +
Sbjct: 566 YITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTT 600

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  232 bits (591), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 152/543 (27%), Positives = 255/543 (46%), Gaps = 31/543 (5%)

Query: 88  RRAEDIDAPTNRDIENELTTTLS-PLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXX 146
           + +++  A +N  I  +L   +    S + D    PH       L++ ++ RHV      
Sbjct: 68  KISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEPH------KLKQGLQSRHVQLIALG 121

Query: 147 XXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG----LPGNFN 202
                       S LH  GP GL I Y I+ + +Y I+ A GEM     G      G+  
Sbjct: 122 GAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTA 181

Query: 203 AYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXX 262
              +  VD + GF+  W Y   ++ ++  E   AS  ++YWTT V               
Sbjct: 182 NLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVI 241

Query: 263 XXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR--- 319
                 K Y E+EF+F S K+L + G  IL+ ++  GG  N   +G +YW +PGAF    
Sbjct: 242 LNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHL 301

Query: 320 GDKSIDRFKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 378
              S+  F D+ +             E + + ++E ++ RR I  A++  ++R++F ++ 
Sbjct: 302 TGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVL 361

Query: 379 SITLVGFLVPYNSTEL---MGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVA 435
               +  +VPYN   L   +  G     +SP+VI + + G++V+PH IN  IL S  S A
Sbjct: 362 GTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAA 421

Query: 436 NSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFT 495
           N+  ++S R L +++Q G AP     I++ G P  A+ +S L S +A+   SS   DVF 
Sbjct: 422 NAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFN 481

Query: 496 WLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAA----IMM 551
           W   IS +S    W+  C++++RFR+A+   G   D + FK+    WG  Y      I++
Sbjct: 482 WFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPYTVWFSLIVI 536

Query: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDID 610
            +  I   +    P    +    +F   Y+ +PI +VL+FG+K+  R W+  ++   +ID
Sbjct: 537 GIITITNGYAIFIP---KYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEID 593

Query: 611 LVS 613
           + +
Sbjct: 594 VTT 596

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  230 bits (587), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/499 (27%), Positives = 239/499 (47%), Gaps = 15/499 (3%)

Query: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVI 171
           +S  +D  +      +D  +++ +K RH+                  + L  AGP G +I
Sbjct: 70  VSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLI 129

Query: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231
            Y  M + ++ + Q+ GEMA  +  +  +F  + S  +  + G +  ++Y   W     L
Sbjct: 130 AYLFMATIVFSVTQSLGEMA-TFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFAL 188

Query: 232 ELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFI 291
           EL      IQ+WT  V                     K Y E EF+  S KV+ + GF I
Sbjct: 189 ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248

Query: 292 LAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSXXXXXXXXXGASEF 346
             + +   GAG  G +G +YW NPG +         +  RF   +S           +E 
Sbjct: 249 YCLCM-VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTEL 307

Query: 347 IAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASP 406
           + I A E +NPR+ +P A K + +RIL  ++ S+  +G LVP++  +L     +   +SP
Sbjct: 308 VGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSD-DSYVSSSP 366

Query: 407 YVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREG 466
           ++IA+ + G +V+PH  NAVIL +++S  NS  Y   R+++ L++   AP WF    + G
Sbjct: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426

Query: 467 RPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQ 526
            P  A++ ++ F  +AF   SS     F WLL I G++  F W+ I ++H+RF + ++ +
Sbjct: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486

Query: 527 GRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPIL 586
           G S D++ FK+ +  W + YA   M + +I + + + AP      +  +F   Y+++ + 
Sbjct: 487 GISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPT----FNGSDFVAAYISVFLF 542

Query: 587 IVLYFGYKI---CKRDWKL 602
             L+  +++   CK  W L
Sbjct: 543 FFLWVSFQLYFRCKLYWSL 561

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  230 bits (586), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 157/511 (30%), Positives = 252/511 (49%), Gaps = 26/511 (5%)

Query: 124 AEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCI 183
            + K   L+K ++ RHV                  SAL +AGP  ++I Y+IMG  ++ +
Sbjct: 51  GKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTV 110

Query: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243
           +   GEMA AY  L G F +Y +   D A GF+V + Y  ++L + P +L  A++ +QYW
Sbjct: 111 MSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 244 TT--TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301
                VN                  G K + E EF+ +S KVL+M     L +V+  GG 
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 302 GNDGYIGAKYWHNPGAFR---GDKSI----DRFKDVMSXXXXXXXXXGASEFIAIGASEQ 354
            +   +G +YW +PG F+   G  SI     +F    S           +E   I A+E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA--SPYVIAVA 412
            NPRR +P A K  +YRI+  +L ++ L+G  V YN   L+ +  A T A  SPYV+A+ 
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 413 SHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAM 472
           + G+ V+PH  NA +L  V S  NS  Y   R LY L+    AP  F   +  G P  ++
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 473 IMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDE 532
            +  LF  +A+   SS  E +F++ + ++ +  L +WI+I +++I F RA +VQG   + 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 533 IGFKS---QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589
           + +++    V  W +    +M  +AL+  F V +     D  D + F   Y+ +P+ I+ 
Sbjct: 469 LSYQAPFQPVTAWIALGFCLM--VALVKNFTVFLG----DTFDYKTFITGYIGIPVYILC 522

Query: 590 YFGYKIC-KRDWKLFIRAKDIDLVSHRKIYD 619
           +  YKI  K  W   I++ ++DL +++   D
Sbjct: 523 FVCYKIVHKTKW---IKSANVDLFTYKTAID 550

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  229 bits (585), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 159/550 (28%), Positives = 261/550 (47%), Gaps = 31/550 (5%)

Query: 88  RRAEDIDAPTNRDIENELT--------TTLSPLSATKDPQFAPHAEEK-DDHLQKTIKPR 138
           RR ++ +  TN ++ ++ T         +L+P  ++ +     + + K +  LQ+ +  R
Sbjct: 4   RREKEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEGKLQQGLSAR 63

Query: 139 HVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198
           H+                  S LH  GP GL I Y I+ + LY I+ A GEM V Y  LP
Sbjct: 64  HIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEM-VCY--LP 120

Query: 199 GNFN---AYPSFLVDE----AFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADX 251
           GN +      S LVD     +  F+  W Y   ++ ++  E   AS  ++YWT  V    
Sbjct: 121 GNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWTDAVPTAA 180

Query: 252 XXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKY 311
                            K Y E EF+F S KVL + G  IL+ ++  GG  N   +G +Y
Sbjct: 181 WITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRY 240

Query: 312 WHNPGAFR---GDKSIDRFKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKT 367
           W NPG F       ++  F DV S             E IA+ +SE  + RR I  A+K 
Sbjct: 241 WKNPGGFAHHITGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKR 300

Query: 368 MIYRILFIFLTSITLVGFLVPYNS---TELMGSGSAATKASPYVIAVASHGVRVVPHFIN 424
            ++R++F ++     +  +V  N    T  + SG     +SP+VI + + G++++PH IN
Sbjct: 301 FVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIIN 360

Query: 425 AVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFC 484
           A IL S  S  N+  ++S R L +++  G AP  F  I+R G P  A+  SAL S +A+ 
Sbjct: 361 ACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYL 420

Query: 485 ACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGS 544
             SS   DVF W   IS +S    W    V+++RFR+A+K  G   + + +  +   +  
Sbjct: 421 NVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGLE-NRLPYAPRFQQYMV 479

Query: 545 SYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW-KLF 603
            ++ +++TL +    +    P      +  +F   Y+ +P+ +VL+ G+KI  RD+ K +
Sbjct: 480 WWSILVVTLVIFTNGYQVFIP---RFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWW 536

Query: 604 IRAKDIDLVS 613
              ++ID+V+
Sbjct: 537 YPVEEIDVVT 546

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  229 bits (585), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 259/532 (48%), Gaps = 24/532 (4%)

Query: 100 DIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXS 159
           D+EN ++  LS  +  ++  +    + +   L+K ++ R V                  +
Sbjct: 42  DLENNIS--LSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGN 99

Query: 160 ALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAW 219
           +L  AGP  ++I YA +G  ++  + + GEMA +Y  L G F +Y +   D A GF+V +
Sbjct: 100 SLATAGPVSMLIAYAFVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYADPALGFAVGY 157

Query: 220 VYCLQWLCVMPLELVTASMTIQYWT--TTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFF 277
            Y  ++  + P +L  A++ IQYW     VN                  G + + E EF+
Sbjct: 158 CYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFW 217

Query: 278 FNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDV 330
            +S KVL+M    IL  ++  GG  N   +G ++W +PGAF        GD    +F   
Sbjct: 218 LSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTG--KFVAF 275

Query: 331 MSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390
           +S           +E + I   E  NPR+++P A K  +YRI+  +L SI L+G  V Y+
Sbjct: 276 VSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYD 335

Query: 391 STELMGSGSAATKA--SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYS 448
              L+ + + +T A  SP+V+A+ + G++V+PH  NA +L+ V S  NS  Y + R LYS
Sbjct: 336 DPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYS 395

Query: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508
           L+    AP  F   +R G P  ++ +S LF ++A+ + SS    +F + + +  +  L +
Sbjct: 396 LAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 455

Query: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIG 567
           WI I V+++ F RA++ QG       + +    +G+ +A    +L ALI  F V +    
Sbjct: 456 WICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLG--- 512

Query: 568 EDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
               D + F   Y+ +P+  + YFGYK+  +     I   ++DL + +   D
Sbjct: 513 -HQFDYKTFITGYIGIPVFFISYFGYKLIYK--TKIIDPLEVDLYTFKAAID 561

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  228 bits (580), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 257/534 (48%), Gaps = 21/534 (3%)

Query: 97  TNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXX 156
           +N  +E E   TL      +        + +   L+K ++ RHV                
Sbjct: 17  SNETLE-EGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIG 75

Query: 157 XXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS 216
             S+L  AGP  ++I Y+ +G  +Y ++   GEMA A+  L G F +Y S  VD A GF+
Sbjct: 76  TGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFA 133

Query: 217 VAWVYCLQWLCVMPLELVTASMTIQYWTTT--VNADXXXXXXXXXXXXXXXXGAKGYAEA 274
           V + Y  ++  V P +L   +M +Q+W +   VN                  G + + E 
Sbjct: 134 VGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEF 193

Query: 275 EFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG-----DKSIDRFKD 329
           EF+ +S KVL+M G  +L  +I  GG  N    G ++W +PGAF+        S  +F  
Sbjct: 194 EFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVS 253

Query: 330 VMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPY 389
             S           +E   I A+E  NPRR++P A K  +YRI+  ++ +I L+G  V Y
Sbjct: 254 FASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAY 313

Query: 390 NSTELMGSGSAATKA--SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILY 447
           N   L+ +   AT A  SP+V+A+ +  + V+PH  N  +L+ V S  NS  Y + R LY
Sbjct: 314 NDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLY 373

Query: 448 SLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLF 507
            L+  G AP  F   ++ G P  ++ +S LF ++A+   SS    VF + + +  +  L 
Sbjct: 374 GLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLL 433

Query: 508 TWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMT--LALIAEFWVSIAP 565
           +WI I +++IRF +A++VQ      + + +    W S+Y A+     + LI  + V +  
Sbjct: 434 SWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW-STYVALFFCCLIGLIKNYTVFLG- 491

Query: 566 IGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
                 D + F   Y+ +P+ ++ Y GYK+  R  KL I+ +D+DL + +   D
Sbjct: 492 ---HKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAID 540

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  228 bits (582), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 151/517 (29%), Positives = 249/517 (48%), Gaps = 23/517 (4%)

Query: 116 KDPQFA-PHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYA 174
           +D  FA P  +++   L+K +K RH+                  +AL   GP  ++I Y 
Sbjct: 64  RDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYG 123

Query: 175 IMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELV 234
            +G  ++  +   GEMA +Y  L G F +Y S  VD A GF++ + Y  ++  + P +L 
Sbjct: 124 FVGLLVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181

Query: 235 TASMTIQYWTTT--VNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFIL 292
            A++ IQYW +   VN                  G + + E EF+ +S KV++M G  +L
Sbjct: 182 AAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILL 241

Query: 293 AIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSXXXXXXXXXGASE 345
             +I  GG  +   +G +YW +PGAF+       G K   +F    S            E
Sbjct: 242 LFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKG--KFVAFASVFVYSLFSYTGIE 299

Query: 346 FIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA- 404
              I  SE  NPR+++P A K  +YRI+  +L ++ L+G  V YN   L+ +   A  A 
Sbjct: 300 LTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAA 359

Query: 405 -SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYID 463
            SP+V+A+ + G++V+PH  N  +L+ V S  NS  Y S R LY+L+  G AP  F    
Sbjct: 360 ASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 419

Query: 464 REGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 523
           + G P  A+++S LF  +A+   S+    +F + + +  +  + +WI I + +I F RA 
Sbjct: 420 KWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRAC 479

Query: 524 KVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIGEDHLDAQNFFENYLA 582
           + QG    +  + +    +G+ +A     L ALI  F V +        D + F   Y+ 
Sbjct: 480 RAQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HTFDYKTFITGYIG 535

Query: 583 MPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619
           +PI +  + GYK+  +     ++  D DL + ++IYD
Sbjct: 536 LPIYVFSWVGYKLIYK--TKVVKPADADLYTLKEIYD 570

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  228 bits (580), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 148/535 (27%), Positives = 250/535 (46%), Gaps = 22/535 (4%)

Query: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXX 152
           +D  T +  E +LT+  +   + K+       +  D +L+K +K  H+            
Sbjct: 16  VDKQTGQVYELDLTSYSN--DSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTG 73

Query: 153 XXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP------GNFNAYPS 206
                 S L+K GP GL I Y IM + +Y ++ A  EM     GLP      G+ +   +
Sbjct: 74  LFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCT 133

Query: 207 FLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXX 266
             VD + GF+V W Y   ++ ++  E   AS  + YWTT V                   
Sbjct: 134 RYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCT 193

Query: 267 GAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR---GDKS 323
             + Y  +E  F S K+  + G  I++IV+  GG  N   +G ++W +PGA+     D  
Sbjct: 194 AVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGG 253

Query: 324 IDRFKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITL 382
             R  D+++             E + + ++E  + RR I  AA+  ++R++F +  S   
Sbjct: 254 AGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLC 313

Query: 383 VGFLVPYNSTELMGS---GSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAF 439
            G +V  N   L+ +   G     +SP+VI + + G++V+PH IN  IL S  S  NS  
Sbjct: 314 AGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFM 373

Query: 440 YSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLA 499
           Y++ R L SLSQ+GYAP  FN ++R G P   +  +  FS +A+   SS   DVF W   
Sbjct: 374 YATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSN 433

Query: 500 ISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEF 559
           IS +S    WI   V+++RFR+A+       D + FK+    + + +  I++ +  +   
Sbjct: 434 ISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLING 492

Query: 560 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDW-KLFIRAKDIDLVS 613
           + S       H + ++F   Y+ +P+ ++L+ G+K   R W +  I   +ID+ +
Sbjct: 493 YESFV-----HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTT 542

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score =  219 bits (558), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 194/326 (59%), Gaps = 6/326 (1%)

Query: 327 FKDVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFL 386
           FK++ +         G SE + + ++E  N   AI  AAK   +RI   ++T++ ++G L
Sbjct: 5   FKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-AISRAAKGTFWRIAIFYITTVVIIGCL 63

Query: 387 VPYNSTELM-GSGSAATKASPYVIAVASHGVR--VVPHFINAVILLSVLSVANSAFYSSC 443
           VPYN + L+ GS S    ASP+VIA+++ G     V +F+N VIL++V+SV NS  Y+S 
Sbjct: 64  VPYNDSRLLNGSTSEDISASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASS 123

Query: 444 RILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGL 503
           R++ +L   G  PS  +Y+DR+GRP   + +S +F ++ F   S+KE++VFTWL A+  +
Sbjct: 124 RLIQALGASGQLPSICSYMDRKGRPLVGIAISGVFGLLGFLVASNKEDEVFTWLFALCSI 183

Query: 504 SQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSI 563
           S  FTW  IC+S IRFR A+K QGRS DEI +KS +GV+G     ++  L +  E +VS 
Sbjct: 184 SSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSA 243

Query: 564 APIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK-LFIRAKDIDLVSHRKIYDGXX 622
           AP+G     A+ FFE  L++PI+IV+Y  ++I ++DW+  +I+  DIDL +   I +   
Sbjct: 244 APVGSPS-SAKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLDL 302

Query: 623 XXXXXXXXXXXXXNGPFWKKVVAFWC 648
                        + PF+ K+  FWC
Sbjct: 303 FKAQKEAEKELIASKPFYYKIYRFWC 328

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  222 bits (565), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 151/506 (29%), Positives = 243/506 (48%), Gaps = 18/506 (3%)

Query: 124 AEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIMGSCLYCI 183
            + +   L+K ++ RHV                  S+L  AGP  ++I Y+ +G  +Y +
Sbjct: 44  GKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTV 103

Query: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243
           +   GEMA A+  L G F +Y S  VD A GF+V + Y  ++  V P +L   +M +QYW
Sbjct: 104 MACLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 244 TT--TVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301
            +   VN                  G + + E EF+ +S KVL+M G  +L  +I  GG 
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 302 GNDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSXXXXXXXXXGASEFIAIGASEQSN 356
            N    G +YW +PGAF+        S  +F    S           +E   I A+E  N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKA--SPYVIAVASH 414
           PRR++P A K  +YRI+  ++ SI L+G  V YN   L+ +   +T A  SP+V+A+ + 
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 415 GVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIM 474
           G+ V+PH  NA +LL V S  NS  Y + R LY L+    AP  F   +  G P  ++ +
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 475 SALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIG 534
           S LF ++A+   SS    +F + + +  +  L +WI+I ++++RF +A+  Q        
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 535 FKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGY 593
           + +    W +  +     L  LI  + V +        D + F   Y+ +P+  + Y GY
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGY 517

Query: 594 KICKRDWKLFIRAKDIDLVSHRKIYD 619
           K+  R  KL I+ +D+DL + +   D
Sbjct: 518 KLVHRS-KL-IKPEDVDLYTFKAAID 541

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  221 bits (564), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 141/504 (27%), Positives = 244/504 (48%), Gaps = 13/504 (2%)

Query: 117 DPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXXXSALHKAGPGGLVIGYAIM 176
           + Q +    + + +L+K +  RH+                  S L + GP  L + + I+
Sbjct: 37  ESQNSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIII 96

Query: 177 GSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTA 236
            + +YCI+    EM V Y    G+     +  VD + GF+  W Y   +  ++  EL  A
Sbjct: 97  STMVYCIMCTLAEM-VCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAA 155

Query: 237 SMTIQYWTTTVNADXXXXXXXXXXXXXXXXGAKGYAEAEFFFNSCKVLMMAGFFILAIVI 296
           +  ++YWT  V                     + Y E+EF+F S K++ +    +++IVI
Sbjct: 156 AGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVI 215

Query: 297 NTGGAGNDGYIGAKYWHNPGAFR---GDKSIDRFKDVMSXXXXXXXXXGAS-EFIAIGAS 352
             GGA N   +G +YW NPGAF       ++ RF D+ +           S E + +   
Sbjct: 216 FFGGAPNHDRVGFRYWRNPGAFGYHITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACV 275

Query: 353 EQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGS---GSAATKASPYVI 409
           E  + RR I  A++  IYRI+F +L+S  ++G +V  N   L+ +         +SP+V 
Sbjct: 276 EAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQ 335

Query: 410 AVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPA 469
            +A+ G+ V+ H IN  IL S  S  NS FY+S R + +LS+QG AP  F+ I+R G P 
Sbjct: 336 GIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPY 395

Query: 470 RAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRS 529
            A+ + +L + +A+   SS    VF WL  I  +S    W  I V++IRFR+A+ +  R 
Sbjct: 396 NAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAI-LFNRL 454

Query: 530 VDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589
           +D I ++S +  + + +  I++ +  +   +V      +   D ++F  +Y+++PI +  
Sbjct: 455 LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFI---KGRWDYKDFLTSYISLPIFLAF 511

Query: 590 YFGYKICKRDWKLFIRAKDIDLVS 613
           Y G+K   +  +  I    ID+++
Sbjct: 512 YLGHKTIYKT-RFCIPVDQIDVIT 534

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  221 bits (564), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 154/513 (30%), Positives = 248/513 (48%), Gaps = 23/513 (4%)

Query: 98  NRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVXXXXXXXXXXXXXXXXX 157
           N D+E  ++   S  S  ++  +    + +   L+K +K RHV                 
Sbjct: 38  NDDLERNIS---SASSQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGT 94

Query: 158 XSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSV 217
            ++L  AGP   +I YA +G  ++  +   GEMA  Y  L G F +Y S   D A GF+V
Sbjct: 95  GTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAV 152

Query: 218 AWVYCLQWLCVMPLELVTASMTIQYWT--TTVNADXXXXXXXXXXXXXXXXGAKGYAEAE 275
            + Y  ++  + P +L  A++ IQYW     VN                  G + + E E
Sbjct: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFE 212

Query: 276 FFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFK 328
           F+ +S KVL+M G  +L  ++  GG  +   +G +YW +PG+F+       GD    RF 
Sbjct: 213 FWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFV 270

Query: 329 DVMSXXXXXXXXXGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVP 388
             +S            E   I A+E  NPR++IP A K  +YRI+  +L SI L+G  V 
Sbjct: 271 AFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVA 330

Query: 389 YNSTELMGSGSAATKA--SPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRIL 446
           Y+   L+ + +++T A  SP+V+A+ + G+  +PH INA +L+ V S  NS  Y S R L
Sbjct: 331 YDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSL 390

Query: 447 YSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQL 506
           YSL+    AP  F   +R G P  A+ +S LF ++A+   SS    +F + + +  +  +
Sbjct: 391 YSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGI 450

Query: 507 FTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAP 565
            +WI+I +++I F RA++ QG       + +    +G+ ++     L ALI  F V +  
Sbjct: 451 LSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-- 508

Query: 566 IGEDHLDAQNFFENYLAMPILIVLYFGYKICKR 598
                 D +NF   Y+ +P+    YFGYK   +
Sbjct: 509 --NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  220 bits (561), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 147/518 (28%), Positives = 246/518 (47%), Gaps = 22/518 (4%)

Query: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDH-LQKTIKPRHVXXXXXXXXXXX 151
           +D  T +  E + T +LS L+          +++++ H L++ ++ RH+           
Sbjct: 16  VDKQTGQVFELD-TESLSALNTGGS-----ESQKREPHTLKQGLQSRHIQLIALGGVIGT 69

Query: 152 XXXXXXXSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP----GNFNAYPSF 207
                  S L   GP GL+  Y I+   +Y ++ A GEM     G      G+ +   S 
Sbjct: 70  GLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSR 129

Query: 208 LVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADXXXXXXXXXXXXXXXXG 267
             D + GF+  W Y   ++ ++  E   AS  + YWTT V                    
Sbjct: 130 YADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGP 189

Query: 268 AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR---GDKSI 324
            K Y E+EF+F   K+L + G   ++ ++  GG  +   +G +YW  PGAF       + 
Sbjct: 190 VKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTGNT 249

Query: 325 DRFKDVMSXXXXXXXX-XGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLV 383
            RF DV +             E +A+ +SE  + RR I  A++   YR++F ++ S   +
Sbjct: 250 GRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAI 309

Query: 384 GFLVPYNSTEL---MGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFY 440
           G +V  N   L   + SG A   +SP+VIA+ +  ++++PH INA IL S  S  NS  +
Sbjct: 310 GVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMF 369

Query: 441 SSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAI 500
           ++ R L S+++ G AP  F  I+R G P  A+ +SA FS +A+   SS     FTW   I
Sbjct: 370 AASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNI 429

Query: 501 SGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFW 560
           S +S    WI I V+++RFR+A+  +G   D + FKS    +G+ +  I++++  +   +
Sbjct: 430 STISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGY 488

Query: 561 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKR 598
            +  P         +F   Y+ +P+ +VL+ G+KI  R
Sbjct: 489 ATFIP---RFWKGADFVAAYITLPVFVVLWVGHKIYTR 523

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,498,557
Number of extensions: 2434530
Number of successful extensions: 9487
Number of sequences better than 10.0: 384
Number of HSP's gapped: 8159
Number of HSP's successfully gapped: 417
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)