Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D041001.52ON1117111754490.0
Suva_2.6871.52ON1128116430910.0
YDR507C (GIN4)1.52ON1142117830610.0
Smik_4.7891.52ON1136116230430.0
Skud_4.7831.52ON1135116930360.0
TDEL0C064901.52ON1153118030120.0
KNAG0F002901.52ON1125116330080.0
NCAS0B086001.52ON1117116528990.0
Kpol_2002.461.52ON1123116327190.0
ZYRO0F17402g1.52ON1189119726940.0
CAGL0K05709g1.52ON1103115126700.0
SAKL0C01716g1.52ON1215123326210.0
TPHA0E036401.52ON1137118526150.0
KLTH0F01672g1.52ON1164119625940.0
KLLA0C01650g1.52ON1112116725920.0
NDAI0A006601.52ON1022115125750.0
AFR696C1.52ON1142118625050.0
Suva_3.1901.52ON1024116219580.0
Skud_3.391.52ON1017114419190.0
Ecym_10581.52ON116458118800.0
TBLA0A071501.52ON139151618640.0
Smik_3.541.52ON103293017980.0
Kwal_33.132251.52ON964100317820.0
YCL024W (KCC4)1.52ON103735314660.0
Ecym_73922.479ON143438510581e-122
KLTH0D05566g2.479ON112835110351e-121
ABL034W2.479ON142535210481e-121
SAKL0E02860g2.479ON137735110461e-121
KLLA0F13552g2.479ON126735010331e-120
KAFR0D032002.479ON144838310211e-117
TDEL0A025502.479ON136939210141e-117
Kwal_26.77882.479ON126735210061e-116
TBLA0I011502.479ON174538510211e-116
Kpol_431.92.479ON155246510141e-116
YKL101W (HSL1)2.479ON151838910101e-115
NCAS0A057702.479ON146138110001e-114
Smik_11.1392.479ON153438910021e-114
KNAG0A065402.479ON14323779971e-114
Skud_11.1262.479ON15183899931e-113
Suva_11.1232.479ON15263909881e-112
ZYRO0G03366g2.479ON16163999841e-111
CAGL0K08514g2.479ON14893999721e-110
TPHA0G032002.479ON15344309171e-103
NDAI0D027502.479ON15153358434e-93
Kwal_33.13222singletonOFF1481206116e-73
CAGL0M08910g5.611ON6122806333e-70
TPHA0C004705.611ON6312756273e-69
YDR477W (SNF1)5.611ON6332706264e-69
Smik_4.7545.611ON6322706256e-69
NCAS0A080805.611ON6232706247e-69
TBLA0E033605.611ON6542706269e-69
Skud_4.7515.611ON6342706241e-68
Kpol_495.145.611ON6242706212e-68
Suva_2.6515.611ON6332706194e-68
KLLA0A03806g5.611ON6024026122e-67
KNAG0B032305.611ON6412756117e-67
Kpol_1018.655.611ON6012706071e-66
AEL230W5.611ON6082706071e-66
TDEL0A047805.611ON6212706071e-66
NDAI0H009405.611ON6852896112e-66
KAFR0C058605.611ON6442706063e-66
TPHA0D028405.611ON6342696045e-66
ZYRO0A05544g5.611ON6312706036e-66
SAKL0G06952g5.611ON5992686008e-66
KLTH0G05698g5.611ON5972685981e-65
Kwal_47.182335.611ON5982685972e-65
Ecym_55885.611ON6132705948e-65
Kwal_26.87098.654ON8292875456e-57
KLTH0D10714g8.654ON8722875441e-56
TPHA0G017108.654ON8052835411e-56
SAKL0H07084g8.654ON9192865405e-56
ZYRO0F06842g8.654ON8432875377e-56
KNAG0J015908.654ON8053245358e-56
TDEL0A060008.654ON7902805303e-55
NDAI0E023208.654ON9322915335e-55
CAGL0M02519g8.654ON7563015222e-54
Suva_16.1698.654ON8582945252e-54
Skud_16.1408.654ON8652945234e-54
YPL141C (FRK1)8.654ON8652945235e-54
NCAS0C015908.654ON8642915227e-54
Kpol_1012.68.654ON6282895072e-53
Kpol_1072.298.654ON8933005173e-53
CAGL0J03872g8.654ON6612915083e-53
NDAI0J012508.279ON11763095188e-53
KAFR0A037308.654ON7882905091e-52
TBLA0B039708.654ON12083075162e-52
NDAI0E012908.654ON7292935052e-52
Smik_6.3398.654ON8652915093e-52
KAFR0H025408.654ON8173325073e-52
TPHA0D011408.654ON6223004965e-52
ACR119W8.654ON9312845069e-52
TPHA0J008208.279ON12182895082e-51
NCAS0B014708.654ON7272884972e-51
NCAS0B037408.279ON10492885052e-51
SAKL0H16632g8.279ON10622915043e-51
Smik_15.4178.654ON8062864993e-51
Smik_4.3678.279ON10663105034e-51
CAGL0M11396g8.279ON11922885045e-51
KNAG0A030408.654ON6442894862e-50
KLTH0G13288g8.279ON11422884982e-50
NDAI0B020708.279ON12583494983e-50
TDEL0F040608.279ON11262844963e-50
Ecym_83398.654ON9202844934e-50
Skud_15.3998.654ON8072864895e-50
Suva_8.2848.654ON8082864895e-50
Skud_4.3838.279ON10652904937e-50
Suva_2.2838.279ON10892904937e-50
YDR122W (KIN1)8.279ON10642904938e-50
TBLA0C017508.654ON9812944911e-49
YOR233W (KIN4)8.654ON8002864861e-49
NCAS0B050908.279ON12102934921e-49
Skud_12.1648.279ON11602954902e-49
KLLA0F19536g8.279ON11042894893e-49
TBLA0C046008.279ON13152904903e-49
KNAG0G021108.279ON11922954893e-49
AGR058W8.279ON10712904874e-49
KAFR0B028008.279ON10952874874e-49
Kpol_1066.468.279ON12252904876e-49
Ecym_42918.279ON11452904866e-49
Smik_12.1558.279ON11623074867e-49
YLR096W (KIN2)8.279ON11472954841e-48
Suva_10.1808.279ON11592954841e-48
CAGL0M02299g8.668ON8932804738e-48
ZYRO0D06776g8.279ON12042864761e-47
KLLA0D07348g8.654ON9092844693e-47
SAKL0H06754g8.668ON8842764667e-47
CAGL0B01925g8.279ON9442884651e-46
KNAG0H031408.279ON9362834642e-46
ZYRO0F07194g8.668ON9382924597e-46
NDAI0G053001.374ON4372724361e-45
YFR014C (CMK1)1.374ON4462764352e-45
NDAI0E023908.668ON8833144542e-45
SAKL0D07656g1.374ON4323004315e-45
KNAG0J016708.668ON10093674517e-45
TBLA0B038608.668ON9882804509e-45
Kpol_1072.198.668ON8962784462e-44
NCAS0C016708.668ON8962774453e-44
KNAG0I014801.374ON4402764253e-44
Smik_7.3191.374ON4462764254e-44
TDEL0A061408.668ON8613734425e-44
NCAS0D006301.374ON4272764227e-44
Suva_6.781.374ON4452764221e-43
KLTH0H11396g1.374ON4372744192e-43
NCAS0A088801.374ON4222724182e-43
Skud_6.891.374ON4462764193e-43
KLLA0F11319g8.668ON8432834354e-43
CAGL0F04741g1.374ON4423944174e-43
Kpol_1069.131.374ON4272764164e-43
KLLA0F23155g1.374ON4272694148e-43
TPHA0G016308.668ON8712774311e-42
KNAG0D010906.222ON3722764072e-42
TPHA0O011201.374ON4292984112e-42
Ecym_24058.668ON8552804273e-42
KAFR0C044801.374ON4352744094e-42
Kwal_0.961.374ON4272684085e-42
Smik_6.3508.676ON8222874247e-42
Kwal_26.87518.668ON8482764239e-42
ACR133C8.668ON8512804231e-41
YPL153C (RAD53)8.676ON8212854212e-41
Smik_6.3478.668ON9172804222e-41
Suva_16.1608.668ON9182924212e-41
CAGL0M02233g8.676ON7672944182e-41
NDAI0H035201.374ON4582704053e-41
YPL150W8.668ON9012784203e-41
Skud_16.1298.676ON8272884193e-41
Skud_16.1328.668ON9242814203e-41
KLTH0D11044g8.668ON8492714184e-41
KLLA0F11143g8.676ON8132754174e-41
Kpol_1065.36.222ON3762743975e-41
Suva_16.1578.676ON8322934167e-41
CAGL0K10604g1.374ON4462784008e-41
KAFR0H024308.676ON7842804149e-41
KNAG0J017008.676ON8202824141e-40
TDEL0B063201.374ON4442843991e-40
AAR009W1.374ON4532693982e-40
Kwal_56.224766.31ON6972294082e-40
NCAS0D021006.31ON7262074093e-40
KLTH0D11242g8.676ON7952784113e-40
KLTH0C10912g6.31ON6972694074e-40
TBLA0A020506.222ON4342863927e-40
Suva_15.1551.374ON4523903938e-40
NDAI0E021108.676ON9032874089e-40
TBLA0D050101.374ON4342753911e-39
CAGL0L07326g2.352ON5063113951e-39
Kwal_26.87968.676ON7962784051e-39
Skud_15.1441.374ON4492743911e-39
Suva_13.1636.31ON7053114021e-39
Kwal_56.237178.279ON8581894033e-39
TBLA0B038408.676ON8582794033e-39
Ecym_12751.374ON4512683883e-39
SAKL0H06534g8.676ON8042804023e-39
YOL016C (CMK2)1.374ON4473003874e-39
TDEL0A062208.676ON7942804014e-39
ACL006W6.31ON7082653994e-39
YMR001C (CDC5)6.31ON7053113994e-39
TPHA0J004206.31ON7072913994e-39
Ecym_30356.31ON7402093995e-39
Smik_13.1596.31ON7052423976e-39
Skud_13.1546.31ON7052783976e-39
Smik_6.4146.222ON3672803807e-39
TBLA0B004906.31ON7873063997e-39
TPHA0E028206.222ON3842603808e-39
NCAS0C013708.676ON7992783989e-39
KAFR0I020101.374ON4322763831e-38
Smik_15.1531.374ON4423003831e-38
NCAS0B044906.222ON3492543771e-38
Kpol_1072.168.676ON7952803971e-38
KAFR0G026906.31ON7132793941e-38
Kpol_1037.206.31ON7042913942e-38
SAKL0E01584g6.31ON6952873932e-38
CAGL0I09504g1.336ON5282943862e-38
KNAG0E008506.31ON7112983932e-38
YPL209C (IPL1)6.222ON3672793743e-38
KLTH0H04180g6.214ON3532693734e-38
Skud_16.706.222ON3672793744e-38
TPHA0G016008.676ON8453013935e-38
ACR142W8.676ON8372843926e-38
ZYRO0C07480g6.31ON7742293908e-38
ZYRO0E05588g1.374ON4712763789e-38
CAGL0J11638g6.31ON7462673881e-37
NDAI0C026806.31ON7502073871e-37
Kwal_56.240596.214ON3532693691e-37
KLLA0E01585g2.352ON5122913782e-37
NDAI0B047001.336ON5282903792e-37
TBLA0A020306.214ON4032773722e-37
Kwal_56.240916.222ON3812563702e-37
KAFR0C042801.336ON5342903783e-37
TDEL0G043806.31ON7222293834e-37
KAFR0B054108.279ON5393743764e-37
SAKL0E05984g2.352ON5052913754e-37
YPL203W (TPK2)6.214ON3802743675e-37
CAGL0G09020g6.214ON3612693655e-37
Skud_16.766.214ON3822693675e-37
KLLA0C06138g6.31ON7082563825e-37
KAFR0K024502.352ON5112963745e-37
ZYRO0F07370g8.676ON7622793826e-37
Ecym_23978.676ON8722793846e-37
Smik_6.4086.214ON3812693666e-37
YDL101C (DUN1)2.352ON5132963737e-37
SAKL0C05368g1.182ON4182853688e-37
Smik_4.1352.352ON5132973738e-37
KNAG0D011406.214ON3952773651e-36
NDAI0A009601.182ON4082573661e-36
KAFR0K003306.214ON3732773631e-36
TPHA0F024306.31ON7982783802e-36
Skud_10.501.182ON3972703642e-36
ZYRO0E07018g6.222ON3672573622e-36
NCAS0A011006.214ON3542753602e-36
KNAG0C018201.336ON5903103732e-36
AFL188C2.352ON4723083672e-36
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D04100
         (1117 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...  2103   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1195   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1183   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1176   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1174   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...  1164   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...  1163   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...  1121   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...  1051   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...  1042   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...  1033   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...  1014   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...  1011   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...  1003   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...  1003   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    996   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   969   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   758   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   743   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   728   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   722   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   697   0.0  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   691   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   569   0.0  
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   412   e-122
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   403   e-121
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   408   e-121
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   407   e-121
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   402   e-120
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   397   e-117
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   395   e-117
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   392   e-116
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   397   e-116
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   395   e-116
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   393   e-115
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   389   e-114
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   390   e-114
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   388   e-114
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   387   e-113
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   385   e-112
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   383   e-111
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   379   e-110
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   357   e-103
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   329   4e-93
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   239   6e-73
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   248   3e-70
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   246   3e-69
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   245   4e-69
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   245   6e-69
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   244   7e-69
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   245   9e-69
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   244   1e-68
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   243   2e-68
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   243   4e-68
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   240   2e-67
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   239   7e-67
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   238   1e-66
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   238   1e-66
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   238   1e-66
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   239   2e-66
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   238   3e-66
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              237   5e-66
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   236   6e-66
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   235   8e-66
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   234   1e-65
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   234   2e-65
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   233   8e-65
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   214   6e-57
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   214   1e-56
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   213   1e-56
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   212   5e-56
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   211   7e-56
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   210   8e-56
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   208   3e-55
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              209   5e-55
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   205   2e-54
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   206   2e-54
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   206   4e-54
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   206   5e-54
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    205   7e-54
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   199   2e-53
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   203   3e-53
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   200   3e-53
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   204   8e-53
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   200   1e-52
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   203   2e-52
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   199   2e-52
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   200   3e-52
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   199   3e-52
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   195   5e-52
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   199   9e-52
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   200   2e-51
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    196   2e-51
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   199   2e-51
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   198   3e-51
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   196   3e-51
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   198   4e-51
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   198   5e-51
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   191   2e-50
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   196   2e-50
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             196   3e-50
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   195   3e-50
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   194   4e-50
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   192   5e-50
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   192   5e-50
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   194   7e-50
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   194   7e-50
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   194   8e-50
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   193   1e-49
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   191   1e-49
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             194   1e-49
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   193   2e-49
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   192   3e-49
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   193   3e-49
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   192   3e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   192   4e-49
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   192   4e-49
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   192   6e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   191   6e-49
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   191   7e-49
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   191   1e-48
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   191   1e-48
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   186   8e-48
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   187   1e-47
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   185   3e-47
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   184   7e-47
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   183   1e-46
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   183   2e-46
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   181   7e-46
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   172   1e-45
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   172   2e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   179   2e-45
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   170   5e-45
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   178   7e-45
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   177   9e-45
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   176   2e-44
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   176   3e-44
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   168   3e-44
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   168   4e-44
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   174   5e-44
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   167   7e-44
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   167   1e-43
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   166   2e-43
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   165   2e-43
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   166   3e-43
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   172   4e-43
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   165   4e-43
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   164   4e-43
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   164   8e-43
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   170   1e-42
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   161   2e-42
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   162   2e-42
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   169   3e-42
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   162   4e-42
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   161   5e-42
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   167   7e-42
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   167   9e-42
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   167   1e-41
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   166   2e-41
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   167   2e-41
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   166   2e-41
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   165   2e-41
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              160   3e-41
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   166   3e-41
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   166   3e-41
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   166   3e-41
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   165   4e-41
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   165   4e-41
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   157   5e-41
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   164   7e-41
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   158   8e-41
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   164   9e-41
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             164   1e-40
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   158   1e-40
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   157   2e-40
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   161   2e-40
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     162   3e-40
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   162   3e-40
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   161   4e-40
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              155   7e-40
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   155   8e-40
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   161   9e-40
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   155   1e-39
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   156   1e-39
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   160   1e-39
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   155   1e-39
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   159   1e-39
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   159   3e-39
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   159   3e-39
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   154   3e-39
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   159   3e-39
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   153   4e-39
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   159   4e-39
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   158   4e-39
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   158   4e-39
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   158   4e-39
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   158   5e-39
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   157   6e-39
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   157   6e-39
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   150   7e-39
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   158   7e-39
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   150   8e-39
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   157   9e-39
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   152   1e-38
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   152   1e-38
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    149   1e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   157   1e-38
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   156   1e-38
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   156   2e-38
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   155   2e-38
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   153   2e-38
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   155   2e-38
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   148   3e-38
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   148   4e-38
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   148   4e-38
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   155   5e-38
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   155   6e-38
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   154   8e-38
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   150   9e-38
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   154   1e-37
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   153   1e-37
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   146   1e-37
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   150   2e-37
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   150   2e-37
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   147   2e-37
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   147   2e-37
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   150   3e-37
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   152   4e-37
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   149   4e-37
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   149   4e-37
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   145   5e-37
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   145   5e-37
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   145   5e-37
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   151   5e-37
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   148   5e-37
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   151   6e-37
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   152   6e-37
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   145   6e-37
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   148   7e-37
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   146   8e-37
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   148   8e-37
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              145   1e-36
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   145   1e-36
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   144   1e-36
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   150   2e-36
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   144   2e-36
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   144   2e-36
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              143   2e-36
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              148   2e-36
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   145   2e-36
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   144   3e-36
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   144   3e-36
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   142   3e-36
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   143   3e-36
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   143   5e-36
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   143   5e-36
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   149   5e-36
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   142   6e-36
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   148   9e-36
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   144   1e-35
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   142   1e-35
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   141   1e-35
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   140   1e-35
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   144   1e-35
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   144   1e-35
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   141   1e-35
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   141   2e-35
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   142   2e-35
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   142   2e-35
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   142   2e-35
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   147   2e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   142   2e-35
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   140   2e-35
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   144   2e-35
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    140   3e-35
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   140   3e-35
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   143   3e-35
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   140   3e-35
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   140   3e-35
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   140   3e-35
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   141   3e-35
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   146   3e-35
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   140   3e-35
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   143   4e-35
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   142   4e-35
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   140   4e-35
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   143   5e-35
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   141   6e-35
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   140   6e-35
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   139   8e-35
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   145   1e-34
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   142   1e-34
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   139   1e-34
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   140   1e-34
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   140   1e-34
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   141   1e-34
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   138   2e-34
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   139   2e-34
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   138   2e-34
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   137   3e-34
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   144   4e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   138   4e-34
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   140   4e-34
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      137   4e-34
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   144   4e-34
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   137   5e-34
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   144   5e-34
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   139   6e-34
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   137   7e-34
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   142   8e-34
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   141   8e-34
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   139   9e-34
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   139   9e-34
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   136   1e-33
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   139   1e-33
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   136   1e-33
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   138   1e-33
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   142   1e-33
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   138   2e-33
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   142   2e-33
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   135   2e-33
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   136   2e-33
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   138   2e-33
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   138   2e-33
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   135   2e-33
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   142   2e-33
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   141   3e-33
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   140   4e-33
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   135   4e-33
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   134   4e-33
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   138   7e-33
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   138   7e-33
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   135   9e-33
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   136   9e-33
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   138   1e-32
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   139   1e-32
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   137   1e-32
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   138   1e-32
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   135   1e-32
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   137   2e-32
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   137   2e-32
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   139   2e-32
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   136   2e-32
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   136   2e-32
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   132   2e-32
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   136   3e-32
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   134   3e-32
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   134   4e-32
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   133   4e-32
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             135   5e-32
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   135   5e-32
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   137   5e-32
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   130   6e-32
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   135   6e-32
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   134   7e-32
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   137   8e-32
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   137   8e-32
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   136   9e-32
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   133   1e-31
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   135   1e-31
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   135   1e-31
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   136   1e-31
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   134   1e-31
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   133   1e-31
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   132   1e-31
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   134   2e-31
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   135   2e-31
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   132   2e-31
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   134   2e-31
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   135   2e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   130   2e-31
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   131   2e-31
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   131   2e-31
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   135   2e-31
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   133   3e-31
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   133   3e-31
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   133   3e-31
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   134   3e-31
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   132   4e-31
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   133   4e-31
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   134   4e-31
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             132   5e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   134   5e-31
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   132   5e-31
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   134   5e-31
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   134   6e-31
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   132   6e-31
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   132   7e-31
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    132   8e-31
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   133   9e-31
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   132   1e-30
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   133   1e-30
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   132   1e-30
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   133   1e-30
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   133   1e-30
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   130   1e-30
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   132   1e-30
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   132   1e-30
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              132   1e-30
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   132   1e-30
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   131   1e-30
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   132   1e-30
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   131   1e-30
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   128   2e-30
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   130   2e-30
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   130   2e-30
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   131   2e-30
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   131   2e-30
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   132   2e-30
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    131   2e-30
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   130   2e-30
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   132   2e-30
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   131   3e-30
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   130   3e-30
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   130   3e-30
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   130   3e-30
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   130   3e-30
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   130   4e-30
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   130   4e-30
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   129   4e-30
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   130   4e-30
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   129   4e-30
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   129   4e-30
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   131   5e-30
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   130   5e-30
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   126   5e-30
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   130   5e-30
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   130   6e-30
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   127   6e-30
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   129   6e-30
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   130   6e-30
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   130   7e-30
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   130   7e-30
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   130   7e-30
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   130   7e-30
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   129   7e-30
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   130   8e-30
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   127   8e-30
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   127   8e-30
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   129   8e-30
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   129   9e-30
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   126   9e-30
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   129   9e-30
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   127   9e-30
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   129   1e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   130   1e-29
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   129   1e-29
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   127   1e-29
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   129   1e-29
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   129   1e-29
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   129   1e-29
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   129   1e-29
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   130   1e-29
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   129   1e-29
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   129   1e-29
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   129   1e-29
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   129   1e-29
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   128   1e-29
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   129   1e-29
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   121   2e-29
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   127   2e-29
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   129   2e-29
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   129   2e-29
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   129   2e-29
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   129   2e-29
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   129   2e-29
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   128   2e-29
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   127   2e-29
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   124   2e-29
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   128   2e-29
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   127   2e-29
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   129   2e-29
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   127   2e-29
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   126   2e-29
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   125   2e-29
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   127   2e-29
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   127   2e-29
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   128   2e-29
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   125   3e-29
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   120   3e-29
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   128   3e-29
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   127   3e-29
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   127   3e-29
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   128   3e-29
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   128   3e-29
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   127   3e-29
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    122   4e-29
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   127   4e-29
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   124   4e-29
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   127   4e-29
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   126   4e-29
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   127   4e-29
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   127   5e-29
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   126   5e-29
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   127   5e-29
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   127   5e-29
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   127   5e-29
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   127   6e-29
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   120   6e-29
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   127   6e-29
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   127   6e-29
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   126   7e-29
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     127   7e-29
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   126   7e-29
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   127   7e-29
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   124   7e-29
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   127   7e-29
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   127   7e-29
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   127   7e-29
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   123   7e-29
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   126   7e-29
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   127   8e-29
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   125   8e-29
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   124   8e-29
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   127   8e-29
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   124   8e-29
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   125   9e-29
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   126   9e-29
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   125   9e-29
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   127   9e-29
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   125   9e-29
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   124   9e-29
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   125   9e-29
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   124   9e-29
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   119   9e-29
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   122   9e-29
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   127   1e-28
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   126   1e-28
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   125   1e-28
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   126   1e-28
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   125   1e-28
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   126   1e-28
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   125   1e-28
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   126   1e-28
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   126   1e-28
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   124   1e-28
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   121   1e-28
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   126   1e-28
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   126   1e-28
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   126   1e-28
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   123   2e-28
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   126   2e-28
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   125   2e-28
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   124   2e-28
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   126   2e-28
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   123   2e-28
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   125   2e-28
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   118   2e-28
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   124   2e-28
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   125   2e-28
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   122   2e-28
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   125   2e-28
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   125   3e-28
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   124   3e-28
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   125   3e-28
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   118   3e-28
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   125   3e-28
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   124   3e-28
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   125   3e-28
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   125   3e-28
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   125   3e-28
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   122   3e-28
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   125   3e-28
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   124   3e-28
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   124   3e-28
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   122   3e-28
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   124   3e-28
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   117   3e-28
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   124   4e-28
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   123   4e-28
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   125   4e-28
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   124   4e-28
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   124   5e-28
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   124   5e-28
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   117   5e-28
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   124   5e-28
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   124   5e-28
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   123   5e-28
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   120   5e-28
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   124   5e-28
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   124   5e-28
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   123   6e-28
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   124   6e-28
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   120   6e-28
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   124   6e-28
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   124   6e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   123   6e-28
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   117   6e-28
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   117   7e-28
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   121   7e-28
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   121   7e-28
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   122   8e-28
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   119   8e-28
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   123   8e-28
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   119   8e-28
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   124   8e-28
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   123   9e-28
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   120   9e-28
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    123   1e-27
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   123   1e-27
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   123   1e-27
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   119   1e-27
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    123   1e-27
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   122   1e-27
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   123   1e-27
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   123   1e-27
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             123   1e-27
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   119   1e-27
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   120   1e-27
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   122   1e-27
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   122   2e-27
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   120   2e-27
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   120   2e-27
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   122   2e-27
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   122   2e-27
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   122   2e-27
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   119   2e-27
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   121   2e-27
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   121   2e-27
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   122   2e-27
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   115   2e-27
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   121   3e-27
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   117   3e-27
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   119   3e-27
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   115   3e-27
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   122   3e-27
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   118   3e-27
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   120   3e-27
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   121   3e-27
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   119   3e-27
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   122   3e-27
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   115   3e-27
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   121   3e-27
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   119   4e-27
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   122   4e-27
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   118   4e-27
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   121   4e-27
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   121   4e-27
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   121   4e-27
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   120   4e-27
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   120   5e-27
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   117   5e-27
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   121   5e-27
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   120   5e-27
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   117   5e-27
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   117   5e-27
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   120   6e-27
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   121   6e-27
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   120   6e-27
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   119   7e-27
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   114   7e-27
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   119   7e-27
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   120   7e-27
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   114   8e-27
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   120   8e-27
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   120   9e-27
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   113   9e-27
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   120   9e-27
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   114   9e-27
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   119   9e-27
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   120   1e-26
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   119   1e-26
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   117   1e-26
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   118   1e-26
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   116   1e-26
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   118   1e-26
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   119   1e-26
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   119   2e-26
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   119   2e-26
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   119   2e-26
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   119   2e-26
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   117   2e-26
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   116   2e-26
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   119   2e-26
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   115   2e-26
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   119   2e-26
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   112   2e-26
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   117   2e-26
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   116   2e-26
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   117   2e-26
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   116   3e-26
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   118   3e-26
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   118   3e-26
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   119   3e-26
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   115   3e-26
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   118   3e-26
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   117   3e-26
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   112   3e-26
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   118   3e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   114   3e-26
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   117   3e-26
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   118   3e-26
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   117   3e-26
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   118   3e-26
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   114   4e-26
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   117   4e-26
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...   112   4e-26
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   117   4e-26
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                115   4e-26
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   118   5e-26
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   117   5e-26
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   116   5e-26
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   118   5e-26
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   118   5e-26
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   117   5e-26
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   117   5e-26
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   114   5e-26
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   115   5e-26
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   118   5e-26
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   117   6e-26
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   117   6e-26
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   116   7e-26
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    117   7e-26
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   114   7e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   115   7e-26
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   114   7e-26
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   115   7e-26
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   117   8e-26
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   115   8e-26
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   114   8e-26
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   115   9e-26
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   112   9e-26
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            115   1e-25
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   117   1e-25
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   116   1e-25
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   116   1e-25
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   115   1e-25
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   114   1e-25
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   116   1e-25
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   115   1e-25
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   116   1e-25
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   114   1e-25
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   115   1e-25
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   115   1e-25
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   116   1e-25
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   116   1e-25
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   116   2e-25
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   116   2e-25
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   116   2e-25
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   116   2e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   114   2e-25
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   116   2e-25
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   109   2e-25
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   116   2e-25
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   116   2e-25
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   113   2e-25
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   115   2e-25
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   113   2e-25
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   115   2e-25
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   113   2e-25
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   115   2e-25
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   115   2e-25
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   115   2e-25
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   115   2e-25
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   115   2e-25
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   115   2e-25
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   113   2e-25
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   115   3e-25
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   115   3e-25
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   110   3e-25
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   113   3e-25
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   115   3e-25
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   113   3e-25
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   115   3e-25
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   114   3e-25
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   115   3e-25
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   115   3e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   114   4e-25
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   114   4e-25
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   115   4e-25
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   111   4e-25
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   112   4e-25
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   108   4e-25
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   114   5e-25
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   114   5e-25
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   114   5e-25
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   114   5e-25
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   108   5e-25
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   110   5e-25
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   111   5e-25
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   114   5e-25
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   114   5e-25
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      114   6e-25
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   114   6e-25
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   112   6e-25
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   114   6e-25
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   112   7e-25
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   114   7e-25
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   114   7e-25
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   114   8e-25
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   113   8e-25
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   114   8e-25
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              112   8e-25
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   114   8e-25
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   113   9e-25
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   114   9e-25
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   108   1e-24
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   113   1e-24
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   114   1e-24
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   111   1e-24
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   110   1e-24
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   108   1e-24
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   110   1e-24
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   113   1e-24
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   113   1e-24
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   111   1e-24
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...   107   1e-24
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   110   1e-24
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...   107   2e-24
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   111   2e-24
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   113   2e-24
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   107   2e-24
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   112   2e-24
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   112   2e-24
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   110   2e-24
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    112   2e-24
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   112   2e-24
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   112   2e-24
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   110   2e-24
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   112   2e-24
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   110   3e-24
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   110   3e-24
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   112   3e-24
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   112   3e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   110   3e-24
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   112   3e-24
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   110   3e-24
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   112   3e-24
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   110   4e-24
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   111   4e-24
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   111   4e-24
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   109   4e-24
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   111   5e-24
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   109   5e-24
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   110   5e-24
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   108   5e-24
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   106   5e-24
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...   105   6e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   110   6e-24
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   111   6e-24
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...   105   7e-24
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   109   7e-24
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   106   7e-24
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   110   8e-24
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   110   9e-24
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   108   9e-24
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   110   9e-24
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   110   9e-24
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   109   1e-23
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...   103   1e-23
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   110   1e-23
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...   110   1e-23
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   109   1e-23
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   104   1e-23
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   108   1e-23
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    105   1e-23
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   110   1e-23
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...   104   1e-23
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   109   1e-23
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   108   1e-23
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   108   1e-23
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   105   1e-23
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   109   1e-23
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   109   2e-23
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   108   2e-23
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              108   2e-23
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   107   2e-23
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   109   2e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   108   2e-23
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   108   2e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   109   2e-23
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   106   2e-23
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    107   2e-23
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...   108   2e-23
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...   105   3e-23
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   108   3e-23
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   104   3e-23
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   108   3e-23
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   107   3e-23
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   107   3e-23
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...   104   3e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   106   3e-23
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   108   3e-23
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   106   3e-23
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   107   4e-23
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...   103   4e-23
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...   102   4e-23
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...   107   4e-23
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   106   4e-23
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   107   4e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   108   4e-23
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   106   4e-23
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   108   5e-23
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...   103   5e-23
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   107   5e-23
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   106   5e-23
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   107   6e-23
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...   102   6e-23
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   103   7e-23
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   105   7e-23
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   107   7e-23
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   102   7e-23
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...   102   7e-23
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    107   7e-23
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...   102   7e-23
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   105   7e-23
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180      107   7e-23
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   107   8e-23
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   105   8e-23
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   105   8e-23
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   107   8e-23
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              106   8e-23
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...   101   9e-23
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   107   1e-22
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   106   1e-22
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   106   1e-22
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   106   1e-22
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   106   1e-22
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   106   1e-22
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   105   1e-22
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...   106   1e-22
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   105   1e-22
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   102   1e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   104   2e-22
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   105   2e-22
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...   106   2e-22
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...   100   2e-22
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   103   2e-22
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   104   2e-22
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   105   2e-22
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   104   2e-22
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   102   2e-22
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....   100   2e-22
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...   100   2e-22
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   103   2e-22
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   105   2e-22
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   103   2e-22
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...   103   3e-22
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   105   3e-22
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...   105   3e-22
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   103   3e-22
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...   100   3e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   103   3e-22
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...   103   3e-22
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   101   3e-22
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...   101   3e-22
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...   103   3e-22
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...   101   4e-22
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...   100   4e-22
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...   105   4e-22
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...   104   4e-22
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             100   4e-22
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   104   4e-22
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...   101   4e-22
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   102   4e-22
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   105   4e-22
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   100   5e-22
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   102   5e-22
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   103   5e-22
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   103   5e-22
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   103   5e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   104   5e-22
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...   102   6e-22
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   104   6e-22
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   104   6e-22
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...   103   6e-22
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   104   6e-22
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    98   6e-22
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   104   6e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   102   7e-22
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...   103   8e-22
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...   100   8e-22
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   103   8e-22
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   103   9e-22
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   102   9e-22
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   101   1e-21
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   101   1e-21
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...   100   1e-21
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   103   1e-21
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...   102   1e-21
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...   103   1e-21
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...   100   1e-21
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...   102   1e-21
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...   101   1e-21
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   102   1e-21
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...   102   1e-21
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...   101   1e-21
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   103   1e-21
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...   102   1e-21
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...   101   1e-21
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    99   1e-21
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...   103   1e-21
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...   103   1e-21
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...   101   1e-21
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   101   1e-21
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...   102   1e-21
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...   102   2e-21
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...   102   2e-21
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    99   2e-21
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    99   2e-21
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...   103   2e-21
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...   102   2e-21
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...   101   2e-21
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...   102   2e-21
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   100   2e-21
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    98   2e-21
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   102   2e-21
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    97   2e-21
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    98   3e-21
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...   100   3e-21
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    95   3e-21
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   102   3e-21
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    97   3e-21
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   101   3e-21
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   101   3e-21
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...   100   4e-21
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...   100   4e-21
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   101   4e-21
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    97   4e-21
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    98   4e-21
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   101   4e-21
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   101   5e-21
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   101   5e-21
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...   100   5e-21
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    97   5e-21
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...   100   6e-21
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    98   6e-21
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...   100   6e-21
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    96   6e-21
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...   100   6e-21
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    99   6e-21
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...   100   7e-21
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...   100   7e-21
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...   100   7e-21
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...   100   7e-21
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    99   7e-21
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    99   8e-21
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    99   8e-21
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    99   8e-21
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...   100   8e-21
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...   101   9e-21
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...   100   9e-21
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    97   9e-21
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...   100   1e-20
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...   100   1e-20
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    99   1e-20
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    97   1e-20
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    97   1e-20
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    98   1e-20
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...   100   1e-20
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    99   1e-20
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    99   1e-20
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   100   1e-20
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    98   1e-20
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    99   1e-20
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    97   1e-20
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    97   1e-20
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    99   1e-20
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    98   1e-20
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    99   1e-20
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...   100   1e-20
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    99   2e-20
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    97   2e-20
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    99   2e-20
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      99   2e-20
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    96   2e-20
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...   100   2e-20
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    99   2e-20
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    99   2e-20
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    99   2e-20
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     99   2e-20
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    98   2e-20
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    99   2e-20
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    99   2e-20
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    98   2e-20
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    99   2e-20
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    95   2e-20
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    98   2e-20
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    99   2e-20
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    98   3e-20
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    98   3e-20
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    99   3e-20
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    99   3e-20
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    98   3e-20
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...   100   3e-20
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    99   3e-20
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    99   3e-20
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    99   3e-20
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    99   3e-20
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    99   3e-20
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    99   3e-20
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    98   3e-20
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    94   3e-20
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    97   4e-20
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    98   4e-20
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    94   4e-20
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    98   4e-20
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    94   4e-20
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        97   4e-20
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    97   4e-20
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    99   4e-20
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    99   4e-20
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    97   4e-20
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    98   5e-20
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     96   5e-20
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    94   5e-20
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    99   5e-20
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     97   5e-20
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    97   5e-20
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    98   5e-20
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    99   5e-20
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    97   6e-20
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    99   6e-20
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    98   6e-20
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    97   6e-20
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    99   6e-20
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    95   6e-20
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    95   7e-20
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    96   7e-20
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    97   7e-20
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    97   8e-20
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    97   8e-20
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    93   8e-20
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    98   9e-20
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    97   9e-20
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    97   9e-20
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    96   9e-20
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    96   9e-20
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    97   1e-19
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    96   1e-19
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    97   1e-19
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    97   1e-19
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    94   1e-19
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    96   1e-19
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    96   1e-19
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    97   1e-19
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    94   1e-19
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    96   1e-19
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    96   1e-19
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    95   1e-19
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    96   1e-19
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    96   1e-19
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    94   1e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    97   1e-19
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    96   2e-19
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    96   2e-19
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    94   2e-19
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    95   2e-19
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    97   2e-19
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    96   2e-19
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    96   2e-19
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    93   2e-19
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    96   2e-19
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    95   2e-19
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    95   2e-19
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    97   2e-19
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    94   2e-19
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    96   3e-19
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    96   3e-19
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    96   3e-19
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    96   3e-19
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    96   3e-19
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    94   3e-19
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    96   3e-19
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    95   3e-19
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    95   3e-19
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    96   3e-19
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    95   3e-19
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    94   3e-19
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    94   3e-19
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    94   4e-19
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    96   4e-19
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    96   4e-19
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    94   4e-19
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    94   4e-19
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    96   4e-19
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    96   4e-19
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    95   5e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    94   5e-19
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    95   5e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    94   5e-19
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    94   5e-19
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    95   5e-19
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    96   5e-19
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    90   5e-19
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    92   5e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    93   6e-19
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    93   6e-19
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    93   6e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    94   6e-19
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    94   6e-19
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    94   6e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    94   7e-19
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    93   7e-19
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    94   7e-19
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    94   8e-19
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    94   8e-19
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    91   8e-19
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    93   1e-18
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     91   1e-18
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              94   1e-18
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               94   1e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    94   1e-18
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     91   1e-18
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    91   1e-18
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    93   1e-18
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    92   1e-18
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    94   1e-18
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    93   1e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    94   1e-18
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    93   1e-18
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    92   1e-18
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    94   1e-18
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    91   1e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    93   2e-18
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    93   2e-18
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    91   2e-18
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    93   2e-18
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    92   2e-18
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    92   2e-18
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    92   2e-18
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    93   2e-18
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    94   2e-18
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    94   2e-18
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    92   2e-18
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    90   2e-18
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    92   2e-18
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    93   2e-18
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    90   2e-18
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    92   2e-18
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    91   2e-18
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             92   3e-18
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    92   3e-18
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    92   3e-18
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    91   3e-18
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               92   3e-18
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    92   3e-18
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    92   3e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    92   3e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    93   3e-18
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    92   3e-18
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    91   4e-18
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    89   4e-18
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    91   4e-18
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    92   4e-18
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    92   4e-18
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    89   4e-18
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    92   5e-18
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    91   5e-18
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    92   5e-18
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    91   5e-18
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    90   5e-18
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    91   5e-18
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    92   5e-18
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    92   6e-18
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    90   6e-18
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    89   6e-18
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    91   6e-18
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    92   6e-18
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    92   7e-18
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    89   7e-18
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    89   7e-18
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      91   7e-18
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    92   8e-18
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    92   8e-18
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    89   9e-18
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    91   9e-18
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    91   9e-18
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    90   9e-18
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    91   1e-17
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    91   1e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    91   1e-17
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    90   1e-17
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    91   1e-17
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    91   1e-17
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    91   1e-17
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    91   1e-17
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    90   1e-17
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    90   1e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    90   1e-17
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    90   1e-17
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    89   2e-17
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     89   2e-17
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    89   2e-17
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    90   2e-17
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    88   2e-17
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              89   2e-17
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    90   2e-17
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    89   2e-17
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    90   2e-17
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    89   2e-17
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    90   2e-17
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    89   2e-17
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    90   2e-17
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    90   2e-17
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    87   2e-17
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    87   2e-17
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    89   2e-17
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    87   2e-17
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    88   3e-17
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    88   3e-17
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    89   3e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    88   3e-17
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    87   3e-17
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    89   3e-17
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    88   3e-17
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    88   3e-17
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    88   3e-17
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    87   3e-17
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    89   3e-17
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    86   3e-17
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    89   4e-17
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    88   4e-17
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    89   4e-17
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    87   4e-17
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    89   4e-17
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    88   4e-17
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    87   4e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    87   4e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    87   4e-17
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    88   4e-17
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    87   5e-17
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    87   5e-17
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    88   5e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    87   5e-17
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    88   6e-17
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    88   6e-17
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      88   6e-17
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    88   6e-17
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    88   6e-17
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    88   6e-17
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    88   7e-17
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    87   7e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    87   7e-17
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    87   8e-17
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    86   8e-17
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    88   8e-17
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    87   8e-17
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    86   9e-17
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    87   9e-17
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    88   9e-17
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    87   9e-17
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    87   9e-17
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    88   9e-17
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    85   1e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    84   1e-16
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    88   1e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   1e-16
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    87   1e-16
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    86   1e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    87   1e-16
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    87   1e-16
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    87   1e-16
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    83   1e-16
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    85   1e-16
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    87   2e-16
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    84   2e-16
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    86   2e-16
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    86   2e-16
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    83   2e-16
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              87   2e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    86   2e-16
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    86   2e-16
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    84   2e-16
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    84   2e-16
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    86   2e-16
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    84   2e-16
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    86   2e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    86   2e-16
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    84   2e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    84   2e-16
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    85   3e-16
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    84   3e-16
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    86   3e-16
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    86   3e-16
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    86   3e-16
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    84   3e-16
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    84   3e-16
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    84   3e-16
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      86   3e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    85   3e-16
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    84   4e-16
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    86   4e-16
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     84   4e-16
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    86   4e-16
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    85   5e-16
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    86   5e-16
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    85   5e-16
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    86   5e-16
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    84   5e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    85   6e-16
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    85   6e-16
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    85   6e-16
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    84   6e-16
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    84   6e-16
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     85   7e-16
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    82   7e-16
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    84   7e-16
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    84   7e-16
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    84   8e-16
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    82   8e-16
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    83   8e-16
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    84   8e-16
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    84   8e-16
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    85   9e-16
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    84   9e-16
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    84   9e-16
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    82   9e-16
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    84   1e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    82   1e-15
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    84   1e-15
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    84   1e-15
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    82   1e-15
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    82   1e-15
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    84   1e-15
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    85   1e-15
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    83   1e-15
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    84   1e-15
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    82   1e-15
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    84   1e-15
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    84   1e-15
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    84   1e-15
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    84   1e-15
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    84   1e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    83   1e-15
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    83   2e-15
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    83   2e-15
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    82   2e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    81   2e-15
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    84   2e-15
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    84   2e-15
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    81   2e-15
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    83   2e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    82   2e-15
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    83   2e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    81   2e-15
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    83   2e-15
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    80   2e-15
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    83   2e-15
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    80   2e-15
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    83   2e-15
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    83   3e-15
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    83   3e-15
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    83   3e-15
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    83   3e-15
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    83   3e-15
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    83   3e-15
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    83   3e-15
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    82   3e-15
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    82   3e-15
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    80   3e-15
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    82   3e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     82   3e-15
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    82   3e-15
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    83   3e-15
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    82   3e-15
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    80   4e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    82   4e-15
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    82   4e-15
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    80   4e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    80   4e-15
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    82   4e-15
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    80   4e-15
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    82   4e-15
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    82   4e-15
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    82   4e-15
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    80   5e-15
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    82   5e-15
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    80   5e-15
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    82   5e-15
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    82   5e-15
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    80   5e-15
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     82   6e-15
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    79   6e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     82   6e-15
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    81   6e-15
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    82   6e-15
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    82   6e-15
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    80   6e-15
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    81   6e-15
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    82   6e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    78   6e-15
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    80   7e-15
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    82   7e-15
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    80   7e-15
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               81   7e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    81   7e-15
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    81   7e-15
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    80   8e-15
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    79   8e-15
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    81   8e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    79   9e-15
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    81   9e-15
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    79   1e-14
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    80   1e-14
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    80   1e-14
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    80   1e-14
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    80   1e-14
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    79   1e-14
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    80   1e-14
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    79   1e-14
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    81   1e-14
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    79   1e-14
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    80   1e-14
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    80   1e-14
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    80   1e-14
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    79   1e-14
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    79   1e-14
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               79   1e-14
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    80   2e-14
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    79   2e-14
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    79   2e-14
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      80   2e-14
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    79   2e-14
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    80   2e-14
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    78   2e-14
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    78   2e-14
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    78   2e-14
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    78   2e-14
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    79   2e-14
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    79   2e-14
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    79   2e-14
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    80   3e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    79   3e-14
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    79   3e-14
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    80   3e-14
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    79   3e-14
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    78   3e-14
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    79   3e-14
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    77   3e-14
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    79   4e-14
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    77   4e-14
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    77   4e-14
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    79   4e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   4e-14
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    77   5e-14
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    77   5e-14
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    79   5e-14
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    79   5e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    79   5e-14
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    77   6e-14
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    79   6e-14
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    78   7e-14
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              78   7e-14
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    78   8e-14
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    76   8e-14
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    78   8e-14
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    77   9e-14
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    77   9e-14
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    78   1e-13
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    77   1e-13
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    77   1e-13
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    76   1e-13
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    77   1e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    77   1e-13
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    77   1e-13
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    76   1e-13
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    76   1e-13
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    76   1e-13
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    77   1e-13
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    77   1e-13
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    77   1e-13
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    77   1e-13
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    77   1e-13
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    77   1e-13
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    75   1e-13
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    75   2e-13
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    76   2e-13
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    75   2e-13
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    76   2e-13
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    77   2e-13
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    77   2e-13
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    75   2e-13
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    76   2e-13
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    77   2e-13
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    75   2e-13
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    76   2e-13
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    77   2e-13
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    76   2e-13
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    77   2e-13
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    77   2e-13
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    77   3e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   3e-13
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    75   3e-13
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    74   3e-13
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             75   3e-13
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    75   3e-13
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    75   3e-13
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    75   3e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    74   3e-13
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    75   3e-13
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               76   4e-13
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    75   4e-13
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    74   4e-13
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    75   4e-13
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    75   5e-13
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    74   5e-13
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    75   5e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    74   6e-13
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    74   6e-13
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    75   6e-13
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    74   6e-13
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    75   6e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    75   6e-13
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    75   6e-13
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    75   6e-13
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    75   7e-13
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    75   7e-13
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    75   7e-13
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    75   7e-13
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    75   8e-13
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    75   9e-13
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    74   9e-13
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    75   1e-12
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    74   1e-12
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    73   1e-12
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    74   1e-12
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    73   1e-12
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    74   1e-12
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    74   1e-12
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    74   2e-12
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    74   2e-12
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    72   2e-12
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    74   2e-12
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    74   2e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    74   2e-12
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    74   2e-12
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    73   2e-12
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    72   2e-12
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    72   2e-12
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    74   2e-12
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    73   2e-12
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    73   2e-12
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    73   2e-12
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     73   2e-12
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    73   2e-12
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    72   2e-12
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    73   3e-12
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    73   3e-12
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    72   3e-12
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     73   3e-12
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    73   3e-12
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    73   3e-12
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    73   3e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    73   3e-12
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    73   3e-12
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    71   3e-12
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    73   3e-12
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    71   3e-12
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    72   4e-12
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    72   4e-12
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    72   4e-12
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    72   4e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     72   5e-12
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    72   5e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    70   5e-12
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    72   5e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    71   5e-12
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    72   6e-12
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    72   6e-12
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    71   6e-12
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    72   6e-12
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    71   7e-12
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    72   8e-12
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    72   8e-12
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    72   8e-12
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    71   9e-12
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    71   9e-12
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    71   1e-11
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    69   1e-11
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    71   1e-11
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    71   1e-11
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    71   1e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    70   1e-11
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    70   1e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    69   2e-11
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    70   2e-11
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    70   2e-11
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    70   2e-11
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    70   2e-11
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    70   2e-11
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    70   2e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   2e-11
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    70   2e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    69   2e-11
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    70   2e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       70   3e-11
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    69   3e-11
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    70   3e-11
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    70   3e-11
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    70   3e-11
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    70   3e-11
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    69   3e-11
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    69   3e-11
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    70   4e-11
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    69   4e-11
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    69   4e-11
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    69   4e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     69   4e-11
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    69   4e-11
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    69   5e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    69   5e-11
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    69   6e-11
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    69   6e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    68   8e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               67   8e-11
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    69   8e-11
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    69   8e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   1e-10
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    67   1e-10
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    68   1e-10
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    68   1e-10
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    68   1e-10
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    67   1e-10
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    68   1e-10
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    67   2e-10
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    67   2e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    67   2e-10
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    67   2e-10
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    67   2e-10
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    67   2e-10
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    67   2e-10
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    67   2e-10
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    67   2e-10
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    67   3e-10
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    67   3e-10
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    66   3e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    65   3e-10
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    66   3e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    65   3e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    65   3e-10
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    66   3e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    65   4e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    66   4e-10
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    66   4e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    65   4e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    66   4e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    65   4e-10
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    66   5e-10
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    66   5e-10
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    65   5e-10
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    65   5e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    65   5e-10
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    65   5e-10
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    65   5e-10
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    65   6e-10
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    65   6e-10
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    65   6e-10
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    65   6e-10
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    65   6e-10
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    64   7e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    65   7e-10
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    65   7e-10
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    65   9e-10
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    64   1e-09
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    65   1e-09
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    65   1e-09
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    64   1e-09
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    64   1e-09
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    65   1e-09
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    64   1e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    64   1e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    64   2e-09
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    64   2e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    63   2e-09
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    64   2e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    63   2e-09
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    64   2e-09
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    64   2e-09
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    63   3e-09
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    63   3e-09
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    63   3e-09
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    63   3e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   3e-09
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    63   4e-09
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    63   4e-09
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    62   4e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   4e-09
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    63   5e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    62   5e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    61   5e-09
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    62   7e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    62   7e-09
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    62   7e-09
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    61   7e-09
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    62   7e-09
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    62   8e-09
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    62   8e-09
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    62   8e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    61   8e-09
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    62   8e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    62   8e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    62   8e-09
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    60   9e-09
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    60   9e-09
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    62   1e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    60   1e-08
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    60   1e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    60   1e-08
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    61   1e-08
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    61   2e-08
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    60   2e-08
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    60   2e-08
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    60   2e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    60   2e-08
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               60   2e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    60   2e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    60   2e-08
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    60   3e-08
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    60   3e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    59   3e-08
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    60   3e-08
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    59   4e-08
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    60   4e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    59   4e-08
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    59   4e-08
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    59   4e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    59   5e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    58   6e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    59   7e-08
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    59   7e-08
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    58   8e-08
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    58   1e-07
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    58   1e-07
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    57   1e-07
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    57   1e-07
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               58   1e-07
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    57   2e-07
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    56   2e-07
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    57   3e-07
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    57   3e-07
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    56   4e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    56   5e-07
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    55   8e-07
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    55   9e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    55   1e-06
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    55   1e-06
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    55   1e-06
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    54   1e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    54   2e-06
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    54   3e-06
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    54   3e-06
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    53   3e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    53   3e-06
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    52   3e-06
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    53   5e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    53   5e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    53   5e-06
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    53   5e-06
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    52   5e-06
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    53   5e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    52   7e-06
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    51   8e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    51   8e-06
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    52   9e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    52   1e-05
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    51   1e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    51   1e-05
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    50   2e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    50   2e-05
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    50   2e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    51   2e-05
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    50   3e-05
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    50   3e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    49   3e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   3e-05
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    49   5e-05
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    49   5e-05
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     49   6e-05
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    49   7e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    49   7e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    49   7e-05
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    49   7e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    48   8e-05
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    49   1e-04
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    48   1e-04
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    49   1e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    48   1e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    48   1e-04
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    47   1e-04
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    48   1e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    48   2e-04
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    48   2e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    47   2e-04
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    45   2e-04
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    47   2e-04
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    47   3e-04
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    47   3e-04
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    47   3e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    47   3e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    46   3e-04
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    47   3e-04
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    45   3e-04
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    46   5e-04
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    45   5e-04
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     46   6e-04
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    46   6e-04
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    46   6e-04
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    46   6e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    46   6e-04
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    46   7e-04
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    45   9e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    45   0.001
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    45   0.001
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    44   0.002
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    44   0.002
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    44   0.002
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    44   0.002
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    44   0.003
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    44   0.003
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.003
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    43   0.003
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     43   0.004
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    44   0.004
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    43   0.004
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    43   0.004
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    43   0.005
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    43   0.005
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    43   0.005
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    43   0.006
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    42   0.007
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    42   0.008
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    42   0.008
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    42   0.008
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    42   0.009
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.009
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.009
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    42   0.009
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    42   0.010
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    42   0.010
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    42   0.011
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    40   0.011
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    42   0.011
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    41   0.012
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    41   0.012
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    42   0.012
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    42   0.012
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    42   0.013
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    41   0.014
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    41   0.016
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    41   0.016
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    41   0.017
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    41   0.017
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    41   0.020
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    41   0.021
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    41   0.021
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    40   0.023
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    40   0.024
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    40   0.024
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    40   0.026
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    40   0.028
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    40   0.029
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    40   0.034
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    40   0.037
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    40   0.037
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    40   0.040
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    40   0.040
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    40   0.042
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    40   0.042
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    40   0.045
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     40   0.045
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    40   0.046
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    40   0.046
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    40   0.048
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    39   0.052
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    40   0.052
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    39   0.058
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    39   0.064
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    39   0.069
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    39   0.073
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    39   0.078
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    39   0.079
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.083
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.086
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.091
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    39   0.094
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    39   0.10 
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    38   0.12 
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    38   0.12 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    38   0.12 
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    38   0.13 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    38   0.13 
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    38   0.13 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    38   0.14 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    38   0.15 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    38   0.17 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    38   0.17 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     38   0.17 
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    38   0.18 
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    38   0.18 
NCAS0D03690 Chr4 (688360..690804) [2445 bp, 814 aa] {ON} Anc_6.1...    38   0.19 
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    37   0.20 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    38   0.21 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    37   0.22 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    37   0.22 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    37   0.22 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    37   0.24 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    37   0.25 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    37   0.25 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    37   0.26 
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    37   0.34 
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    37   0.34 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    37   0.35 
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    37   0.39 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.43 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    36   0.45 
Skud_7.199 Chr7 (356300..358714) [2415 bp, 804 aa] {ON} YGL083W ...    36   0.60 
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    36   0.66 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    36   0.70 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    35   0.97 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    35   0.99 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   1.0  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    35   1.1  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    35   1.1  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    35   1.3  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    35   1.6  
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    34   1.9  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    34   2.0  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    34   2.0  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    34   2.5  
ADR360W Chr4 (1343587..1345770) [2184 bp, 727 aa] {ON} Syntenic ...    34   2.8  
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    34   3.2  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   3.6  
SAKL0H21648g Chr8 (1892798..1894882) [2085 bp, 694 aa] {ON} weak...    33   3.7  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    32   9.1  

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score = 2103 bits (5449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1042/1117 (93%), Positives = 1042/1117 (93%)

Query: 1    MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQ 60
            MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQ
Sbjct: 1    MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQ 60

Query: 61   SSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120
            SSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE
Sbjct: 61   SSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120

Query: 121  KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 180
            KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED
Sbjct: 121  KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 180

Query: 181  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240
            KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK
Sbjct: 181  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240

Query: 241  VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL 300
            VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL
Sbjct: 241  VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL 300

Query: 301  PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
            PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK
Sbjct: 301  PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360

Query: 361  IDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLS 420
            IDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLS
Sbjct: 361  IDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLS 420

Query: 421  SVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQS 480
            SVVHNNL            KKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQS
Sbjct: 421  SVVHNNLSASSSTTTTPASKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQS 480

Query: 481  ILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATL 540
            IL              VMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATL
Sbjct: 481  ILSKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATL 540

Query: 541  IDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQLQLQ 600
            IDEIFEHEKYEQIRKEKEELA                                AQQLQLQ
Sbjct: 541  IDEIFEHEKYEQIRKEKEELARKVRLAKEREEEERRRREEEELHKLNEEKKFEAQQLQLQ 600

Query: 601  RQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVNDNLLRQRNFSLQTRPISR 660
            RQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVNDNLLRQRNFSLQTRPISR
Sbjct: 601  RQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVNDNLLRQRNFSLQTRPISR 660

Query: 661  LDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAAEK 720
            LDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAAEK
Sbjct: 661  LDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAAEK 720

Query: 721  RVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSN 780
            RVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSN
Sbjct: 721  RVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSN 780

Query: 781  RRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGN 840
            RRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGN
Sbjct: 781  RRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGN 840

Query: 841  SSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKAGL 900
            SSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKAGL
Sbjct: 841  SSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKAGL 900

Query: 901  GIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQK 960
            GIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQK
Sbjct: 901  GIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQK 960

Query: 961  TRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLV 1020
            TRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSV                 AETEKVLV
Sbjct: 961  TRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVSFFRKFSGSSISSNKSKAETEKVLV 1020

Query: 1021 TNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSN 1080
            TNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSN
Sbjct: 1021 TNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSN 1080

Query: 1081 GESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLLP 1117
            GESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLLP
Sbjct: 1081 GESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLLP 1117

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1195 bits (3091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/1164 (57%), Positives = 804/1164 (69%), Gaps = 96/1164 (8%)

Query: 5    NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
            N++ +IK + +GPWKLGETLGLGSTGKVQLA NK+TG++AA+KVISK+VFN+ +   +S+
Sbjct: 6    NSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSI 65

Query: 65   T---TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEK 121
                TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYAEKGELFNLLVE+
Sbjct: 66   VGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125

Query: 122  GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 181
            GPL E EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE K
Sbjct: 126  GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK 185

Query: 182  LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 241
            LLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFDEEDGNIR LLLKV
Sbjct: 186  LLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKV 245

Query: 242  QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLP 301
            Q GEFE+PSDDEIS EAQDL++KILTVDPE+RI+ARDILKHPLLQKYPSI+DSKSIR+LP
Sbjct: 246  QKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLP 305

Query: 302  REDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKI 361
            REDTYL PLS++NS+ID TILQNLV+LWHGRD + I +KL+EPGANAEKTLYALL RFK 
Sbjct: 306  REDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKC 365

Query: 362  DSEKENFKNEQIRKRQSITSSVSRSPAKKAST-PQRRKNRISMISVSSSHKKPASFNRLS 420
            D++KE  K +QIRKRQSI  SVS SP K+ ST PQRR+NR S+ISVSSS KKP SFN+ +
Sbjct: 366  DTQKELIKQQQIRKRQSI-GSVSISPPKRTSTTPQRRRNRESIISVSSSRKKPISFNKFT 424

Query: 421  SVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTD--- 477
            +   ++             K FS  KKLS I      N SSPTP+ RNKRTS+ N D   
Sbjct: 425  ASSASSSNLTTPGSSKRLSKNFSSKKKLSTIV-----NQSSPTPSSRNKRTSIANVDKNQ 479

Query: 478  -RQSILXXXXXXXXXXXXXXVMA---NMKRGSITTKLIATYAKLSEDDDWEYIEKETKRT 533
             R SI                M+   +MKR S+TTKL++TYAKL+EDDDWEYIEKETKRT
Sbjct: 480  KRASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRT 539

Query: 534  SSDFATLIDEIFEHEKYEQIRKEKEEL---AXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 590
            SS+FATLIDEIFE+EKY+QIRKEKEEL                                 
Sbjct: 540  SSNFATLIDEIFEYEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEKERARKLLEKE 599

Query: 591  XXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVN-------- 642
                +Q +L++Q+D +I +L  +L   +   +EK E N RS+S P+  E  N        
Sbjct: 600  ELKRKQEELKKQIDIDISDLEHEL---INHREEKFEGNIRSISAPMENEENNINHLEADI 656

Query: 643  DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTE-EKPISPDEPVPNKKLDTEKMILETIRR 701
            DN+LR+RNFSLQTRP+SRLDPG+ FS  SP E E P+ P +   N++L TEK ILETIRR
Sbjct: 657  DNILRRRNFSLQTRPVSRLDPGIIFS--SPIETEDPVEPKK-AENERLTTEKKILETIRR 713

Query: 702  SKFLGSSFDINRELKAAEKRVMQPPTVQKLTTENKSSDE--------LPKHAVGTAALNS 753
            SKFLGSSF+I++ELK ++         Q+L+ E   SD         LPK A G A L  
Sbjct: 714  SKFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSDSNGKYESLVLPKDAKGVAHLKD 773

Query: 754  STA----------EVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILK 803
            +TA          E+ KISDIRVPQFTRKSRHF+ SN+RLSVLSMYST++SF+NLVDILK
Sbjct: 774  NTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILK 833

Query: 804  NT--EAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSG 861
            N   +   +  QR PTP SA DSEF+FETVNEEAEYTGNSSND++LY+V D    +K + 
Sbjct: 834  NGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSCIKDKNT- 892

Query: 862  MKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKAGLGIYQTSSPIEPQLLERPVKGD 921
            +KLNFADRFN     ST         LP LPPL+GK   G  Q     +  L E+P    
Sbjct: 893  LKLNFADRFN----GSTNEKETKNLHLPTLPPLNGKDEAG-KQGEEQEKEDLHEQP---- 943

Query: 922  KFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEV-QKTRKDQEH---DKRPVMEKKP 977
                           ++KSMIPE+      ++S  E  QK R+DQ+    D  P + K  
Sbjct: 944  ---------------KVKSMIPES-----DSLSHAEKEQKEREDQQRGGKDLEPPLNKSV 983

Query: 978  EVVAPKQRESDQEKKRSV------XXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDG 1031
            +    K  ++ Q K +S                        +E    L   ++A+Q+F+G
Sbjct: 984  QKTREKNNDT-QAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTELYAKVSAKQLFNG 1042

Query: 1032 LRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKK 1091
            L +LL GW++YGLKNV+S  + +T++GKLSS+N+ SLRST FE+ +   G+ S V  +K 
Sbjct: 1043 LEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKKI 1102

Query: 1092 SGSSKAVLRLTTEIENIFSKEGVL 1115
            SGS K V +L  E+EN+ +KEGVL
Sbjct: 1103 SGSFKTVKKLVKEVENVLNKEGVL 1126

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1183 bits (3061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/1178 (56%), Positives = 801/1178 (67%), Gaps = 110/1178 (9%)

Query: 5    NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
            N++P+IK + +GPWKLGETLGLGSTGKVQLA N +TG++AA+KVISK+VFN  +   +S+
Sbjct: 6    NSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSI 65

Query: 65   ---TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEK 121
               TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYAEKGELFNLLVE+
Sbjct: 66   VGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125

Query: 122  GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 181
            GPL E EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE K
Sbjct: 126  GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK 185

Query: 182  LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 241
            LLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFDEEDGNIR LLLKV
Sbjct: 186  LLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKV 245

Query: 242  QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLP 301
            Q GEFEMPSDDEIS EAQDL+ KILTVDPE+RI+ RDILKHPLLQKYPSI+DSKSIR LP
Sbjct: 246  QKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLP 305

Query: 302  REDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKI 361
            REDTYL PLS++NS+ID TILQNLV+LWHGRD   I  KL+EPGANAEKTLYALL RFK 
Sbjct: 306  REDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKC 365

Query: 362  DSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSS 421
            D++KE  K +Q++KRQSI+S       K ++TPQRR+NR S+ISV+SS KKP SFN+ ++
Sbjct: 366  DTQKELIKQQQVKKRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPISFNKFTA 425

Query: 422  VVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTD---- 477
               ++             K FS  KKLS I      N SSPTPA RNKR S+IN +    
Sbjct: 426  SSASSSNLTTPGSSKRLSKNFSSKKKLSTIV-----NQSSPTPASRNKRASVINVEKNQK 480

Query: 478  RQSILXXXXXXXXXXXXXXVMA---NMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTS 534
            R SI                M+   +MKR S+TTKL++TYAKL+EDDDWEYIEKETKRTS
Sbjct: 481  RASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 535  SDFATLIDEIFEHEKYEQIRKEKEEL---AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 591
            S+FATLIDEIFE+EKYEQIRKEKEEL                                  
Sbjct: 541  SNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKLLEKED 600

Query: 592  XXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVN--------D 643
               +Q +L++Q++ +I +L  +L    E   EK + N RS+S P+  E  N        D
Sbjct: 601  LKRKQEELKKQIEIDISDLEQELSKHKE---EKLDGNIRSISAPMENEEKNINHLEVDID 657

Query: 644  NLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEP--VPNKKLDTEKMILETIRR 701
            N+LR+RNFSLQTRP+SRLDPG+ FS  SPTEE  +SP EP    N++L TEK ILETIRR
Sbjct: 658  NILRRRNFSLQTRPVSRLDPGIMFS--SPTEE--VSPVEPKRTENERLTTEKKILETIRR 713

Query: 702  SKFLGSSFDINRELKAAEKRVMQPPTV---QKLTTENKSSDE--------LPKHAVGTAA 750
            SKFLGSSF+I++ELK ++   M+ P++   Q+L+ E   SD         LPK   G + 
Sbjct: 714  SKFLGSSFNIDKELKLSK---MEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQ 770

Query: 751  LNSSTAEVS--------KISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDIL 802
            L  STA  +        KIS+IRVPQFTRKSRHF+ SN+RLSVLSMYST++SF+NLVDIL
Sbjct: 771  LKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDIL 830

Query: 803  KNT--EAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPS 860
            KN   +   +  QR PTP SA DSEF+FETVNEEAEYTGNSSND++LY+V D    +K S
Sbjct: 831  KNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDK-S 889

Query: 861  GMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKAGLGIYQTSSPIEPQLLERPVKG 920
             +KLNFADRFN     S E  +     LP+LPPL+G                        
Sbjct: 890  ALKLNFADRFN----GSNEAKQTDNLHLPILPPLNG-----------------------D 922

Query: 921  DKFMETISSDNEKPEKEIKSMIPEA---------VIEEPKNVSPIEVQKTRKDQEHDKRP 971
            ++  +  S + ++   +IKSMIPE+            E K     E  K  +DQE  ++ 
Sbjct: 923  NELRKQNSQEGDQAHPKIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKV 982

Query: 972  VMEKKPEV--VAPKQRESD---QEKKRSVXXXXXXXXXXXXXXXXXAETEKV-------- 1018
            V + +P +     K RE +   Q K  S                  +   K         
Sbjct: 983  VDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFRKFSKSSDKTM 1042

Query: 1019 -LVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKV 1077
             L   I+A+Q+F+GL +LL GW++YGLKN++S  + +T++GKLSSDNI SLRST FE+ +
Sbjct: 1043 ELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNI 1102

Query: 1078 TSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
               G+ S V  +K SGS KAV +L  E+EN+ +KEGVL
Sbjct: 1103 YPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1162 (56%), Positives = 803/1162 (69%), Gaps = 84/1162 (7%)

Query: 5    NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
            N++P+IK + +GPWKLGETLGLGSTGKVQLA NK+TG++AA+KVISK+VFN  +   +S+
Sbjct: 6    NSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSI 65

Query: 65   ---TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEK 121
               TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYAEKGELFNLLVE+
Sbjct: 66   VGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVER 125

Query: 122  GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 181
            GPL E EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE K
Sbjct: 126  GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK 185

Query: 182  LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 241
            LLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFDEEDGNIR LLLKV
Sbjct: 186  LLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKV 245

Query: 242  QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLP 301
            Q GEFE+PSDDEIS EAQDL+++ILTVDPE+RI+ RDILKHPLLQKYPSIKDSKSIR LP
Sbjct: 246  QKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLP 305

Query: 302  REDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKI 361
            REDTYL PLS++NS+ID TILQNLV+LWHGRD + I  KL+E GANAEKTLYALL RFK 
Sbjct: 306  REDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYRFKC 365

Query: 362  DSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSS 421
            D++KE  K +QI+KRQSI+S       K ++TPQRRKNR SMISVSSS KKP SFN+ ++
Sbjct: 366  DTQKELVKQQQIKKRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRKKPISFNKFTA 425

Query: 422  VVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTD---- 477
               ++             K FS  KKLS I      N SSPTPA RNKR S+IN +    
Sbjct: 426  SSASSSNLTTPGSSKRLSKNFSSKKKLSTIV-----NQSSPTPASRNKRASVINIEKNQK 480

Query: 478  RQSILXXXXXXXXXXXXXXVMA---NMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTS 534
            R S+                M+   +MKR S+TTKL++TYAKL+EDDDWEYIEKETKRTS
Sbjct: 481  RASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 535  SDFATLIDEIFEHEKYEQIRKEKEEL---AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 591
            S+FATLIDEIFE+EKYEQIRKEKEEL                                  
Sbjct: 541  SNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKLLEKEE 600

Query: 592  XXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVN--------D 643
               +Q +L++Q++ +I +L  +L    E   EK + N RS+S P+  E  N        D
Sbjct: 601  LKMKQEELKKQIEMDISDLEQELSRHKE---EKPDGNIRSISAPMENEEKNIDHLGTDID 657

Query: 644  NLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEP--VPNKKLDTEKMILETIRR 701
            N+LR+RNFSLQTRP+SRLDPG+ FS  +P E   + P EP    N++L TEK ILETIRR
Sbjct: 658  NILRRRNFSLQTRPVSRLDPGIVFS--NPIE--TVYPVEPKRSENERLTTEKKILETIRR 713

Query: 702  SKFLGSSFDINRELKAAEKRVMQPPTV---QKLTTENKSSDE--------LPKHAVGTAA 750
            SKFLGSSF+I +ELK ++   M+ P+V   +KL+ E   SD         LPK A G + 
Sbjct: 714  SKFLGSSFNIEKELKLSK---MEYPSVLAPEKLSGERVVSDLNGKYESLILPKDAKGVSQ 770

Query: 751  L----NSSTAE------VSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVD 800
            L     S+T E      + KIS++RVPQFTRKSRHF+ SN+RLS+LSMYST++SF+NLVD
Sbjct: 771  LKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMYSTKESFTNLVD 830

Query: 801  ILKNT--EAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEK 858
            ILKN+  +   +  QR PTP SA DSEF+FETVNEEAEYTGNSSND++LY+V D    +K
Sbjct: 831  ILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDK 890

Query: 859  PSGMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKAGLGIYQTSSPIEPQLLERPV 918
             + +KLNFADRFN    +STE        LP LPPL G   +   +  +  E  L++  V
Sbjct: 891  -TALKLNFADRFN----ESTEYKETDNLHLPSLPPLSGDDEM---RKQNSEEDSLVQPKV 942

Query: 919  KGDKFMETISSDNEKPEKE--IKSMIPEAVIEEPKNVSP---IEVQKTRKDQEHDKRPVM 973
            K        SS  EK E++      + E   +E K++ P     VQK R     +K P  
Sbjct: 943  KSMIPQSDSSSHTEKVEEKEGESQEVQEESEKEAKDIEPPLNKSVQKLR-----EKNPGP 997

Query: 974  EKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGLR 1033
            ++K       QR+  +E K+                   ++    L   ++ARQ+F+GL 
Sbjct: 998  QEKDH-----QRDHLKEHKQDRNTTGNSSFFRKFSKSSASDKLVELYAKVSARQLFNGLE 1052

Query: 1034 RLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSG 1093
            +LL GW+++GLKN++S  + +T++GKLSS+NI SLRST FEI +   G  S V  +K SG
Sbjct: 1053 KLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMSVVQFKKISG 1112

Query: 1094 SSKAVLRLTTEIENIFSKEGVL 1115
            S KAV +L  E+EN+ +KEGVL
Sbjct: 1113 SFKAVKKLVNEVENVLNKEGVL 1134

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/1169 (55%), Positives = 799/1169 (68%), Gaps = 99/1169 (8%)

Query: 5    NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
            N++P+IK + +GPWKLGETLGLGSTGKVQLA NK+TG++AA+KVISK+VFN  +   +S+
Sbjct: 6    NSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSI 65

Query: 65   T---TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEK 121
                TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYAEKGELFNLLVE+
Sbjct: 66   VGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125

Query: 122  GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 181
            GPL E EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE K
Sbjct: 126  GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK 185

Query: 182  LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 241
            LLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFDEEDGNIR LLLKV
Sbjct: 186  LLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKV 245

Query: 242  QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLP 301
            Q G+FE+PSDDE+S EAQDL+ KILTVDP++RI+ARDILKHPLLQKYPSI+DSKSIR LP
Sbjct: 246  QKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLP 305

Query: 302  REDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKI 361
            REDTYL PLS++NS+ID TILQNLV+LWHGRD + I  KLKEPGANAEKTLYALL RFK 
Sbjct: 306  REDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKC 365

Query: 362  DSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSS 421
            D++KE  + +QI+KRQSI+S  + SP K ++TPQRRKNR S+ISV+SS KKP SFN+ ++
Sbjct: 366  DTQKELIRQQQIKKRQSISSVSTSSPNKISTTPQRRKNRESIISVTSSRKKPISFNKFTA 425

Query: 422  VVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQ-- 479
               ++             K FS  K+LS I      N +SPTPA RNKRTS+IN D+   
Sbjct: 426  SSASSSNLTTPGSSKRLSKNFSSKKRLSTIV-----NQASPTPASRNKRTSIINVDKNQR 480

Query: 480  -----SILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTS 534
                 S                ++ +MKR S+TTKL++TYAKL+ DDDWEYIEKETKRTS
Sbjct: 481  RASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540

Query: 535  SDFATLIDEIFEHEKYEQIRKEKEEL---AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 591
            S+FATLIDEIFE+EKYE+IRKEK+EL                                  
Sbjct: 541  SNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKVLEKEE 600

Query: 592  XXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVN--------D 643
               +Q +L++Q++ +I +L  +L    E   EK + N RS+S P+  E  N        D
Sbjct: 601  LKRKQQELKKQIEIDISDLEHELSKHKE---EKPDGNIRSISAPMESEEKNINHLEVDID 657

Query: 644  NLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETIRRSK 703
            N+LR+RNFSLQTRP+SRLDPG+ FS  SP E++     +   N++L TEK ILETIRRSK
Sbjct: 658  NILRRRNFSLQTRPVSRLDPGIMFS--SPVEKESAVEPKRTENERLTTEKKILETIRRSK 715

Query: 704  FLGSSFDINRELKAA--EKRVMQPPTVQKLTTENKSSDE--------LPKHAVGTAALNS 753
            FLGSSF+I +ELK +  E   M PP  Q+L+ E   SD         LPK A G + L  
Sbjct: 716  FLGSSFNIEKELKLSKMEYPSMVPP--QRLSEERIVSDPSDDYGSLVLPKDARGYSQLED 773

Query: 754  ----------STAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILK 803
                      S  E+ KIS++RVPQFTRKSRHF+ SN+RLSVLSMYS+++SF+NLVDILK
Sbjct: 774  HIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILK 833

Query: 804  N--TEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSG 861
            N   +   +  QR PTP SA DSEF+FETVNEEAEYTGNSSND++LY+V D    +K S 
Sbjct: 834  NGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDK-SA 892

Query: 862  MKLNFADRFNKKEEDSTEPSRDIQN-KLPVLPPLDGKAGLGIYQTSSPIEPQLLERPVKG 920
            +KLNFADRFN     ++   ++ +N  LP LPPL+G                       G
Sbjct: 893  LKLNFADRFN-----ASTNEKETENLHLPTLPPLNG-----------------------G 924

Query: 921  DKFMETISSDNEKPEKEIKSMIPEA---VIEEPKNVSPIEVQKTRKDQEHDKRPVMEKKP 977
            D+  +    D    + ++KSMIP++        +     + ++ R+DQE D +   + +P
Sbjct: 925  DEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKGAKDIEP 984

Query: 978  EV-----------VAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAAR 1026
             +             P+ +   +E K+                   ++    L   ++A+
Sbjct: 985  PLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGSFFRKFSKSSTSDKSVELYAKVSAK 1044

Query: 1027 QVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSV 1086
            Q+F+GL +LL GW++YGLKN++S  + +T++GKLSS+NI SLRST FEI +   G+ S V
Sbjct: 1045 QLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVV 1104

Query: 1087 LIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
              +K SG+ KAV +L  E+EN+ SKEGVL
Sbjct: 1105 QFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1153

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1180 (55%), Positives = 810/1180 (68%), Gaps = 97/1180 (8%)

Query: 1    MTASNN--LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN-NN 57
            M A +N  +P++KG+++GPWKLGETLGLGSTGKVQLA++++T +QAAIKVISK++FN   
Sbjct: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60

Query: 58   SAQSSSL--TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELF 115
            S + SS+  +TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA+KGELF
Sbjct: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120

Query: 116  NLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 175
            NLLVE+GPL E+EAIRFFRQI+IGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAA
Sbjct: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180

Query: 176  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIR 235
            LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFD+EDGNIR
Sbjct: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 236  NLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSK 295
            NLLL+VQSG +EMP DDEIS +AQDL+A+ILTVDPE+RI+ARDILKHPLLQKYPSI DSK
Sbjct: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300

Query: 296  SIRNLPREDTYLNPLSDNNST-IDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYA 354
            SIRNLPREDTYL+PLS+  S  ID+ ILQNLVVLWHGR+  EII+KL+EPGANAEKTLYA
Sbjct: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360

Query: 355  LLDRFKIDSEKENFKNEQIRKRQSITSSVSRSPAKKA-STPQ-----RRKNRISMISVSS 408
            LLDRFK D+E ++ K+ Q +KR S  + V +   KKA S PQ     +R+NR SMISVSS
Sbjct: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420

Query: 409  SHKKPASFNRLSSVVHNNL--XXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAH 466
            SHK+P SFN+LS+VV                     S NK+LS +     +N+ SPTPA 
Sbjct: 421  SHKRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVY----TNSGSPTPAS 476

Query: 467  RNKRTSMINTDRQS--------ILXXXXXXXXXXXXXXVMANM--------KRGSITTKL 510
            R+KR S+++ +R+         I                  NM        KRGSITTKL
Sbjct: 477  RHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKL 536

Query: 511  IATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXX 570
            I+TYAKLSEDDDWEYIEKETKRTSSDFATL D+IFEHEK+EQIR+EKEEL          
Sbjct: 537  ISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRETKER 596

Query: 571  XXXXXXXXXXXXXXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNED--- 627
                                    +QL++QRQMDEE+ NL  +L+G +  +Q+ +E    
Sbjct: 597  EERERREKEIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEH 656

Query: 628  ---NYRSVSVPLSKETVN---------DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEE 675
               N RSVS PL K++ +         D+LLRQR FSLQTRP+SRLDPG+F S+ S  ++
Sbjct: 657  GAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQ 716

Query: 676  KPISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQKLTTE- 734
               S D      KL+ +K+ILETIRRSKFLGSSFDIN+ELK A     +     K T++ 
Sbjct: 717  YTGSEDRA----KLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDR 772

Query: 735  --NKSSDE-----LPKHAVGTAAL--NSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSV 785
              + ++DE     LPK+A  +A L  ++  AE  KISDI+VPQFTRKSR F  SN+RLSV
Sbjct: 773  IISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSV 832

Query: 786  LSMYSTRQSFSNLVDILKNTEAGTELGQR-TPTPHSAGDSEFIFETVNEEAEYTGNSSND 844
            LSMYS++QS++NL D+L N EA    G R +P   S  + EF+FE V E+ E TG+SS+D
Sbjct: 833  LSMYSSKQSYTNLADLL-NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHD 891

Query: 845  DKLYEVADLDAAEKPSGMKLNFADRFNKKE-EDSTEPSRDIQNKLPVLPPLDGK--AGLG 901
             +LYEV + D+      +KLNFADRF     ED T   +++  +LP LPPLDGK   GLG
Sbjct: 892  GRLYEVPE-DSNMTKEKLKLNFADRFKTSNGEDRTAEDKNV--RLPTLPPLDGKEAKGLG 948

Query: 902  IYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEK--EIKSMIPEAVIEEPKNVSPI--E 957
            IYQ+SS   P+  +  VK       I +D  +P +  E+ S+  +    E +  +P+   
Sbjct: 949  IYQSSSESLPEPAQHNVKS-----MIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNAS 1003

Query: 958  VQKTRKD--QEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAET 1015
            + K R D  Q+ ++ P  E               EKKR+                   + 
Sbjct: 1004 IPKHRTDGAQKSERMPSKE-------------GSEKKRNTSFFRKFSKSSNEKTNGEFDA 1050

Query: 1016 EKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEI 1075
            E  L  ++AA+Q+F+GL+ LL GW KYGLK V+S+   +T++GKLSS+NILSLRST FE+
Sbjct: 1051 E--LYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEM 1108

Query: 1076 KVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
             V S G+ S V  RKKSGS+K + RL +EIE +  KE VL
Sbjct: 1109 VVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score = 1163 bits (3008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1163 (56%), Positives = 795/1163 (68%), Gaps = 88/1163 (7%)

Query: 1    MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQ 60
            M  +   P+IKGDQ+G WK+GETLGLGSTGKVQLA+NKTTG QAAIKVISK++F +++  
Sbjct: 1    MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT 60

Query: 61   SS-SLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
            S    TTPDALPYGIEREI+IMKLLNH NVLRLYDVWETNSNLYMVLEYAEKGELFNLLV
Sbjct: 61   SMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120

Query: 120  EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
            E+GPL E EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALETE
Sbjct: 121  ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180

Query: 180  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
            DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLL
Sbjct: 181  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240

Query: 240  KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRN 299
            KVQ+G+FEMP DDEIS EAQ+L++KIL V+P +RI ARDILKHPLLQKYPSIKDSKSIRN
Sbjct: 241  KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300

Query: 300  LPREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRF 359
            LPREDTYL+PL++ NS ID+ ILQNLVVLWHGRD  EI  KLKE GANAEKTLYA+L+RF
Sbjct: 301  LPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRF 360

Query: 360  KIDSEKENFKNEQIRKRQSITSSVSRSPAKKASTP-----------QRRKNRISMISVSS 408
            K+D E+EN KNE ++ RQS   S S +PA   ST             R+KNR S+ISV+S
Sbjct: 361  KLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTS 420

Query: 409  SHKKPASFNRLSSVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSN-NSSPTPAHR 467
            SHK+P SF +L ++  N+             ++    K+LS I+    SN N SPTPA R
Sbjct: 421  SHKRPISFQKLPTL--NSTSSLAAITPSTSARR----KRLSKISGYPVSNVNGSPTPASR 474

Query: 468  NKRTSMINTD--RQSILXXXXX---XXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDD 522
             KR SM N    R S +                 ++ N K G+I +KLI+TYAKLSEDD+
Sbjct: 475  KKRNSMANIQAARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKLISTYAKLSEDDE 534

Query: 523  WEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXX 582
            WEY+E+ETKRTSS+FATLIDEIFEHEKYEQIRKEKEELA                     
Sbjct: 535  WEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEELARKVREAKEREEAERKQKELQE 594

Query: 583  XXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSK---- 638
                        +    QR M+EEIENL+ +L  D+  ++ K E   RSVS PL+K    
Sbjct: 595  REKQRERERKENETNDRQRIMEEEIENLKKEL--DMMSHEGKTES--RSVSEPLNKKQGG 650

Query: 639  -ETVNDNLLRQRNFSLQTRPISRLDPGLFF-SEQSPTEEKPISPDEPVPNKKLDTEKMIL 696
             E     LLRQRN +LQTRP SRLDPGLFF S +S T    +   E   + KL TEK IL
Sbjct: 651  VEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAIL 710

Query: 697  ETIRRSKFLGSSFDINRELKAAEKR---VMQPPTVQKLTTENKSSDELPKHAVGTAAL-- 751
            ETIRRSKFLGSSFDI++ELK+A  R      P  V    +  + SD LPK+A+ TA L  
Sbjct: 711  ETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRI 770

Query: 752  NSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDIL----KNTEA 807
            +S   EV KISDI+VPQFTRKSR+F+ S++RLSVLSMYSTRQSF NL D++    +NT+A
Sbjct: 771  HSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDA 830

Query: 808  GTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMKLNFA 867
                GQ   TP+SAG SEF+FE+VNEEAE T N+S D KLYEV++   +    G+++N +
Sbjct: 831  AENRGQ-IATPNSAGQSEFLFESVNEEAENTNNTSTDGKLYEVSESPESSSKKGLRVNLS 889

Query: 868  DRFNKKEEDSTEPSRDIQNKLPVLPPLDGK-AGLGIYQTSSPIEPQLLERPVKGDKFMET 926
            DR+NK   ++     D++NKLP+LPPLD + AGLGIYQ     +P+ +            
Sbjct: 890  DRYNKANSEA-----DMENKLPILPPLDPEIAGLGIYQD----QPEEV------------ 928

Query: 927  ISSDNEKP-EKEIKSMIPEA--VIEEPKNVSPIEVQKTRKDQEHDKRPVMEKKPEVVAPK 983
                N KP EK+ KS   E   + E    VS ++ +  RK  +    P+ EKK ++ A K
Sbjct: 929  ----NAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQP---PITEKK-KLDAKK 980

Query: 984  QRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKV----------LVTNIAARQVFDGLR 1033
            QR +D+  K S                    T+ V          + T ++A Q++ GL 
Sbjct: 981  QR-NDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLY 1039

Query: 1034 RLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSG 1093
             LL GW  YGLK+++  S  MTI+GKL+S+NILSLRST FEI +   G+ S V I+KKSG
Sbjct: 1040 NLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSG 1099

Query: 1094 SSKAVLRLTTEIENIFSKEGVLL 1116
            S+KAV RL  E++N+  KEGV++
Sbjct: 1100 STKAVNRLAGEVKNVLVKEGVMI 1122

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/1165 (54%), Positives = 779/1165 (66%), Gaps = 116/1165 (9%)

Query: 7    LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN---NNSAQSSS 63
            +P+IKGD +GPWKLGETLGLGSTGKVQLA N+TT +QAAIK+ISKS+FN   N++  S  
Sbjct: 11   IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70

Query: 64   LTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGP 123
              TPD+LPYGIEREIIIMKLL H NVL LYDVWETNSNLYM+LEYAEKGELFNLLVEKGP
Sbjct: 71   ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130

Query: 124  LQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLL 183
            L E+EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALETEDKLL
Sbjct: 131  LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 190

Query: 184  ETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 243
            ETSCGSPHYAAPEIVSGIPYHGF SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS
Sbjct: 191  ETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250

Query: 244  GEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRE 303
            G+FEMP DDE+S +AQDL+++ILTVDP KRI+ R+ILKHPLLQKYPSIKDSKSI+NLPRE
Sbjct: 251  GQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310

Query: 304  DTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDS 363
            DTYL PLSDNNS ID +ILQNLVVLWHGRD  +I +KLKE GANAEKT+YALL RFKI++
Sbjct: 311  DTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370

Query: 364  EKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRL---- 419
            E  + K EQ++++QSI   + +S A   STP R+KNRIS +SVSSS K+P SFNRL    
Sbjct: 371  ENLSAKQEQVKRKQSI---IKKSTA-NVSTPPRKKNRISTMSVSSSRKRPVSFNRLPTIS 426

Query: 420  ----SSVVHNNLXXXXXXXXXXXXKKFSM----NKKLS--MIADKSNSNNSSPTPAHRNK 469
                ++++ N              K+ S+    NK+LS  ++   SN N++SPTP+ R+K
Sbjct: 427  NGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGNSNSPTPS-RSK 485

Query: 470  RTSMINTDRQSI-------------LXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAK 516
            R S+IN D  +                              + N KRGSITTKL++TYAK
Sbjct: 486  RISLINLDNSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNGKRGSITTKLLSTYAK 545

Query: 517  LSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXX 576
            LSEDD+WEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELA               
Sbjct: 546  LSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVREAKEGEARERR 605

Query: 577  XXXXXXXXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL 636
                              QQL+LQ  +D+EI NL+ADL  + +  +    +N RSVS PL
Sbjct: 606  EQESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKGAEPY--ENPRSVSAPL 663

Query: 637  SKET-------VNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKL 689
             +E        +ND L  +RN SLQTRP SRLDPG+ +S  + T   P+  D    ++++
Sbjct: 664  ERENPEAIERDIND-LFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSD---IDQEI 719

Query: 690  DTEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQ----KLTTENKSSDELPKHA 745
            D EK ILETIRRS+FLGSS++IN+EL+ A+K  +   + +    K+T++N  +D   K A
Sbjct: 720  DREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVAD---KAA 776

Query: 746  VGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNT 805
            +G   LN + A + KIS+I+VPQFTRKSRHF+ SNRRLSVLSMYST+QS++NL DILK  
Sbjct: 777  IGVIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILK-- 834

Query: 806  EAGTELGQR---TPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGM 862
            E G  L      T T  ++ + EF FE+VNE           +KLYE+      E+P   
Sbjct: 835  EGGVNLASEANNTTTSKASTEPEFQFESVNE--------GTANKLYEL-----QEEPEYT 881

Query: 863  KLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKA----GLGIYQTSS-----PIEPQL 913
             +N  D          +P +++  KLP LPPL  K     GL IYQ+SS     P EPQ 
Sbjct: 882  DVNKED---------GKPKKNV--KLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQ- 929

Query: 914  LERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQ---EHDKR 970
               P       E   S N        + + +  + EP++ +  ++ K ++ Q   E +++
Sbjct: 930  ---PKSQSMIPERQDSINN------SASVKKTPVVEPESQATKKINKPKQRQPKKEEERK 980

Query: 971  PVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFD 1030
            P+ E  P V          EKKR+V                    +  +  N++A Q++ 
Sbjct: 981  PLNEMPPNV----------EKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYK 1030

Query: 1031 GLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRK 1090
            GL RLL GWSKYGLK+V+S S+ M ++GKLS+DNILSLRST FE+ V S G+ S V   K
Sbjct: 1031 GLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGFNK 1090

Query: 1091 KSGSSKAVLRLTTEIENIFSKEGVL 1115
             SGSSK V RL  EIE +  +EGVL
Sbjct: 1091 ISGSSKTVRRLFVEIEKVLRQEGVL 1115

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
            (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1163 (53%), Positives = 755/1163 (64%), Gaps = 107/1163 (9%)

Query: 9    SIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN---NNSAQSSSLT 65
            S+KGD +GPWKLGETLGLGSTGKVQLA+N++T +QAAIKVISKSVF+   NNS+  SS  
Sbjct: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNNSSMVSS-- 67

Query: 66   TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQ 125
            TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN+NLYMVLEYAEKGELFNLLVEKGPL 
Sbjct: 68   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127

Query: 126  EQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLET 185
            E EAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETEDKLLET
Sbjct: 128  ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187

Query: 186  SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE 245
            SCGSPHYAAPEIVSG+PYHG  +DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ GE
Sbjct: 188  SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247

Query: 246  FEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDT 305
            FEMP DDEIS EAQDLL KIL VDPEKRI++R+ILKHPLLQKYPSIKDSK+IRNLPREDT
Sbjct: 248  FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307

Query: 306  YLNPLSDN---NSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKID 362
            YLNPL  N   ++TIDKTILQNLVVLWHGR+ ++I  KL+EPGANAEKTLYALL RFK+D
Sbjct: 308  YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367

Query: 363  SEKENFKNEQIRKRQSITSSVS-RSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSS 421
            SE+E  KN QI+KRQSI S+ + +S     +TPQ++KNR S+ISVSSSHK+P S NRLS+
Sbjct: 368  SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427

Query: 422  VVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSN-----SNNSSPTPAHRNKRTSMINT 476
             + N                 S    +S+ ++K +     SN+ SPTPA RNKR S+ N 
Sbjct: 428  -IQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNL 486

Query: 477  DRQS--------ILXXXXXXXXXXXXX----------XVMANMKRGSITTKLIATYAKLS 518
            +  S        +L                        V+ N KRGSITTK+I+TYAKLS
Sbjct: 487  ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLS 546

Query: 519  EDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXX 578
            EDDDWE+IEKETKR SSDFATLIDEIFEHEKYEQIRKEKEEL                  
Sbjct: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEELERKVRENKEREERQKRQK 606

Query: 579  XXXXXXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL-- 636
                            +  + + Q+ +E++    + + D     E    N RS+S P+  
Sbjct: 607  EVELAAIAREREELQRRLEEEETQITKELQQDTKNFQED-----EVVHKNVRSISSPVEN 661

Query: 637  -SKETVNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMI 695
             ++    ++   QR+FSLQTRP+S+LDPG+      P + + I  DE   +K +D++K+I
Sbjct: 662  GNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDE--LDKTIDSQKVI 719

Query: 696  LETIRRSKFLGSSFDINRELKAAEK--RVMQPPTVQK-----------LTTENKSSDELP 742
            LETIRRSKFLGSSF+I++ELK  +K   V +    QK            T E   +  LP
Sbjct: 720  LETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLP 779

Query: 743  KHAVGTAALNSSTAEVS--KISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVD 800
            K+A    AL   + EV   KISDI+VPQFTRKS+ FT SN+RLSVLS+YS+ QS++NL +
Sbjct: 780  KNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLAN 839

Query: 801  ILKNTEAGTELG--QRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEK 858
            +LK  E G ++G  + +     + + EF FETV  E E            E+ + +   +
Sbjct: 840  VLK--EGGVDIGVNEGSNNVEVSEEPEFQFETVGTEIENNKYEEE----KEIENENNLSQ 893

Query: 859  PSGMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPL-DGKA--GLGIYQTSSPIEPQLLE 915
             + +KLN+ADRF     D+     ++  KLP LPPL D K   GLGIY + S  E     
Sbjct: 894  GANIKLNYADRF-----DTAGNVNEV--KLPTLPPLGDDKVSDGLGIYSSKSGSEGN-ES 945

Query: 916  RPV---KGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPV 972
            +PV   K +K  ET+   N +P+  +  ++P                KTR          
Sbjct: 946  KPVPSIKENKSEETLKEKNVEPKPPLNDVVP----------------KTRD--------- 980

Query: 973  MEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGL 1032
              KK  VV     +   +K RS                      K L +N++  Q+++GL
Sbjct: 981  -TKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVK-LFSNVSVTQLYNGL 1038

Query: 1033 RRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKS 1092
              LL GW  YGLK ++S     +IS +LSSDNILSLRST  ++ V S G+ S +  RKKS
Sbjct: 1039 FNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKS 1098

Query: 1093 GSSKAVLRLTTEIENIFSKEGVL 1115
            GSSK + RLT+E+E +  KEGVL
Sbjct: 1099 GSSKTLKRLTSEVEKVLRKEGVL 1121

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
            {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507C
          Length = 1189

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1197 (51%), Positives = 762/1197 (63%), Gaps = 108/1197 (9%)

Query: 8    PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSS---L 64
            P+++GD++GPWKLGETLG GSTGKVQLA N+ T + AA+K ISK++F+  +A  +S    
Sbjct: 10   PTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGNSSIAA 69

Query: 65   TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
            +TPD LPYGIEREIIIMKLLNHPNVLRLYDVWETN +LYMVLEYAEKGELFNLLVE GPL
Sbjct: 70   STPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPL 129

Query: 125  QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE 184
             E EA+ FFRQIIIG+SYCHALGIVHRDLKPENLLLDH  NIKIADFGMAALETEDKLLE
Sbjct: 130  PENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALETEDKLLE 189

Query: 185  TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            TSCGSPHYAAPEIVSGIPYHGFASD+WSCGVI FALLTGRLPFDEEDGNIRNLLLKVQSG
Sbjct: 190  TSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSG 249

Query: 245  EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRED 304
            +FEMP DDEIS EAQDLLAKILTVDPE RI+ R+ILKHPLLQKYP++ D+KSIRNLPRED
Sbjct: 250  KFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPRED 309

Query: 305  TYLNPLSDNNST-IDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDS 363
            TYL+PLSD+ S+ +D+ ILQNLVVLWHGR   EI +KLK+PGANAEKTLYALL RFK D+
Sbjct: 310  TYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLARFKNDT 369

Query: 364  EKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVV 423
            E+E  + +QI+KR S+  + +       S P++R NR S I+ SSSHK+P S  +LS   
Sbjct: 370  EREAARQKQIKKRSSLNGTGAGVNNNHVS-PKKR-NRASTINASSSHKRPVSLIKLSGSS 427

Query: 424  HNNLXXXXXXXXXXXXKKFSMN----KKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQ 479
            ++N             K+ S+N    K+LS +  K+  N  SPTPA R+KR S+I +D+ 
Sbjct: 428  NSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTV--KTQGNGGSPTPASRSKRVSIIESDKN 485

Query: 480  S--------ILXXXXXXXXXXXXXXVMANM------KRGSITTKLIATYAKLSEDDDWEY 525
                     +L                  +      KRGS+TTKLI+TYAKLSE+DDWEY
Sbjct: 486  GGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLSEEDDWEY 545

Query: 526  IEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXX 585
            IEKETKRTSSDFATLIDEIFEHEK+EQIRKEK EL                         
Sbjct: 546  IEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKEREERERKEREEKELNE 605

Query: 586  XXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKE----TV 641
                     ++++ Q    ++  +  +D+  +   NQ  N    RSVS PL ++     V
Sbjct: 606  KLENDARQKREMEAQEAQGDDGTDTESDVHSN---NQAPN--GVRSVSAPLERKKRDSMV 660

Query: 642  N-----DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMIL 696
            N     + +  QR  SLQTRP+SRLDPGLF++E+S   E   + +E    KKL T+K IL
Sbjct: 661  NVQSDIEEIFGQRTMSLQTRPVSRLDPGLFYAEESNEPEAGDTEEE----KKLRTQKNIL 716

Query: 697  ETIRRSKFLGSSFDINRELKAAE--KRVMQPPTVQKLTTENKSSDE--LPKHAVGTAALN 752
            ETIRRSKFLGSSFDI +EL+  E  K+  QP   + ++  N+  D   LP  AV TA L 
Sbjct: 717  ETIRRSKFLGSSFDIGKELQNEELKKKASQPHRDRTVSQTNEPYDTRVLPTQAVATAPLR 776

Query: 753  SSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAG-TEL 811
                E  KIS+I VPQFTRKSR F+ SN+RLSVLSMYST+ S++NL ++L +++A    L
Sbjct: 777  DQ--EPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGRL 834

Query: 812  GQRTPTPHSAG--DSEFIFETVNEEAEYTGN----SSNDDKLYEVADL--------DAAE 857
                      G  + EF FE V E ++        S+ND++L  V+          D   
Sbjct: 835  NSAAEYSDVKGKKEPEFQFEAVREASDEDNGISRLSNNDERLRNVSGTSGGSGVPHDNLS 894

Query: 858  KPSGMKLNFADRFNKKEEDSTEPSRDIQN---KLPVLPPLDGKA---GLGIYQTSSPIEP 911
                MKLNFADRF+  E  +   +    +   KLP LPPLDG +   GLGIYQ+SS    
Sbjct: 895  SKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPTLPPLDGTSEANGLGIYQSSSESFR 954

Query: 912  QLLERPVKGDKFMETISSDNEKPEKEI--------KSMIPEAVIEEPKNVSPIEVQKTRK 963
             ++E P    K  +  S+  ++ E+E+         S I  A  E  K    I+ +K   
Sbjct: 955  DIVE-PTPKSKLQDNSSNPEQEVEEEVAGREGSVKHSAIDTASKERSKRTDRIDAKKPSS 1013

Query: 964  DQEHDKRPVMEKKPEV--VAPKQRESD-----------------------QEKKRSVXXX 998
             QE+       K P +    PK+R  D                        +KKR+V   
Sbjct: 1014 FQENLASAGASKGPPLNDSMPKRRNEDPRNGSTAAKGENGRAPLKDITTNSDKKRNVSFF 1073

Query: 999  XXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISG 1058
                             +  + T ++A+Q+F GL+ LL+GW++YGLK+VRS    MT++G
Sbjct: 1074 RKFSKSNEKDTTGF---DGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTG 1130

Query: 1059 KLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
            KL+S+NILSLRST FE+ V S G+ S V  RKKSGSSKA+ RL +E+E +  KEGV+
Sbjct: 1131 KLTSENILSLRSTLFEMVVWSRGKVSVVGFRKKSGSSKAMRRLVSEVEKVLLKEGVI 1187

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa] {ON}
            similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507c GIN4
          Length = 1103

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/1151 (50%), Positives = 745/1151 (64%), Gaps = 92/1151 (7%)

Query: 3    ASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN--NNSAQ 60
            +SN +  IK +Q+GPWKLGETLG GSTGKV LA N+TT +QAA+KVISK+VF   NNS  
Sbjct: 5    SSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSES 64

Query: 61   SSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120
            +   T  +ALPY IE+EIIIMKLLNHPNVLRL+DVWETNS+LY+VLEYAEKGELFN+LVE
Sbjct: 65   NGDAT--NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122

Query: 121  KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 180
            +GPL E EA+R FRQIIIGISYCH+LG+VHRDLKPENLLLD+K NIKIADFGMAALE+ED
Sbjct: 123  RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESED 182

Query: 181  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240
            KLLETSCGSPHYAAPEI+SG+PY GF+SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK
Sbjct: 183  KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242

Query: 241  VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL 300
            VQ GEFEMP DDEI+ EAQDLLA++LTVDP KRI  R+ILKHPLLQKYPSIKDS+SIRNL
Sbjct: 243  VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNL 302

Query: 301  PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
            PREDTYL+PL+D NS ID  ILQNLV+LWHG+D  EI +KL+EPGAN EKTLYALL RFK
Sbjct: 303  PREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362

Query: 361  IDSEKENFKNEQ----IRKRQSITSSVSRSPAKKAS-TPQRRKNRISMISVSSSHKKPAS 415
             D+++E  +  +    +++  +I S+   SP+KK + TPQ++  R S+I  +SS K+P S
Sbjct: 363  CDTQREANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASII--ASSSKRPVS 420

Query: 416  FNRLSSVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMIN 475
              + ++ +  N             K+ SMN               SPT   R++R+S+I 
Sbjct: 421  VTKTATNITVN---SSITGTPKSAKRMSMNNSARKRMSALYGTRDSPTKTSRSRRSSIIT 477

Query: 476  TD------RQSILXXXXXXXXXXXXXXV--MANMKRGSITTKLIATYAKLSEDDDWEYIE 527
             D      R S++              +  + N+KR S+TTKL+ATYAKLSEDDDWEYIE
Sbjct: 478  KDFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIE 537

Query: 528  KETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXX 587
            +ETKRTSSDFATLIDEIFE+EKYEQIRKEK EL                           
Sbjct: 538  RETKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKEREERERKERQEKELQERL 597

Query: 588  XXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVN----- 642
                   Q+  + RQMDEEI NL+ +L GD     + NED +RSVS PL  ++       
Sbjct: 598  ERERIEKQKEDIARQMDEEISNLKKELVGD-----QDNEDKFRSVSEPLESKSKKIEDIE 652

Query: 643  ---DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETI 699
               D +LR R +SLQTRP+SRLDPG+ F ++    E+ +     +  +  +TE+ ILETI
Sbjct: 653  EDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETI 712

Query: 700  RRSKFLGSSFDINRELKAAEKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVS 759
            RRSKFLGSSFDI +EL+  ++       ++K        + LPK AV    + S    + 
Sbjct: 713  RRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPK-AVEKKNV-SMDPSLR 770

Query: 760  KISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPH 819
            KISDI+VPQFTRKSRHF+TSNRRLSVLSMYST++S+SNL DILKN     E+ Q  PTP 
Sbjct: 771  KISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPK 830

Query: 820  SAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEED--S 877
            SA DS+ +F+T++ EA+   + S +++LYEVA+ ++  + +  K++ AD  N +  +  S
Sbjct: 831  SADDSDQLFDTID-EADTPASVSREERLYEVAE-ESENELANKKIDIADLLNSEGSNLKS 888

Query: 878  TEPSRDIQNKLPVLPPLDGKAGLGIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKE 937
             E   D   KLP LPPL        ++  S  E +                       ++
Sbjct: 889  VEEQED-SMKLPKLPPL--------FEDGSTKETK-----------------------EQ 916

Query: 938  IKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPVMEK------------KPEVVAPKQR 985
             KSMIPE +     + S  +++K   D+     P M K            KP V      
Sbjct: 917  SKSMIPENM---QSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTS 973

Query: 986  ES-DQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGL 1044
            E    +KKR++                   T   L T+++++Q+F GL  LL GW+KYGL
Sbjct: 974  EQVSADKKRNMSFLRKLSKGSSSSKDNVDVT---LSTSVSSKQLFSGLVNLLKGWTKYGL 1030

Query: 1045 KNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGSSKAVLRLTTE 1104
            K +   S++ TI+GKL++DNILS RST F I + S  + S+V  RK SGS KAV RL+ E
Sbjct: 1031 KGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRLSDE 1090

Query: 1105 IENIFSKEGVL 1115
            ++ + SKEGVL
Sbjct: 1091 VKKVLSKEGVL 1101

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1233 (49%), Positives = 754/1233 (61%), Gaps = 154/1233 (12%)

Query: 4    SNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN----NNSA 59
            S+ L ++K D++GPWKLG  LG GS GKV +A ++TTG+QAA+K++SKS+F     NNS+
Sbjct: 12   SSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSS 71

Query: 60   QSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
                   PD LPYGIEREIIIMKLLNH NVLRLYDVWET SNLYMVLEY EKGELFNLLV
Sbjct: 72   TIVGSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLV 131

Query: 120  EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
            E+GPL E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++
Sbjct: 132  ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESK 191

Query: 180  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
            DKLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDE++GNIR+LLL
Sbjct: 192  DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLL 251

Query: 240  KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRN 299
            KVQSGE+EMP +DEIS EAQDL+AKILTVDP++RI+ R+ILKHPLLQKYPSIKDSKSIRN
Sbjct: 252  KVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRN 311

Query: 300  LPREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRF 359
            LPREDTYLNPL   + +ID  ILQNLVVLWHGRD NEI++KL EPGAN EKT Y LL RF
Sbjct: 312  LPREDTYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRF 371

Query: 360  KID-----------------SEKENFKNEQIRKRQSITSSVSRSPAKKASTPQ------- 395
            K D                  +++  + +Q + RQS   S  +   KK+++ +       
Sbjct: 372  KHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSL 431

Query: 396  ------RRKNRISMISVSSSHKKPASFNRLSSVVHNNLXXXXXXXXXXXXK-KFSMNKKL 448
                  ++KNR+SMISVSSSHK+P SFN+LS+   ++                 S +K+L
Sbjct: 432  SGTTTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSACGTPGSSTKRMSISLSSSKRL 491

Query: 449  SMIADKSNSNNSSPTPAHRNKRTSMINTDRQS------IL----------XXXXXXXXXX 492
            S +       N+SPTPA  NKR S+ + D  +      +L                    
Sbjct: 492  SAMGP-----NTSPTPA--NKRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRAS 544

Query: 493  XXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQ 552
                 + N+KRGSITTKLIATYAKLSE+DDWEYIEKETKRTS+DFATL D+IFEHEKYEQ
Sbjct: 545  KRLSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQ 604

Query: 553  IRKEKEEL---------AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQLQLQRQM 603
            IRKEK+EL                                          A+Q +LQ  M
Sbjct: 605  IRKEKQELERKVREAKEREERERRKRQEEQEEQERKRRAEEERVLRELEDAKQQELQELM 664

Query: 604  DEEIENLRADL-KGDVEPNQEKNEDNYRSVSVPLSKETVN---------------DNLLR 647
             +E+  LRAD  +   EP ++    N R VS P++  +                 D+LL+
Sbjct: 665  AKEVAMLRADYGEPQTEPEEQGASKN-RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLK 723

Query: 648  QRNFSLQTRPISRLDPGLFFSEQ--SPTEEKPISPDEPVPNKKLDTEKMILETIRRSKFL 705
            +R  SLQTRP+SRLDPG+  +E   S   E+    DE      L TEK ILETIRRS+FL
Sbjct: 724  RRTVSLQTRPVSRLDPGIVAAENLGSVIYEEADGVDETT----LRTEKTILETIRRSRFL 779

Query: 706  GSSFDINRELKAAEK------------RVMQPPTVQKLTTENKSSDELPKHAVGTAALNS 753
            GSSFDI +EL+ A++            R++   T    T +   S  LPK+A     LN 
Sbjct: 780  GSSFDIKKELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPKNAAAVDTLND 839

Query: 754  S-TAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELG 812
                E  KIS+I+VPQFTR+SRHFT SN+RLSVLSMYST+ SF+NL D LK      E+ 
Sbjct: 840  ERNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLKGGADLQEVS 899

Query: 813  QRTP-TPHSAGDSEFIFETVNEE-AEYTGNSSNDDKLYEVADLDAAEKPS---GMKLNFA 867
               P T     + EF+FE+V+EE +E T +++ D +LYEV D   + K S    M+LNFA
Sbjct: 900  GSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNFA 959

Query: 868  DRFNKKEEDSTEPSRDIQNKLPVLPPLDGKA-----GLGIYQTSSPIEPQLLERP---VK 919
            DRFN +  D+     D+  KLP LPPL+        GLGIYQ  SP  P+    P   V 
Sbjct: 960  DRFNTRAGDNPA---DV--KLPPLPPLEKNGSKKPNGLGIYQ--SPERPRADPNPTSMVH 1012

Query: 920  GDKFMETISSDNEKPEKEIKSM----IPEAVIE--EPKNV-----SPIEVQK-----TRK 963
              K    I  D   P K  K      +P +  +  EPKN      +P   Q       RK
Sbjct: 1013 EPKVFSMIPDDIAGPAKSTKPAESENVPTSATKKSEPKNALHSADAPEASQPPLNGMMRK 1072

Query: 964  DQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNI 1023
            +  +D++P+ +  P         +++++ RS                  A+    L T++
Sbjct: 1073 N--NDRKPLEDITP--------AAEKKRNRSFFRKFSRSSEEKKSDNFDAK----LNTSV 1118

Query: 1024 AARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGES 1083
             A Q+F+ L +LL GW  YGLK VR    T TI+GKLSSDNILSLRST FEI V  +   
Sbjct: 1119 EAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSK 1178

Query: 1084 SSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
             SV+   KKSGS+K   RL  E+E +  +E VL
Sbjct: 1179 GSVVWFVKKSGSTKTFKRLVKEVEKVLERENVL 1211

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/1185 (50%), Positives = 749/1185 (63%), Gaps = 137/1185 (11%)

Query: 9    SIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVF-------------- 54
            ++ G+ +GPWKLGETLG GSTGKVQLA N+ T +QAAIK+ISKSVF              
Sbjct: 10   TVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSAL 69

Query: 55   -----NNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA 109
                 NN S Q +     +ALPYGIEREIIIMKLLNH NVLRLYDVWETN+NLYMVLEYA
Sbjct: 70   AASDVNNGSVQHNQ----EALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYA 125

Query: 110  EKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIA 169
            EKGELFNLLVEKGPL E EA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIA
Sbjct: 126  EKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIA 185

Query: 170  DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDE 229
            DFGMAALETEDKLLETSCGSPHYAAPEIVSG+PY+G  +D+WSCGVILFALLTGRLPFDE
Sbjct: 186  DFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDE 245

Query: 230  EDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYP 289
            EDGNIRNLLLKVQ GEFEMP  DE+S EAQDL+ KILTV+P++RI+ R+ILKHPLLQKYP
Sbjct: 246  EDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYP 305

Query: 290  SIKDSKSIRNLPREDTYLNPLSDNNST---IDKTILQNLVVLWHGRDVNEIISKLKEPGA 346
            +IKDSK+IR+LPREDTYLNPL+DNN     ID++ILQNL VLWHG+D NEII KLKEPGA
Sbjct: 306  NIKDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGA 365

Query: 347  NAEKTLYALLDRFKIDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISV 406
            NAEKTLY LL RFK D+E+EN KN Q+RKRQS+  + S S + + + P+RRKNR SMISV
Sbjct: 366  NAEKTLYVLLHRFKEDTERENHKNSQLRKRQSLMKASSSSSSNQGNVPRRRKNRNSMISV 425

Query: 407  SSSHKKPASFNRLSSVVHNNLXX----XXXXXXXXXXKKFSM-----NKKLSMIADKSNS 457
            +SSHKKP S+N+++ V  ++                 K+ S+     NK+ S +  +SNS
Sbjct: 426  TSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRNSRLYTQSNS 485

Query: 458  NNSSPTPAHRNKRTS---MINT-------------DRQSILXXXXXXXXXXXXXXVMANM 501
              SSPTPA R++R+S   +IN              D   I                + N 
Sbjct: 486  --SSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSRLSKRYSFLLNN 543

Query: 502  KRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELA 561
            KRGS+TTK+++TYAKL+EDDDWE+IEKETKR SSDFATLIDEIFEHEK+E+IRKEKEEL 
Sbjct: 544  KRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKFEKIRKEKEELE 603

Query: 562  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQL-----QLQRQMDEEIENLRADLKG 616
                                              ++     QLQ  +DEE   L+ +   
Sbjct: 604  RKVIEAKQKEERERKEAEAAAKEEARVRREKELARMNKEEEQLQNDIDEEARLLKDEFNF 663

Query: 617  DVEPNQEKNEDNYRSVSVPLSKETVNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEK 676
              +  QE N  N RSVS P+     ++    QRNFSLQTRPISRLDPGL FS+    +  
Sbjct: 664  VNDETQE-NPINSRSVSEPVKNGGTDEK--GQRNFSLQTRPISRLDPGLMFSKLGDVDNN 720

Query: 677  PISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAA--EKRVMQPPTVQK---- 730
              S DE   N  ++ +K ILETIRRSKFLGSSFDIN+EL  A  E++ ++   +QK    
Sbjct: 721  S-SVDE---NLTMNNQKTILETIRRSKFLGSSFDINKELNNANEERKRLRQLQLQKQKEL 776

Query: 731  -----LTTENKSSDE---LPKHAVGTAALN--SSTAEVSKISDIRVPQFTRKSRHFTTSN 780
                 + + +  S+E   L K+A+G   L   SS  E  KIS+++VPQFTRKS++F+ SN
Sbjct: 777  EEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEPRKISEVQVPQFTRKSKYFSESN 836

Query: 781  RRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGN 840
            +RLSVLS YS++QS++NLVD++K      E     P   +  DS++ +     EA     
Sbjct: 837  KRLSVLSFYSSKQSYTNLVDMIKENPVEDEDVTEDPG-FNFEDSQYDYLEEKNEAPL--- 892

Query: 841  SSNDDKLYEVAD-LDAAEKPS-GMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKA 898
              +D+   EV D +   EK S  MKLNFADRF+    ++ + S   ++K P +    G  
Sbjct: 893  EVSDEVPKEVDDKVQEEEKNSVSMKLNFADRFSNVNSNTKQES-SFEDKFPNILSKSGTE 951

Query: 899  GLGIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIE- 957
            GLG+Y  +   EP                        K +KSMIPE   E+  N SP+  
Sbjct: 952  GLGLYSKNEKTEP------------------------KPVKSMIPE---EDKVNSSPVVE 984

Query: 958  ------VQKTR-KDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXX 1010
                  V KTR +++   K P   +K    +   R+   +   S                
Sbjct: 985  APLNKVVNKTRAENKSTSKGPSGSQKVSNTSSFLRKISGKSSNSTVAK------------ 1032

Query: 1011 XXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRS 1070
                 E  L +++   Q+F+GL+ LL GW+ YGLK+V+       I GKLS+DNILSLRS
Sbjct: 1033 --GAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRS 1090

Query: 1071 TNFEIKVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
            T  E+ V +  + S + IRKKSGSSK + RL +EIE + SKEGVL
Sbjct: 1091 TIVELCVFTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVL 1135

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1196 (50%), Positives = 746/1196 (62%), Gaps = 135/1196 (11%)

Query: 7    LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTT 66
            L ++KGD++GPWKLG TLG GSTGKV +A +++TG+QAA+K++SKS+F N S  S+ + +
Sbjct: 15   LTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIVGS 74

Query: 67   --PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
              PD LPYGIEREIIIMKLLNHPNVLRLYDVWETNS+LYMVLEY EKGELFNLLV++GPL
Sbjct: 75   NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPL 134

Query: 125  QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE 184
             E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++DKLLE
Sbjct: 135  PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLE 194

Query: 185  TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            TSCGSPHYAAPEIVSG+PYHGF SDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSG
Sbjct: 195  TSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG 254

Query: 245  EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRED 304
            +FEMP  +EIS EAQDL+AKILTVDP  RI++R ILKHPLLQKYPSIKDSKSIRNLPRED
Sbjct: 255  KFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPRED 314

Query: 305  TYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSE 364
            TYLNPL   + TID TI+ NLVVLWHGRD NEI +KLKEPGAN EKT YALL RFK DS+
Sbjct: 315  TYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQ 374

Query: 365  KENFKNEQIRKRQSITSSVSRSPAKKA-------STPQRRKNRISMISVSSSHKKPASFN 417
            +E  K  Q R+ Q++  S  ++  +K+       ST  ++K R  +IS SSSHK+P SF+
Sbjct: 375  QEQLK--QQRRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKRPVSFS 432

Query: 418  RLS-SVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTS---- 472
            RLS S   N                 S NK++S + +     NSSPTPA  +KR S    
Sbjct: 433  RLSYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINP----NSSPTPA--SKRASLREL 486

Query: 473  ----------MINTDRQSILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDD 522
                      M+    ++                 +   KRGSITTKLIATYAK+SED+D
Sbjct: 487  DPSAPPIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKISEDND 546

Query: 523  WEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXX 582
            WEYIEKETKRTS+DFATL DEIFEHEKYEQIR+EKEEL                      
Sbjct: 547  WEYIEKETKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREAKEQEERERRQREEEE 606

Query: 583  XXXX----XXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVP--- 635
                            ++   QR++ E I+   A LK   E +   + +  RSVS P   
Sbjct: 607  RRQREEELARQREFEEERYHRQREVQENIDREMALLKEGYETSSGVDPNKNRSVSAPVES 666

Query: 636  ---LSKETVND-------NLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVP 685
               + K +  D       +LL +R FSL+TRP SRLDPG++  E+ P        D    
Sbjct: 667  VLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIYTLEEVPNS------DIKDG 720

Query: 686  NKKLDTEKMILETIRRSKFLGSSFDINREL----------KAAEKRVMQPPTVQKLTTEN 735
             + L TEK ILETIRRSKFLGSSFDIN+EL           AA K+  +   V    T N
Sbjct: 721  GRDLKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKEDRVVSNATGN 780

Query: 736  KSSD-----ELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYS 790
             S +      LPK+A  T   N + ++  KIS+++VPQFTR+SRHFT SN+RLSVLSMYS
Sbjct: 781  YSENGYEPQTLPKNAAATKISNDAGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMYS 840

Query: 791  TRQSFSNLVDILKN-TEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYE 849
            T+ SF+NL D L+  T+  +  G    T     ++EF+FE+V+ E + T ++S D +LYE
Sbjct: 841  TKASFTNLADHLRGKTDLQSINGSPPSTSRMEPETEFMFESVDGEGKETADTSADSRLYE 900

Query: 850  VA---DLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQN----KLPVLPPL-----DGK 897
            VA   D   A + S ++LNFADRFNK    ++ P + +++    KLP LPPL     DG 
Sbjct: 901  VAEGNDPKGAAR-SAVRLNFADRFNKP---TSPPPQSVEDPNGIKLPSLPPLDKAKSDGV 956

Query: 898  AGLGIYQTSS-PIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPI 956
             GLG+YQ +S   E ++  +P    K M  I  D E+ E        EA  EE K V P 
Sbjct: 957  NGLGLYQPASDSSETEIHHQP----KSM--IPVDAEQKEAA------EAKPEEQKQVPPK 1004

Query: 957  EVQKT--------RKDQEHDKRPVMEKKPEVVAPKQR--------ESDQEKKRSVXXXXX 1000
            +V+          +K+ E +K    +  P  V    +        +SD EK+        
Sbjct: 1005 DVESAPAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFFRRFSGKSDDEKR-------- 1056

Query: 1001 XXXXXXXXXXXXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKL 1060
                         E +    T I   Q+F+ L +LL  W  YGLK+V +  S   I GK+
Sbjct: 1057 -----------PGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKM 1105

Query: 1061 SSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116
            SSDN+LSLRST FEI + S GE S V   KKSGS+K   +L  EIE I   +  L+
Sbjct: 1106 SSDNMLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKALV 1161

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1167 (49%), Positives = 735/1167 (62%), Gaps = 116/1167 (9%)

Query: 5    NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
            N + ++KGD +GPWKLG TLG+GSTGKV +A+N+T G+QAA+K+ISKS+FN   +     
Sbjct: 4    NGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGG 63

Query: 65   TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
              PD LPYGIEREIIIMKLLNHPNVLRLYDVWET+ +LYMVLEY EKGELFNLLVE+GPL
Sbjct: 64   NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPL 123

Query: 125  QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE 184
             E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+N+K+ADFGMAALE++DKLLE
Sbjct: 124  PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLE 183

Query: 185  TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            TSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQSG
Sbjct: 184  TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG 243

Query: 245  EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRED 304
            +FEMP DDEIS EAQDL+A+ILTVDPE+RI+ R+ILKHPLL+KYPSIKDSKSIRNLPRED
Sbjct: 244  KFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPRED 303

Query: 305  TYLNPLS--DNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKID 362
            TYLNPLS    N  +D+TILQNLVVLWHGR+  +II+KL EPGAN EKT YALL RFK D
Sbjct: 304  TYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHD 363

Query: 363  SEKENFKNEQIRKRQSITSS----VSRSPAKKAS-----TPQRRKNRISMISVSSSHKKP 413
            + ++  K ++++K+QS++S+    V   P+   S     TP  +K R S+I  SSSHK+P
Sbjct: 364  NYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTP--KKKRTSIIVASSSHKRP 421

Query: 414  ASFNRLSSVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSM 473
             S  +LSS   ++             K F  NK++S +     SN+SSPTPA  +KR S 
Sbjct: 422  VSMQKLSS--QHSSPVKNGSIGKRLSKTFPSNKRISQLV----SNSSSPTPAA-HKRVSR 474

Query: 474  IN------TDRQSILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIE 527
            IN        ++ +               ++ NMKRGSITTKLIATYAKLSED +WEYIE
Sbjct: 475  INDSAAPPVPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIE 534

Query: 528  KETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXX----XXXXXXXXXXXXXXXXXXX 583
            KETKRTS DFATL+D+IFEHEKYEQIRKEKEEL                           
Sbjct: 535  KETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEAREKEEAERKERERIEREEQE 594

Query: 584  XXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL-SKETVN 642
                       +Q +LQ QM++EI  L+A+ +     + E+N  N RSVS P+ +  T N
Sbjct: 595  RLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQGSSDERNTANGRSVSAPIETDRTAN 654

Query: 643  ------------DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLD 690
                        + L+  RNFSLQTRP+SRLDPG+  +E   +          + + +  
Sbjct: 655  KRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGIIAAESRLSAN--------LEDDQAS 706

Query: 691  TEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQKL-----TTENKSSDELPKHA 745
             EK ILETIRRSKFLGS F++N EL+ A+K ++     ++L      T      +LPK+A
Sbjct: 707  KEKTILETIRRSKFLGSQFNLNVELEKAQKDLVSKERQEQLRKYSEQTAKYEVQKLPKNA 766

Query: 746  VGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNT 805
               A L     E  K+S+++VPQFTR+S+HF++SN+R SVLS+YST+ SF+NLVD LKN 
Sbjct: 767  KAVATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVDHLKND 826

Query: 806  EAGTEL-GQ-RTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMK 863
                 L GQ    +   A + EF+FETV E  E       + KL+EV + +  +  S  +
Sbjct: 827  NYLEPLPGQPEYSSSKVAQEPEFMFETVEELDE-------NSKLFEVPETEEGKLASAAR 879

Query: 864  LNFADRFNKKEEDSTEPSRDIQNKLPVLPPL---------DGKAGLGIY----QTSSPIE 910
                D   +   D     +DI   LP LPPL         +G  GLGIY    QT  P +
Sbjct: 880  KESTDARKQSTND-----KDIN--LPSLPPLQVSHDVADENGALGLGIYQPNDQTQKPHK 932

Query: 911  PQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKR 970
              L++  +      E ISS ++    E        V+++P       +    +   ++++
Sbjct: 933  TMLIDESID-----ENISSTSDVSRTE--------VVKKPP------LNDVVRKNNNERK 973

Query: 971  PVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFD 1030
            P+ E  P+V          E KR +                 +  +  L   ++A +++ 
Sbjct: 974  PLEEITPKV----------ENKRKISFFRKFSQGSEKKLGPES-FDSQLKAGVSAPKMYK 1022

Query: 1031 GLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVT-SNGESSSVLIR 1089
             L RLLN W+ YGLK+V S  +   ISGKL+SDNILSLRST F+I V    G  S +   
Sbjct: 1023 ALDRLLNEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFT 1082

Query: 1090 KKSGSSKAVLRLTTEIENIFSKEGVLL 1116
            KKSGS+K   RL  EIE I  KE VL+
Sbjct: 1083 KKSGSTKTFNRLVKEIEKILEKEKVLV 1109

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1151 (50%), Positives = 731/1151 (63%), Gaps = 165/1151 (14%)

Query: 1    MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQ 60
            MT+      +KGD +GPWKLG+TLGLGSTGKV+LA+N+TT +QAAIK+ISKS+F+  +  
Sbjct: 1    MTSVVGETKMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVG 60

Query: 61   SSSL---TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNL 117
             SS+   ++PDALPYGIEREIIIMKLL HPNVL LYDVWETNS LYM+LEYAEKGELFNL
Sbjct: 61   ESSMVSNSSPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNL 120

Query: 118  LVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 177
            LVE+GPL E+EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK NIKIADFGMAALE
Sbjct: 121  LVERGPLPEKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALE 180

Query: 178  TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNL 237
            T+DK+LETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVILFALLTGRLPFDEEDGNIRNL
Sbjct: 181  TKDKMLETSCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNL 240

Query: 238  LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSI 297
            LLKVQSGE+EMP DDEIS EAQDL+ +ILTVDPE+RI+ RDILKHPLLQKYPSIKDS+SI
Sbjct: 241  LLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSI 300

Query: 298  RNLPREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLD 357
            +NLPREDTYL PLS+NNS ID +ILQNLV LWHGRD ++I  KL+E GA+AEKT+YALL 
Sbjct: 301  KNLPREDTYLYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLY 360

Query: 358  RFKIDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFN 417
            RFK+++EK N                        S+P RRKNRISMISVSSSHK+P S  
Sbjct: 361  RFKVEAEKMN----------------------TCSSP-RRKNRISMISVSSSHKRPVSMK 397

Query: 418  RLSSVVHNNLXXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTD 477
            ++S+V +N                 +  K++S I   +   NSSPTP+ R KR S+IN D
Sbjct: 398  KISTVQNNTPPSNRRLSISLSS---TQRKRMSGILQHT---NSSPTPS-RTKRISVINID 450

Query: 478  -------------------------RQSILXXXXXXXXXXXXXXVMANMKRGSITTKLIA 512
                                     R++I                + N KR SITTKL++
Sbjct: 451  DSENKAPPPVPMEMLEDYKNNSKNVRRTI---KKKKKKKNNYRLTLVNNKRVSITTKLLS 507

Query: 513  TYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXX 572
            TYAKLSEDD+WEYIE+ETKRTSSDFATLIDE+FEHEKYE+IRKEKEEL            
Sbjct: 508  TYAKLSEDDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEEL----------ER 557

Query: 573  XXXXXXXXXXXXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSV 632
                                  +QL+LQ+++DEEI  L+ D            +DN+RSV
Sbjct: 558  KVRETRVREQRREEEERAELQREQLKLQQKIDEEISKLKED---------ALEKDNFRSV 608

Query: 633  SVPL----SKETVNDNLLRQRNFSLQTRPISRLDPGLFFSEQS--PTEEKPISPDEPVPN 686
            S P+     ++   + L  +R FSLQTRP+SRLDPG+ +S  +  P+ E+ +  +E    
Sbjct: 609  SAPIKENEDEDENENELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYER-VVVNESGNK 667

Query: 687  KKLDTEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQKLTTENKSSDELPKHAV 746
                 ++ ILETIRRSKFLGSSF+I +EL+ +++ V+ P   Q +       DE+     
Sbjct: 668  SSAQQQRKILETIRRSKFLGSSFNIQQELEFSQRNVLVPTKEQVVDV-----DEVKLE-- 720

Query: 747  GTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTE 806
                       + KIS++++PQFTRKSRHF+ SN+RLSVLSMYST+QS++NL  ILK+  
Sbjct: 721  ---------GGLRKISEVKIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDGT 771

Query: 807  AGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMKLNF 866
              +E  ++TP        E +FE           S  DD+LYEV+               
Sbjct: 772  EESEPAKKTP--------ELLFE-----------SGRDDRLYEVS--------------- 797

Query: 867  ADRFNKKEEDSTEPSRDIQN-KLPVLPPLDGKAGLGIYQTSSPIEPQLLERPVKGDKFME 925
                  +E +  E   DI+   LP LPPL   A        + I    + RP K +  +E
Sbjct: 798  ------EEPEIQEEKEDIETVTLPQLPPLKQSANTNANANETEINGLAIFRP-KENIELE 850

Query: 926  TISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPVMEKKPEVVAPKQR 985
             I+       KE+K +IP    ++     PI +   +  Q  + +P  E++ + +AP  +
Sbjct: 851  DIT-------KEVKEVIPS---QDHGKDKPIAINNPK--QRLEVKP--ERQLDEIAP-NK 895

Query: 986  ESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLK 1045
                EKKR+V                  E    +  NI +RQ++ GLR+LL GW++YGLK
Sbjct: 896  VGTTEKKRNVSFFRKFSNNSATIKGYDHE----IYVNIGSRQLYTGLRKLLEGWTQYGLK 951

Query: 1046 NVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVL-IRKKSGSSKAVLRLTTE 1104
            +VRS ++ M I+GKL++DNILSLRST FE+ V   G   S++   K  GSSK V RL TE
Sbjct: 952  DVRSDNTAMKITGKLANDNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKVVRRLFTE 1011

Query: 1105 IENIFSKEGVL 1115
            IE + +KEGVL
Sbjct: 1012 IEKVLNKEGVL 1022

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR507C
            (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/1186 (48%), Positives = 728/1186 (61%), Gaps = 126/1186 (10%)

Query: 5    NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
            NN+ S++GD++GPWKLGETLG GSTGKV LA N  TG+ AA+KVISKSVFN   +     
Sbjct: 6    NNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGS 65

Query: 65   TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
              PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNLLV++GPL
Sbjct: 66   NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125

Query: 125  QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE 184
             E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLE
Sbjct: 126  PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 185

Query: 185  TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            TSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQSG
Sbjct: 186  TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG 245

Query: 245  EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRED 304
            ++E+P +DEIS EA+DL+ +ILTV+PE+RI+ R+ILKHPLLQKYPSIKDSKSIRNLPRED
Sbjct: 246  KYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRED 305

Query: 305  TYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSE 364
            TYLNPL  N+ TID+ ILQNLVVLWHGRD NEI  KLKEPGAN EKT YALL RFK ++E
Sbjct: 306  TYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENE 365

Query: 365  KENFKNEQIRKRQSITSS-----VSRSPAKKA-----STPQRRKNRISMISVSSSHKKPA 414
            ++  K +QI KR S TSS     + +S ++++     STP  +K R S I+VSS+HK+P 
Sbjct: 366  QQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTP--KKKRSSAINVSSAHKRPV 423

Query: 415  SFNRLSSVVHNNLXXXXXXXXXXXXKKFSM-NKKLSMIADKSNSNNSSPTPAHRNKRTSM 473
            S  +L+     N             KK S+ N+KLS +   + SN+SSP+     KR S 
Sbjct: 424  SIQKLNDCGTLN--------PTSPSKKRSLSNRKLSAVL--AGSNSSSPS----RKRMS- 468

Query: 474  INTDR----QSILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKE 529
            +  D      ++L                   KRGSITTK+IATYAKLSED+DWEYI++E
Sbjct: 469  VGQDAPPVPTAVLRDYNKRASRASKRLSFLPSKRGSITTKIIATYAKLSEDNDWEYIDRE 528

Query: 530  TKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 589
             KRTSSDFATLID IFEHEKYEQIR+EKEEL                             
Sbjct: 529  AKRTSSDFATLIDNIFEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEE 588

Query: 590  XXXXA-------QQLQLQRQMDEEIENLRADLKGDVEPNQEK-----NEDNYRSVSVPLS 637
                        +Q +LQ+ ++E++  L+A++       QEK      E + RS+S P+ 
Sbjct: 589  ERRRRREVEELIRQRELQKSLEEQVARLKAEVAAT---KQEKRISLAQEQHVRSISEPME 645

Query: 638  KETVN--------------DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEP 683
            ++                 ++LL++R  SL+TRPISRLDPG+  SE++   E  +  +E 
Sbjct: 646  RKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNE- 704

Query: 684  VPNKKLDTEKMILETIRRSKFLGSSFDINRELKAA------------------------- 718
                +L  EK ILETIRRSKFLGS +DI++EL+                           
Sbjct: 705  ---DRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSR 761

Query: 719  -EKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFT 777
             E+R +   T    + E+  S  LPK+      L    +E  K+S++++PQFTR+S+HF+
Sbjct: 762  QEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFS 821

Query: 778  TSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTP-HSAGDSEFIFETVNEEAE 836
             S++RLSVLSMYST+ S++NL D L N      L    PT      + EF+FE+  +E  
Sbjct: 822  ASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENR 881

Query: 837  YTGNSSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQN-KLPVLPPLD 895
            Y   +  D  L         +   G  +   +  + ++        DI   KLP+LPPLD
Sbjct: 882  YQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLD 941

Query: 896  G---KAGLGIYQTSSPI-EPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPK 951
                  GLGIYQ  +P  EP  L +PV                   +KSMIP+ +     
Sbjct: 942  HLNKPNGLGIYQAPAPPKEP--LGQPV-------------------MKSMIPDDI----- 975

Query: 952  NVSPIEVQKTRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXX 1011
             +  +  Q + + +  ++ P  EKK     P++  + +                      
Sbjct: 976  KIKCVPNQLSPRRRATERAP--EKKLTKTVPERVIAAETFPPPNTKKKPSFFKKFSREKM 1033

Query: 1012 XAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRST 1071
             ++ +  L T +   ++F  L +LLNGW+ YGLK VRS+ ++ TI+GKLSSDNILSLRST
Sbjct: 1034 HSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRST 1093

Query: 1072 NFEIKVTSNGES-SSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116
             FEI + S  ++ SSV   KKSGS K   RL  EIE I  KE VL+
Sbjct: 1094 AFEIVILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVLV 1139

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
            {ON} YDR507C (REAL)
          Length = 1024

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1162 (42%), Positives = 648/1162 (55%), Gaps = 206/1162 (17%)

Query: 13   DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
            + +GPW+LGETLG GSTG+VQLA ++ TG + A+KVISK++F+             ALPY
Sbjct: 8    NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXL---ALPY 64

Query: 73   GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
             IEREI++MKLL+HPNVL LYDVWETN+NLY++LEYAEKGELFNLLV++GPL E+EA++ 
Sbjct: 65   NIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKC 124

Query: 133  FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 192
            FRQIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+ +LLETSCGSPHY
Sbjct: 125  FRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSPHY 184

Query: 193  AAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDD 252
            AAPEIVSG+PY GFASDVWSCGVILFALLTGRLPFDE++GN+R+LLLKVQ G+FEMP   
Sbjct: 185  AAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDAT 244

Query: 253  EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSD 312
            EIS +AQ+L+++IL VDP +R++ RDIL HPLL+KY +I+DSKSIRNLPRE+TYL PL+D
Sbjct: 245  EISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLAD 304

Query: 313  ----NNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENF 368
                 N+TID +ILQNLVVLWHGR  +EI++ LK+ G N EKTLYALL RFK ++ K   
Sbjct: 305  AGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQEANK--- 361

Query: 369  KNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVVHNNLX 428
                 R R  I  +  ++P                         P+     SS  HN L 
Sbjct: 362  -----RSRHKIKKTTKKNPP-----------------------YPSMSILSSSSSHNRLS 393

Query: 429  XXXXXXXXXXXKKFSMNKKLSMIADK----SNSNNSSPTPAHRNKRTSMINTDRQSIL-- 482
                       +  SMN   S         SNS+N SP P+  +KR+S  NT   ++   
Sbjct: 394  GSTPRRRTPKRR--SMNFSSSKKRSSFILASNSSNGSPMPSRNSKRSSFFNTASANVPPV 451

Query: 483  ------XXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSD 536
                                 + N+KRGS+T+K ++ Y  L ++DDWEYIEK+TKRTSS+
Sbjct: 452  PVKLLNSYKRNSKRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSN 511

Query: 537  FATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQ 596
            FATLIDEIFE EK+E  R+EK E                                     
Sbjct: 512  FATLIDEIFEPEKFELARREKAE------------------------------------- 534

Query: 597  LQLQRQMDEEIENLRADLKGDVEP-NQEKNEDNYRS------------VSVPL------S 637
              LQR++ E         K DV   NQE   +  +S            VS PL       
Sbjct: 535  --LQRKVQEAKRG-----KSDVAKLNQENGNETGKSDAMEELKKINNKVSSPLINYEYSQ 587

Query: 638  KETVND--NLLRQR-NFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKM 694
            +E + D   LL  R   S  TRPIS+LDPGL      PT E      +   +  LDTE  
Sbjct: 588  QELLQDINTLLTNRCQLSAYTRPISKLDPGLM-----PTPETIPYDIKEKTDLLLDTEMK 642

Query: 695  ILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNSS 754
            ILETIR+SK L SS ++ +E+     R+   P+V+          E P  +      N+ 
Sbjct: 643  ILETIRKSKILDSSLNLRKEVSRDADRL---PSVE----------ESPIASTTPLVYNND 689

Query: 755  TAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQR 814
            + EV KISDI+VP FTRKS+ FT +N R SVLS+YS+R SF  L  IL + +        
Sbjct: 690  SKEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHSFKGLSRILNSKDPSA----- 744

Query: 815  TPTPHSAGDSEFIFETVNEEAEYTGNSSN----------DDKLYEVAD--------LDAA 856
             P  H  G        ++EE + T + +N          +++LY+V++         D  
Sbjct: 745  NPYSHING-------PLSEEIDLTEDIANMKNIENNNNNNNRLYDVSESAILLQGNDDDD 797

Query: 857  EKPSGMKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGK--AGLGIYQTSSPIEPQLL 914
            +       + +        ++TEP+  +  KLP L     K  +GLGIYQ    IEP + 
Sbjct: 798  DDDDNENDDGSQSIQSSVSNNTEPTTFV--KLPSLSSFQEKNASGLGIYQREPSIEPSI- 854

Query: 915  ERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPVME 974
                                         E+ IE   NV+ I ++   +D E++ +   E
Sbjct: 855  -----------------------------ESSIEPLPNVT-IAIEDVDEDGENEIQ--HE 882

Query: 975  KKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGLRR 1034
                 ++    + + + K ++                  E E  +   I A ++F+GL +
Sbjct: 883  NITTSLSNDNIKKNDDTKDTIREYSNVSFLKKFSKGKILELE--IHAKIPAERLFEGLHK 940

Query: 1035 LLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVL-IRKKSG 1093
            LL GW +YGLKN+   ++ M I+GKL +DNILSLRST FEI V  N +  S++   KK+G
Sbjct: 941  LLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTG 1000

Query: 1094 SSKAVLRLTTEIENIFSKEGVL 1115
            S+K + +L  EI+ +  KEGVL
Sbjct: 1001 STKTLKKLGYEIQIVLQKEGVL 1022

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1144 (42%), Positives = 639/1144 (55%), Gaps = 189/1144 (16%)

Query: 15   LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN--NNSAQSSSLTTPDALPY 72
            +GPWKLGETLG+GS GKV+LA ++ T  + A+K+ISKS+FN   N     S+     LPY
Sbjct: 18   IGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSV-----LPY 72

Query: 73   GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
             IEREI+IMKLL+HPNVL LYDVWETN+NLY++LEYAEKGELFNLLV++G L E+EA++ 
Sbjct: 73   NIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKC 132

Query: 133  FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 192
            FRQIII +SYCHALGIVHRDLKPENLLLD  YNIK+ADFGMAAL+T+  LLETSCGSPHY
Sbjct: 133  FRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPHY 192

Query: 193  AAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDD 252
            AAPEIVSG+PY GF+SDVWSCGVILFALLTGRLPFDEE+GNIR LLLKVQ G+FEMP D 
Sbjct: 193  AAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDT 252

Query: 253  EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSD 312
            EIS +AQDL++KIL VDP +RI+ RDIL HPLL++Y +IKDSKSI++LPREDTYL PL+D
Sbjct: 253  EISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLAD 312

Query: 313  NNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKEN----- 367
              + ID +ILQNLVVLWHGR  +EI +KLK  G N EKTLYALL RFK++S +E+     
Sbjct: 313  AGAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRR 372

Query: 368  FKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVVHNNL 427
             K ++ + R+  TSS         STP++R                      +S  H+N 
Sbjct: 373  HKTKKTKNRKFSTSSSLVKGRNLESTPRKR----------------------TSKTHSN- 409

Query: 428  XXXXXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQS------I 481
                          FS  KK S      NS NSSP P   +K  S+ N           I
Sbjct: 410  -------------NFSSGKKRSSFILSPNSINSSPIPLRNSKGISLRNATSGGSPVVPVI 456

Query: 482  L--XXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFAT 539
            L                 M N+K GS+T++L++ Y KL ++DDWE IEK+TKRTSS+FAT
Sbjct: 457  LLNSFKRNSKLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFAT 516

Query: 540  LIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQLQL 599
            LID        E    E+ ELA                                 ++++L
Sbjct: 517  LID--------EIFEPEEFELAKR-------------------------------EKVEL 537

Query: 600  QRQ-----MDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL------SKETVND--NLL 646
            QR+     M + I + R++    ++  +  N      VS PL       +E + D   LL
Sbjct: 538  QRKVRGSKMSDNIGD-RSEFTDGMKELKRINA----KVSSPLINYEFSQQELLQDIDTLL 592

Query: 647  RQR-NFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKL--DTEKMILETIRRSK 703
              R   S  TRPIS+LDPGL  +  +       +P +      L  DTE  I+ETI RSK
Sbjct: 593  TNRYQLSAYTRPISKLDPGLMPAAGT-------TPHDIKEQTALIRDTEVKIIETIHRSK 645

Query: 704  FLGSSFDINRELKAAEKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISD 763
            FLGS  ++ RE  + +   + P     + +              T  +     EV KISD
Sbjct: 646  FLGSLLNV-REGMSKDDDELAPIEESSIIST-------------TPLIYDDRTEVRKISD 691

Query: 764  IRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQR----TPTPH 819
            + VP FTRKSRHFT ++ R SVLS+YS+R SF +L  I KN E      QR    T +  
Sbjct: 692  VEVPHFTRKSRHFTAASNRRSVLSLYSSRDSFKDLSQISKN-EYSDSPSQRSVDDTSSSK 750

Query: 820  SAGDSEF---IFETVNEEAEYTGNS--SNDDKLYEVADLDAAEKPSGMKLNFADRFNKKE 874
              G +E    + E +++++    NS  ++D+ LY+V +    + P  +K +         
Sbjct: 751  KVGHTESLASVAEHIDDDSYNDHNSGMNSDNVLYDVPE--GVDLPQEVKNSDEQSSCSLV 808

Query: 875  EDSTEPSRDIQNKLPVLPPLDGK--AGLGIYQTSSPIEPQLLERPVKGDKFMETISSDNE 932
              S EP+  ++  LP L    GK  +GLGIYQ     EP                     
Sbjct: 809  SSSLEPTPVVE--LPSLSSFQGKNASGLGIYQR----EPS-------------------- 842

Query: 933  KPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPVMEKKPEVVAPKQRESDQEKK 992
                  K  +P A I+    V   E +  +K+ +HD   +    P+    +   +  E  
Sbjct: 843  ------KVSLPTATIDTSDAVENRETE-VKKELKHDS--IATNLPDDNVKENNNATAEAP 893

Query: 993  RSVXXXXXXXXXXXXXXXXXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSS 1052
              +                  E E  +   I  +++F+GL +LL GW +YGLK +   ++
Sbjct: 894  SRIKKSSNVSILKNISKGKILELE--IHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAA 951

Query: 1053 TMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVL-IRKKSGSSKAVLRLTTEIENIFSK 1111
             M I GKL +D+ILSLRST FEI V  NG+  S++   KK+GSSK + +L TEI+ I  K
Sbjct: 952  KMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQK 1011

Query: 1112 EGVL 1115
            EGVL
Sbjct: 1012 EGVL 1015

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/581 (64%), Positives = 438/581 (75%), Gaps = 50/581 (8%)

Query: 5   NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64
           +N+ S+KG ++GPW LGETLG+GSTGKV +A N  TG+ AA+K+ISKS+FN   +     
Sbjct: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
             PD LPYGIEREI IMKLLNHPNVLRLYDVWET+++LYMVLEY EKGELFNLL+E+GPL
Sbjct: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE 184
            E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLE
Sbjct: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186

Query: 185 TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
           TSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKVQSG
Sbjct: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRED 304
           EFEMP  DEIS EAQDL+AKILTVDP  RI+ R+ILKHPLL+KYPSIKDSKSIRNLPRED
Sbjct: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRED 306

Query: 305 TYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSE 364
           TYLNPL  N+ T+D+TIL+NLVVLWHGRD NEI+ KL E G N EKT YALL RFK ++E
Sbjct: 307 TYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENE 366

Query: 365 KENFKNEQIRKR-QSITSSVSRSPAKKAS---------TPQRRKNRISMISVSSSHKKPA 414
           ++  K +QI KR  S +SS  R+  K +S         TP  +K R S I+VSS+HK+P 
Sbjct: 367 QQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTP--KKKRSSGINVSSAHKRPV 424

Query: 415 SFNRLSSVVHNNLXXXXXXXXXXXXKKFSM-NKKLSMIADKSNSNNSS------------ 461
           S  +   +   N             KK S+ N+KLS I +  +S+ S             
Sbjct: 425 SIQKWGEIGGGN------NGLISPSKKRSLSNRKLSAILNTPSSSPSRKRMSIAQDAPPM 478

Query: 462 PTPAHR--NKRTSMINTDRQSILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSE 519
           PT   R  NKR S  N+ R S L                 ++KR SIT+K+IATYAKLSE
Sbjct: 479 PTSVLRDYNKRASR-NSKRFSFL----------------PSIKRQSITSKIIATYAKLSE 521

Query: 520 DDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 560
           D+DWEYI+KE KRTSSDFATLID IFEHEKYEQIR+EKE L
Sbjct: 522 DNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562

 Score =  231 bits (590), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 199/580 (34%), Positives = 273/580 (47%), Gaps = 103/580 (17%)

Query: 595  QQLQLQRQMDEEIENLRADLKGDVEPNQ----EKNEDNYRSVSVP-------------LS 637
            +Q +LQR +++E+  LRA+L+      Q     KN+   RSVS P             L+
Sbjct: 627  RQEELQRSLEDEVAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLA 686

Query: 638  KETVNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILE 697
             +   + +L +R  S+QTRPISRLDPG+    Q    E     +E +  + L  EK ILE
Sbjct: 687  LQYSINTVLNKRAVSVQTRPISRLDPGIM--AQEVAHELDYDDEEILSERTLRREKTILE 744

Query: 698  TIRRSKFLGSSFDINRELKAA-------------------------EKRVMQPPTVQKLT 732
            TIRRS FLGS FDI++ELK A                         ++R +   T     
Sbjct: 745  TIRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSA 804

Query: 733  TENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTR 792
             +   +  L +H      L    +E  K+S++R+P+ TR+SRH + S++R SVLSMYST 
Sbjct: 805  HDGYDTTSLTRHTT-VGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTM 863

Query: 793  QSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVAD 852
             S++NL D +K+      L   T +       EF+FE+  +  E    SSND+     + 
Sbjct: 864  TSYTNLADFMKSDVQLKPLND-TASSKVTQQPEFMFESTIDNVERI--SSNDN-----SH 915

Query: 853  LDAAEKPSG--MKLNFADRFNKKEE-------DSTEPS--RDIQN-KLPVLPPLD----G 896
            + + E P+   +KLN+ADRF K  E       D+T+P    DI   KLP LPPL+     
Sbjct: 916  ISSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKS 975

Query: 897  KAGLGIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPI 956
              GLGIYQ SSP E            F   + S      KE          E+P   +  
Sbjct: 976  PNGLGIYQHSSPRE-----------DFKHAVRSVTPNENKEN---------EDPAGTTQQ 1015

Query: 957  EVQKTRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXAETE 1016
            +   T   +E   R  +    +   PK+R S   K                      E +
Sbjct: 1016 KAPLTSVGKELGIREPLTDLAQQGVPKKRPSFFRK--------------FSKEKIKPEYD 1061

Query: 1017 KVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIK 1076
              L T +   ++F  L +LLNGW+ YGLK VRS  S   I+GKLSSDNILSLRST F++ 
Sbjct: 1062 YQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVV 1121

Query: 1077 VTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116
            V  +   SSV   KKSGS K   RL  EIE I  KE VL+
Sbjct: 1122 VAGSNHGSSVRFTKKSGSKKTFARLVNEIEKILEKEKVLI 1161

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/516 (69%), Positives = 408/516 (79%), Gaps = 45/516 (8%)

Query: 1   MTASNNLPS--IKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNS 58
           M    N PS  +KG+ +GPWKLGETLGLGSTGKVQLA+N +TG+QAAIKVISK+VFNN++
Sbjct: 1   MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDN 60

Query: 59  AQSS--SLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFN 116
           A +S  +L TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+SNLYMVLEYAEKGELFN
Sbjct: 61  ANASDSALLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFN 120

Query: 117 LLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 176
           LLVE+GPL E EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121 LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRN 236
           ETEDKLLETSCGSPHYAAPEI+SG+PYHG  +DVWSCG+ILFALLTGRLPFDEEDGNIRN
Sbjct: 181 ETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRN 240

Query: 237 LLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKS 296
           LLLKVQSG+FEMP +DEIS EAQDL++KILTVDP+KRI+ R+ILKHPL+QKYPSIKDSK+
Sbjct: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKT 300

Query: 297 IRNLPREDTYLNPLSDNN---STIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLY 353
           IRNLPREDTYLNPLSD+N     ID  ILQNLVVLWHGRD  EI  KLKEPGANAEKTLY
Sbjct: 301 IRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLY 360

Query: 354 ALLDRFKIDSEKENFKNEQIRKRQ--------------SITSSVSRSPAKKASTPQRRKN 399
           ALLDRFK D+EKE  +  Q++KRQ              S  S VSR      +TP +RKN
Sbjct: 361 ALLDRFKNDTEKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGAL--VNTPTKRKN 418

Query: 400 RISMISVSSSHKKPASFNRLSSV----------------VHNNLXXXXXXXXXXXXKKFS 443
           R SM+SVSS+HK+P SFNRLS                   H+ +            K+ S
Sbjct: 419 RASMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMS 478

Query: 444 M----NKKLSMIADKSNSNNSSPTPAHRNKRTSMIN 475
           +    NK++S +   +N  N+SPTP++  KR S+IN
Sbjct: 479 INLSSNKRISQLL--ANDLNTSPTPSNCTKRMSIIN 512

 Score =  274 bits (701), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 208/561 (37%), Positives = 287/561 (51%), Gaps = 117/561 (20%)

Query: 455  SNSNNSSPTPAHRNKRTSMINTD----------------RQSILXXXXXXXXXXXXXXVM 498
            +N  N++ T  + NKR S+INT                   S                V 
Sbjct: 558  TNDTNTNLTDINNNKRNSVINTKYTNPANSTQISTNGQTSDSAAQNVNRASRSQKRKSVR 617

Query: 499  ANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKE 558
             NM+RGSITTKLI+TYA+L+EDDDWE+IEKETKR SS+FATLID IFEHEKYEQIRKEK+
Sbjct: 618  PNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKD 677

Query: 559  ELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDV 618
            EL                                  ++LQLQ++M+ +I+N +  ++   
Sbjct: 678  ELERKVRENKKREEEERLVREAIEKEKQIELEK---ERLQLQKEMEGDIDNAKETVQT-T 733

Query: 619  EPNQEKNEDNY-----------------RSVSVPLSK-ETVNDNLL---RQRNFSLQTRP 657
            E  +E + D                   RSVS PL K E   D+     +QRNFSL+TRP
Sbjct: 734  EGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFDYSKQRNFSLRTRP 793

Query: 658  ISRLDPGLFFSEQSPTEEKPISPDEPVPN-------KKLDTEKMILETIRRSKFLGSSFD 710
            +SRLDPGL +S  S T     +P     +        ++DT+K+ILETIRRSKFLGSSFD
Sbjct: 794  VSRLDPGLMYS--SGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFD 851

Query: 711  INRELKAAE--------KRVMQPPTVQKL---------------------TTENKSSDE- 740
            + +EL+  E        ++  Q   ++++                     TT ++   E 
Sbjct: 852  LKKELEMVEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEI 911

Query: 741  LPKHAVG---TAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSN 797
            LPK   G   T  LN S+ +   +S+I+VPQFTRKS+ F+ SN+RLSVLS+YS+R+SF+N
Sbjct: 912  LPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTN 971

Query: 798  LVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAE 857
            LVD+LK      E  +R+PT  S  + EF+FE+ + +  Y+ +SS +DK     +     
Sbjct: 972  LVDMLKEDGINVEPTERSPTTKSQ-EPEFLFESPSVDT-YSRDSSTEDKPINEKENSEPI 1029

Query: 858  KPSGMKLNFADRFNKK--EEDS------------TEPSRDIQN----------------K 887
            + + ++L+F DRFN++   ED+             EP +D  N                K
Sbjct: 1030 QSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVK 1089

Query: 888  LPVLPPLDGKA--GLGIYQTS 906
            LP LPPL  K   GLGIYQ S
Sbjct: 1090 LPALPPLTTKKTDGLGIYQKS 1110

 Score =  105 bits (263), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 1019 LVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVT 1078
            L  N+AA Q+F GL  L  GWSKYGLKN++S   ++  +GK+SS+NILS +ST FE+++ 
Sbjct: 1292 LKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEII 1351

Query: 1079 SNGESSSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116
            SN   + +L  +K SGSSK+V RL  E+EN+  KEGVLL
Sbjct: 1352 SNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/930 (46%), Positives = 556/930 (59%), Gaps = 127/930 (13%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           +GPWKLGETLG GSTGKVQLA ++ TG++ A+KVI KS+F +  +  ++      LP+ I
Sbjct: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN---DSVLPFNI 74

Query: 75  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134
           EREI+IMKLL+HPNVL LYDVWET++NLY++LEYAEKGELFNLLV++GPL E+EAI+ F+
Sbjct: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194
           QIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGSPHYAA
Sbjct: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194

Query: 195 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254
           PEIVSG+PY GFASDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP++ EI
Sbjct: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN 314
           S +AQDL+ +IL VDP +RI+ RDIL HPLL+KY +IKDSKSI++LPRE+TYL PL+D +
Sbjct: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314

Query: 315 S----TIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKN 370
           +    TID +ILQNLV+LWHGR   EI+ KL++ G N EKTLYALL RFK++S KE    
Sbjct: 315 NHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKE---- 370

Query: 371 EQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVVHNNLXXX 430
                    T+  SRS   K     ++  R+S +S SSS    ++FN      H +L   
Sbjct: 371 ---------TNKRSRSKINKT----KKSKRVSTLSSSSS----SAFN------HQSLDSA 407

Query: 431 -XXXXXXXXXKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMI-----NTDR--QSIL 482
                     K F  ++K S     SNS + SP P   +KR S+      NT +   S L
Sbjct: 408 PRKHASRGHSKNFPSSRKRSSFILSSNSTDCSPIPLRSSKRISISSAVPGNTLQVPDSSL 467

Query: 483 XXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLID 542
                          M N+ RGS+TT L++ Y  L +DDDWEYI+K+TKRTSS+FATLID
Sbjct: 468 KLKRNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLID 527

Query: 543 EIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQLQLQRQ 602
           EIFE EK+E  ++EK EL                                  Q+ + Q  
Sbjct: 528 EIFEPEKFELAKREKAEL------------------------------QKKVQEAKRQVS 557

Query: 603 MDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL------SKETVN--DNLLRQR-NFSL 653
            +  I +   D+  +V     + +     VS PL       KE +   D LL  R   S 
Sbjct: 558 KNAPISD-EKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKELLQDIDTLLTNRYQLSS 616

Query: 654 QTRPISRLDPGLFFSEQSP-TEEKPISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDIN 712
            TRPISRLDPGL     +P T   P S  E     + DTE  I+ETIR+S+FLGS  ++ 
Sbjct: 617 YTRPISRLDPGL-----TPVTGAIPHSIKEKTALLQ-DTEMKIIETIRKSEFLGSLLNVR 670

Query: 713 RELKAAEKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRK 772
             +     ++       K++T              T  + +   E+ KISD+ VP FTRK
Sbjct: 671 EGISQDNNQLASIEVSPKIST--------------TPLMYNDQVEIRKISDVEVPHFTRK 716

Query: 773 SRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVN 832
           S+HFTT+N R SVLS+YS ++S  +L  I KN E  +     T    +A  SE +   V 
Sbjct: 717 SKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGST---DNASKSELV--DVI 771

Query: 833 EEAEYTGNSSNDDK-------------LYEVADLDAAEKPSGMKLNFADRFNKKEEDSTE 879
           EE     NS +D               LY+V   +  + P G  +N A         STE
Sbjct: 772 EEVTEQKNSQHDQDDSNDSNGMNNNNILYDVP--ECVDSPQGYDINDAHSTQSPASKSTE 829

Query: 880 PSRDIQNKLPVLPPLDGK--AGLGIYQTSS 907
           P   +  KLP L     K  +GLGIYQ  S
Sbjct: 830 PKPVV--KLPSLSSFQRKNASGLGIYQRES 857

 Score = 92.4 bits (228), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 1023 IAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGE 1082
            I+ +++++GL +LL GW +YGLKN+   ++ M ISGKL +D ILSLRST FEI +  NG 
Sbjct: 937  ISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGS 996

Query: 1083 SSSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
              S++   KK+GS+K + +  TEI+ I  KEGVL
Sbjct: 997  GRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
            Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1003 (45%), Positives = 571/1003 (56%), Gaps = 138/1003 (13%)

Query: 201  IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQD 260
            +PYHGF SDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSG+FEMP  DEIS EAQD
Sbjct: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 261  LLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNNSTIDKT 320
            L+AKILTVDP  RI++R+ILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL   N +ID++
Sbjct: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 321  ILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKNEQIR------ 374
            I+ NLVVLWHGRD NEI ++LKEPGAN EKT YALL RFK DS +E  K ++        
Sbjct: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189

Query: 375  -KRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVVHNNLXXXXXX 433
             KR ++ +SVSR       TP ++KN+  +IS SSSHK+P SFNRLS    NN       
Sbjct: 190  PKRSNMRNSVSRRSITNV-TP-KKKNKAPVISASSSHKRPVSFNRLS---FNNGSNTAHT 244

Query: 434  XXXXXXKKFSMN----KKLSMIADKSNSNNSSPTPAHRNKRTSMINTD------------ 477
                  K+ S+N    K++S + + +NS    PTP H  KR+SM + D            
Sbjct: 245  PPTSASKRASVNLSSNKRISALINPNNS----PTPVH--KRSSMRDLDASAPPIPMDMLK 298

Query: 478  --RQSILXXXXXXXXXXXXXXVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSS 535
               +S                 +   KRGSITTKLIATYAK+S+D+DWEYIEKET+RTS+
Sbjct: 299  DYNKSAPKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSA 358

Query: 536  DFATLIDEIFEHEKYEQIRKEKEELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQ 595
            DFATL DEIFEHEKYEQIRKEKEEL                                  +
Sbjct: 359  DFATLCDEIFEHEKYEQIRKEKEEL---------ERRVREAKEQEELERRQREEEERLQR 409

Query: 596  QLQLQRQM-------------DEEIENLRADLKGDVEPNQEKNEDNYRSVSVP------L 636
            +++LQ QM              E IE   A LK  V P    + ++ RSVS P      +
Sbjct: 410  EMELQHQMRLEEESRRRQRETQELIEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKV 469

Query: 637  SKETVNDN-------LLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKL 689
             K     N       LL +R FSL+TRP SRLDPG++ SE+     K    D       L
Sbjct: 470  DKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGAD-------L 522

Query: 690  DTEKMILETIRRSKFLGSSFDINREL---------KAA------EKRVMQPPTVQKLTTE 734
             TEK ILETIRRSKFLGSSFDIN+EL         +AA      E+RV    T   +   
Sbjct: 523  STEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEERVASNATTANVVGN 582

Query: 735  NKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQS 794
               S  LPK  +G+A   SS  E  KIS++ VPQFTR+SRHFT SN+RLSVLSMYST+ S
Sbjct: 583  GYESQTLPKRKMGSAMEASS--EPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTS 640

Query: 795  FSNLVDILKNTEAGTELGQRTPTPHSAGD--SEFIFETVNEEAEYTGNSSNDDKLYEVAD 852
            F+NL D LK  +A  +L Q +P   S  D  +EF+FE+V++E + T ++S D +LYEVA+
Sbjct: 641  FTNLADHLKG-KADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAE 699

Query: 853  L-DAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQN----KLPVLPPLDGK-----AGLGI 902
              DA      +KLNFADRFN+    ++ PS+D  +    KLP LPPLD       +GLG+
Sbjct: 700  TKDAKNAKPAVKLNFADRFNRP---TSPPSQDTDSSAAIKLPALPPLDKNKPNMVSGLGL 756

Query: 903  YQTSS--------PIEPQLLERPVKGDKFMETISSDNEKPEKEIKS-MIPEAVIEEPKNV 953
            YQ ++        P+   ++   V+ +   E  ++  E  E    S ++P A +    NV
Sbjct: 757  YQATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNV 816

Query: 954  SPIEVQKTRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXXXXXXA 1013
                    +K+ + D++P+ +  P V           +K++                   
Sbjct: 817  -------MKKNTDADRKPLSDITPAV-----------EKKANKSFFRKFSSKGSDEKKSG 858

Query: 1014 ETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNF 1073
            + +    T I   Q+F+ L +LL  W  YGLK+V +  S   I GKLSSDNILSLRST F
Sbjct: 859  DYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLF 918

Query: 1074 EIKVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116
             I V   GE S V   KKSGS+K   +L  EIE I   +  L+
Sbjct: 919  IITVVGRGEGSYVEFTKKSGSNKTFKKLVKEIEKILESKKALV 961

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/353 (75%), Positives = 306/353 (86%), Gaps = 7/353 (1%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           +GPWKLGETLG GSTGKVQLA ++ TG + A+KVISKS+FNNN   S+  +    LPY I
Sbjct: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS---VLPYNI 74

Query: 75  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134
           EREI+IMKLL+HPNVL LYDVWETN+NLY++LEYAEKGELFNLLV+ GPL E+EAI  FR
Sbjct: 75  EREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFR 134

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194
           QIIIGISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGSPHYAA
Sbjct: 135 QIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAA 194

Query: 195 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254
           PEIVSG+PY GFASDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP+D EI
Sbjct: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN 314
           S +AQDL+ KIL VDP +RI+ RDIL HPLL+KY +IKDSKSI++LPRE+TYL PL+D+N
Sbjct: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314

Query: 315 ----STIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDS 363
               ++ID +ILQNLVVLWHGR  ++I+SKLKE G N EK LYALL RFK+DS
Sbjct: 315 NHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367

 Score =  210 bits (534), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 213/708 (30%), Positives = 318/708 (44%), Gaps = 152/708 (21%)

Query: 455  SNSNNSSPTPAHRNKRTSMINTDRQSILXX---------XXXXXXXXXXXXVMANMKRGS 505
            SN  +SSP P   +KR + IN    +                          M N KR S
Sbjct: 433  SNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHKRNSKKRSSKRLSYMPNTKRSS 492

Query: 506  ITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELAXXXX 565
            +T+K ++ +  L +DDDWEYIEK+ KRTSS+FATLIDEIFE EK+E  ++EK EL     
Sbjct: 493  LTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQ 552

Query: 566  XXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQLQLQRQMDEEIENLRADLKGDVEPNQEKN 625
                                         Q +  Q+  ++E  +  +D   +++   +K 
Sbjct: 553  EAKR-------------------------QSVNAQKINEDEFGSEVSDGMKELKKINDKV 587

Query: 626  ED---NYRSVSVPLSKETVNDNLLRQR-NFSLQTRPISRLDPGLFFSEQSPTEEKPISPD 681
                 NY      L ++   D LL  R   S  TRPISRLDPGL           P++  
Sbjct: 588  SSPLINYEFSQQELLQDI--DTLLTNRYQLSSYTRPISRLDPGL----------TPVT-- 633

Query: 682  EPVPNKK-------LDTEKMILETIRRSKFLGSSFDINRELKAAEKR---VMQPPTVQKL 731
            E +PN          DTEK I+ETIRRSKFLGS  ++   L   +     + + P V   
Sbjct: 634  ETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSELAPIEESPIVST- 692

Query: 732  TTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYST 791
                            T  + +   E  +ISD+ VP FTRKS+HFTT+N R SVLS+Y+ 
Sbjct: 693  ----------------TPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA- 735

Query: 792  RQSFSNLVDILKNT------EAGTELGQRTPTP---HSAGDSEFIFETVNEEAEYTGNSS 842
            + S  +L + L         +  T+   R+  P    S  DS  I    +E+    G++ 
Sbjct: 736  KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI--QYDEDDSKDGDNV 793

Query: 843  NDDKLYEVADLDAAEKPSGMKLNFADRFNKKEED--------STEPSRDIQNKLPVLPPL 894
            N+D +        ++ P G+ +  +  ++ K+++        S EP+  +  KLP L   
Sbjct: 794  NNDNIL-------SDFPQGVGI--SQEYDMKDKNPNQSPISKSAEPTLVV--KLPSLSSF 842

Query: 895  DGK--AGLGIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKN 952
             GK  +GLG+YQ     EP  +  P        +++S+N    + I+    +    E   
Sbjct: 843  QGKNASGLGLYQR----EPSKVTLP--------SLTSNNSSVGENIEDGAEKGTESEKIA 890

Query: 953  VS----PIEVQKTRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVXXXXXXXXXXXXX 1008
             S     ++    +KD +    P   KKP    P      +  K  +             
Sbjct: 891  ASLSDDDLKEDNDKKDNDTVNAPTTVKKP----PNSVLLKKFSKGKI------------- 933

Query: 1009 XXXXAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSL 1068
                   E  +   I  +++++GL +LL GW +YGLKN+    + M I+GKL +D+IL L
Sbjct: 934  ------LELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFL 987

Query: 1069 RSTNFEIKVTSNGESSSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVL 1115
            RST FEI V  NG+  S++   KK+GS+K + +L TEI+ I  KEGVL
Sbjct: 988  RSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVL 1035

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  412 bits (1058), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/385 (54%), Positives = 270/385 (70%), Gaps = 16/385 (4%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           D +GPWKLG+TLG GS+G+V+LA N  TGK AAIK++ K    +N+ Q +SL      PY
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTSL------PY 112

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
           GIEREIIIMKL++HPNV+ LY+VWE    LY+VLEY E GELF+ L+ +G L EQEA+ +
Sbjct: 113 GIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVHY 172

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPH 191
           F+QI+ G+SYCH   I HRDLKPENLLLD K  ++KIADFGMAALET DKLLETSCGSPH
Sbjct: 173 FKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGSPH 232

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQSG+++MP +
Sbjct: 233 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMPQN 290

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLS 311
             IS+EA+DL+AKIL VDP  RI   ++L+HPLL KY   + SKS  NL   D+  N + 
Sbjct: 291 --ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPNIVV 347

Query: 312 -DNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKN 370
            ++   ID++IL NL +LWHG     +  KL + G   EK  Y+LL R++   E++    
Sbjct: 348 LESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ---ERQKLPE 404

Query: 371 EQIRKRQSITSSVSRSPAKKASTPQ 395
               K  S  + + ++ +  A TPQ
Sbjct: 405 ASQPKPLSSLAPLRKTGSSNADTPQ 429

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  403 bits (1035), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 250/351 (71%), Gaps = 26/351 (7%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           D +GPWKLG+TLG GS+G+V+LA N  TGK AA+K++ K+            + P+ALPY
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT----------KSSRPNALPY 102

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
           GIEREIIIMKL++HPNV+ LY+VWE    L++VLEY + GELF+ LV +G L E+EAI +
Sbjct: 103 GIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHY 162

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPH 191
           FRQII G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGSPH
Sbjct: 163 FRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPH 222

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YA+PEIV G  Y+G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ+G+++MP  
Sbjct: 223 YASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP-- 278

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLS 311
             IS EAQDL+++IL VDP KRI   DIL HPL+ KY   K SKS  +L      L+  S
Sbjct: 279 QAISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKSNSDL----HILSHTS 333

Query: 312 DNNSTI------DKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALL 356
               TI      D TILQNL +LWHG   + I+ +L EP    EKT Y+LL
Sbjct: 334 PQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLL 384

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  408 bits (1048), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/352 (57%), Positives = 251/352 (71%), Gaps = 16/352 (4%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           D +GPWKLG+TLG GS+G+V+LA N  +GK AAIK++ K    +N  Q +      ALPY
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVT------ALPY 109

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
           GIEREIIIMKL+ HPN++ LY+VWE  S LY+VLEY E GELF+ L+ +G L EQEAI +
Sbjct: 110 GIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHY 169

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPH 191
           F+QI+ G+SYCH   I HRDLKPENLLLD K   +KIADFGMAALET ++LLETSCGSPH
Sbjct: 170 FKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSPH 229

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D N+R LLLKVQ G ++MPS+
Sbjct: 230 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMPSN 287

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNP-L 310
             +S EA+DL++KIL VDPEKRI    IL+HPLL KY +    K     P E     P +
Sbjct: 288 --VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDN--PGKGGLACPLEKPEERPKV 343

Query: 311 SDNNST--IDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
            D +S   ID+TIL NL +LWHG     ++ KL + G   EK  YALL R++
Sbjct: 344 LDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  407 bits (1046), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 200/351 (56%), Positives = 251/351 (71%), Gaps = 9/351 (2%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           D +GPWKLG+TLG GS+G+V+LA N  TGK AAIK++ K V  + +A   S      LPY
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAANGNLPY 115

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
           GIEREIIIMKL++HPN++ LY+VWE  S L++VLEY E GELF+ LV KG L EQEA+ +
Sbjct: 116 GIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVHY 175

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPH 191
           FRQII G++YCH   I HRDLKPENLL+D K + IKIADFGMAALET +KLLETSCGSPH
Sbjct: 176 FRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGSPH 235

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQSG++ MP +
Sbjct: 236 YASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHMPQN 293

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI--KDSKSIRNLPREDTYLNP 309
             IS EAQDL++KIL VDP  RI   ++L+HPL+ KY     K +  +  L R    +  
Sbjct: 294 --ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQLVTL 351

Query: 310 LSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
            S  +  ID +IL NL +LWHG     I+++L + G   EK  Y+LL +++
Sbjct: 352 QSKED--IDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  402 bits (1033), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 198/350 (56%), Positives = 249/350 (71%), Gaps = 14/350 (4%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           D +GPWKLG+TLG GS+G+V+LA N  TGK +AIK++ K    +N  +         LPY
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ--------LPY 119

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
           GIEREIIIMKL++HPNV+ LY+VWE  S LY+VLEY E GELF+ LV KG L E EAI +
Sbjct: 120 GIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHY 179

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLD-HKYNIKIADFGMAALETEDKLLETSCGSPH 191
           F+QI+  ++YCH   I HRDLKPENLLLD  K +IKIADFGMAALET DKLLETSCGSPH
Sbjct: 180 FKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCGSPH 239

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQSG+++MP  
Sbjct: 240 YASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP-- 295

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLS 311
             +S EA+DL+++IL VDP +RI    IL+H LL KY     SKS  +L   +   N +S
Sbjct: 296 QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPNIVS 355

Query: 312 -DNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
             +   ID+TIL NL +LWHG     ++++L +PG   EK  Y+LL  ++
Sbjct: 356 FSSERDIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQ 405

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  397 bits (1021), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/383 (54%), Positives = 270/383 (70%), Gaps = 42/383 (10%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VF---NNNSAQSSSLTTPD 68
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K+ +F   N+NS Q SS ++ D
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 69  ALP--------------YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGEL 114
             P              YGIEREI+IMKL++HPNV+ LY+VWE  S L++VLEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 115 FNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 173
           F+ LV +G L E+EA+ +F+QII G+SYCH+  I HRDLKPENLLLD K N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN 233
           AALE  +KLL TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 234 IRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKD 293
           I+ LLLKVQSG+F+MP +  IS EA+DL+++IL VDPEKRI+  DIL HPL++KY   +D
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKY---ED 379

Query: 294 SKSIRN-------LPREDTYLNPLSDNNST---------IDKTILQNLVVLWHGRDVNEI 337
           +K+  N         + ++ L+ L+D   +         ID++IL+NL +LWHG     I
Sbjct: 380 NKTDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELI 439

Query: 338 ISKLKEPGANAEKTLYALLDRFK 360
           ISKL +   + EK  Y+LL ++K
Sbjct: 440 ISKLLQTPMSEEKLFYSLLLQYK 462

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  395 bits (1014), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/392 (52%), Positives = 265/392 (67%), Gaps = 48/392 (12%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISK--SVFNNNSA----------- 59
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K  +V   N A           
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 60  --QSSSLTTPDAL-------------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYM 104
             Q+S++    A              PYGIEREI+IMKL++H NVL LY+VWE  S LY+
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 105 VLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKY 164
           VLEY + GELF+ LV +G L E+EA+ +F+QII G+SYCHA  I HRDLKPENLLLD K 
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 165 N-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTG 223
           + IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 224 RLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHP 283
            LPF+  D +I+ LLLKVQSG+++MP +  +S EAQDL+AKILTV+P KR+   +IL+HP
Sbjct: 314 HLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 284 LLQKYPSIKDSKSIRNL------PREDTYLNPLSDNNST---------IDKTILQNLVVL 328
           L+ KY S+  +K  + L       + +  L+ L++  +T         ID TIL NL +L
Sbjct: 370 LIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQIL 429

Query: 329 WHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
           WHG     I++KL +P  + EK  Y+LL ++K
Sbjct: 430 WHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  392 bits (1006), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 250/352 (71%), Gaps = 28/352 (7%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           D +GPWKLG+TLG GS+G+V+LA N  TGK AAIK++ K+     S+++ SL      PY
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKT----KSSRTGSL------PY 102

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
           GIEREIIIMKL++HPNV+ LY+VWE    L++VLEY + GELF+ LV +G L E+EAI +
Sbjct: 103 GIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHY 162

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPH 191
           FRQII G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGSPH
Sbjct: 163 FRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPH 222

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YA+PEIV G  Y+G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ+G+++MP  
Sbjct: 223 YASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP-- 278

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL-------PRED 304
             +S  AQDL+++IL VDP+KRI   +IL HPLL KY + K SKS  +L       P+  
Sbjct: 279 QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKSNSDLHILSHSKPQIS 337

Query: 305 TYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALL 356
           T       + S +D TILQNL +LWHG     I+  L +P    EKT Y+LL
Sbjct: 338 TI-----KSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLL 384

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  397 bits (1021), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/385 (52%), Positives = 256/385 (66%), Gaps = 45/385 (11%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSS---SL----- 64
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K+  +    Q S   SL     
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 65  ---------TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELF 115
                    T P    YGIEREI+IMKL++HPNV+ LY+VWE  S LY+VLEY + GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 116 NLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMA 174
           + LV +G L E+EA+ +F+QII G++YCHA  I HRDLKPENLLLD K   IKIADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 175 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNI 234
           ALE  DKLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 235 RNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYP----- 289
           + LLLKVQSG + MPSD  +S +A+DL++KIL VDP+KR+   +IL H L+ KY      
Sbjct: 306 KKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 290 --------SIKDSKSIRNLPREDTYLNPLSD------NNSTIDKTILQNLVVLWHGRDVN 335
                   S+   KS  NL     ++N LS+      N   ID +IL NL +LWHG   +
Sbjct: 364 NRNYNNNLSMARDKSNSNL----NFINNLSNVDILLQNPCDIDTSILSNLQILWHGESKH 419

Query: 336 EIISKLKEPGANAEKTLYALLDRFK 360
            II KL +P  N EK  Y+LL ++K
Sbjct: 420 AIIDKLLQPNMNEEKLFYSLLLKYK 444

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  395 bits (1014), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 218/465 (46%), Positives = 292/465 (62%), Gaps = 62/465 (13%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISK--------------------- 51
           D +GPWKLG+TLG GS+G+V+LA N  TGK AAIK++ K                     
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 52  ----SVFNNNSAQSSSLTTPDAL-------PYGIEREIIIMKLLNHPNVLRLYDVWETNS 100
               S+ N  +  ++  T   A+       PYGIEREI+IMKLL+HPNV+ LY+VWE N+
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNN 208

Query: 101 NLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL 160
            LY+VLEY + GELF+ LV KG L E EA+ +F+QII GISYCH+  I HRDLKPENLLL
Sbjct: 209 ELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLL 268

Query: 161 DHKYN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFA 219
           D K   IKIADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  SD+WSCG+ILFA
Sbjct: 269 DKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFA 328

Query: 220 LLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDI 279
           LLTG LPF+  D NI+ LL+KVQ+G ++MPS   IS EA++L+++IL VDP KRI    I
Sbjct: 329 LLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTEQI 384

Query: 280 LKHPLLQKYP---SIKDSKSIRN-----LPREDTYLNPLSD-----------NNSTIDKT 320
           L HPLL KY      KD K  +N       + ++ LN LS+             S ID++
Sbjct: 385 LSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRARSDIDES 444

Query: 321 ILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKNEQIRKRQSIT 380
           IL+NL +LWHG   + II+KL +   + EK +Y+LL ++K    + NFK+ +     S +
Sbjct: 445 ILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK----QINFKSSKAPSISSAS 500

Query: 381 SSVSRSPAKKASTPQRRKNRISM--ISVSSSHKKPASFNRLSSVV 423
            ++S S     ++   R N  S   IS+   + +P  FN+++ VV
Sbjct: 501 VNISVSAQDTETSTNTRTNSNSATDISIPFVNTEPLQFNKINPVV 545

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  393 bits (1010), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/389 (51%), Positives = 268/389 (68%), Gaps = 45/389 (11%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISK-----SVFNNNS---AQSSSL 64
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K        NN +   + SSS+
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSM 135

Query: 65  TTPDAL----------------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEY 108
            T +                  PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 VTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 109 AEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIK 167
            + GELF+ LV KG L E+EAI +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 168 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPF 227
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 228 DEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +  D NI+ LLLKVQSG+++MPS+  +S EA+DL++KIL +DPEKRI  ++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 288 YPSIKDSKSIRNLPREDT----------YLNPLSDNNST------IDKTILQNLVVLWHG 331
           Y  +  +K +R + +++            LN +S +  T      ID++IL++L +LWHG
Sbjct: 372 YDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHG 431

Query: 332 RDVNEIISKLKEPGANAEKTLYALLDRFK 360
                I +KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  389 bits (1000), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/381 (54%), Positives = 262/381 (68%), Gaps = 37/381 (9%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISK-------------SVF----N 55
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K             S F    N
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 56  NNSAQSSSLTTP---------DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVL 106
           +NS  S+  T+P            PYGIEREI+IMKL++HPNV+ LY+VWE  S LY+VL
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVL 215

Query: 107 EYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YN 165
           EY + GELF+ LV KG L E+EA+ +F+QII G+SYCH+  I HRDLKPENLLLD K  +
Sbjct: 216 EYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS 275

Query: 166 IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRL 225
           IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG L
Sbjct: 276 IKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHL 335

Query: 226 PFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           PF+  D NI+ LLLKVQ+G+F MPS   +S EAQDL+++IL +DP KRI    IL HPL+
Sbjct: 336 PFN--DDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

Query: 286 QKY-PSIKD---SKSIRNLP-REDTYLNPLS-DNNSTIDKTILQNLVVLWHGRDVNEIIS 339
            KY P+ K+    KS  +L   E     P+S  + + ID +IL+NL +LWHG     II+
Sbjct: 392 LKYEPAGKNMVSGKSNSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTSRELIIA 451

Query: 340 KLKEPGANAEKTLYALLDRFK 360
           KL +   + EK  Y+LL ++K
Sbjct: 452 KLLQTPMSEEKLFYSLLWQYK 472

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  390 bits (1002), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 266/389 (68%), Gaps = 45/389 (11%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVI-SKSVFNNNS-------AQSSSL 64
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++  K  F + S       + SSS+
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 65  TTPDAL----------------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEY 108
            T +                  PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 109 AEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIK 167
            + GELF+ LV KG L E+EAI +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 168 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPF 227
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 228 DEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +  D NI+ LLLKVQSG+++MP +  +S EA+DL++KIL +DP KRI  ++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 288 YPSIKDSKSIRNLPREDT----------YLNPLSD------NNSTIDKTILQNLVVLWHG 331
           Y  +  +K +R + R++            LN +S       + S ID++IL++L +LWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 332 RDVNEIISKLKEPGANAEKTLYALLDRFK 360
                I +KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  388 bits (997), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 263/377 (69%), Gaps = 34/377 (9%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVF-----NNNSAQ--SSSLT 65
           D +GPWKLG+TLG GS+G+V+LA N   G+ AAIK++ K+       +N S+   S++LT
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 66  TPDAL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGEL 114
           T  ++           PYGIEREI+IMKL++H NV+ L++VWE  ++L++VLEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 115 FNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 173
           F+ LV KG L E EA+ +F+QII G+++CH+  I HRDLKPENLLLD K   IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN 233
           AALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 234 IRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKD 293
           IR LLLKVQSG F +P +  IS EAQDL+AKIL V+P +RI+  DILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 294 SKSIRNLPRED-TYLNP---LSDNN------STIDKTILQNLVVLWHGRDVNEIISKLKE 343
            K    +P    T LN    L+ NN      + ID++IL+NL +LWHG     II+KL +
Sbjct: 379 VK-FNQVPNPSATNLNSEHMLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQ 437

Query: 344 PGANAEKTLYALLDRFK 360
              +AEK  Y+LL ++K
Sbjct: 438 YPMSAEKIFYSLLWQYK 454

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  387 bits (993), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 268/389 (68%), Gaps = 45/389 (11%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVI-SKSVF----NNNS---AQSSSL 64
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++  K  F    NN +   + SSS+
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 65  TTPDAL----------------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEY 108
            T +                  PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 109 AEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIK 167
            + GELF+ LV KG L E+EAI +F+QI+ G+S+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 168 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPF 227
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 228 DEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +  D NI+ LLLKVQSG+++MP +  +S EA+DL++KIL ++PEKRI  ++IL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 288 YPSIKDSKSIRNLPREDT----------YLNPLSDNNST------IDKTILQNLVVLWHG 331
           Y ++  +K IR + R++            LN +S +  T      ID++IL++L +LWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 332 RDVNEIISKLKEPGANAEKTLYALLDRFK 360
                I +KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  385 bits (988), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 272/390 (69%), Gaps = 47/390 (12%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISK-----------SVFNNNSAQ- 60
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K           +V N+ S+  
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 61  -SSSLTTPDAL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEY 108
            +S++++P  +           PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 109 AEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIK 167
            + GELF+ LV +G L E+EAI +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 168 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPF 227
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 228 DEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +  D NI+ LLLKVQSG+++MP +  +S EA++L++KIL +DPEKRI  ++IL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 288 YPSIKDSKSIRNLP-------REDTYLNPLSDNNST----------IDKTILQNLVVLWH 330
           Y ++  +K +R +        + ++ L+ L DN S           ID++IL++L +LWH
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLH-LLDNVSPSIVTLNTKNEIDESILRSLQILWH 430

Query: 331 GRDVNEIISKLKEPGANAEKTLYALLDRFK 360
           G     I +KL +   + EK  Y+LL R+K
Sbjct: 431 GVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  383 bits (984), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/399 (49%), Positives = 258/399 (64%), Gaps = 56/399 (14%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNN--------------- 57
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K    N+               
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 58  ------------------SAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN 99
                             +A +     P A PYGIEREI+IMKL++H N+L LY+VWE  
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVP-ANPYGIEREIVIMKLISHSNILGLYEVWENK 214

Query: 100 SNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLL 159
           S LY+VLEY + GELF+ LV +G L E+EA+ +F+QI+ G+SYCH+  I HRDLKPENLL
Sbjct: 215 SELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLL 274

Query: 160 LDHK-YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILF 218
           LD K  +IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG+ILF
Sbjct: 275 LDKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILF 334

Query: 219 ALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARD 278
           ALLTG LPF+  D NI+ LLLKVQSG+F MP +  +S EA+DL++KIL V+P KRI   +
Sbjct: 335 ALLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEE 390

Query: 279 ILKHPLLQKYPS----IKDSKSIRNLP----REDTYLNPLSDNNST---------IDKTI 321
           IL HPLL KY      +K   S+  +     + ++ L+ L  +NS          ID +I
Sbjct: 391 ILNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSI 450

Query: 322 LQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360
           + NL +LWHG     I++KL +P  + EK  Y+LL  +K
Sbjct: 451 VSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  379 bits (972), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/399 (49%), Positives = 252/399 (63%), Gaps = 59/399 (14%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN----------------- 55
           D +GPWKLG+TLG GS+G+V+LA N   G  AAIK++ K  +N                 
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSG 147

Query: 56  NNSAQSSSLTTP------DAL-PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEY 108
            +S  SS+   P       AL PYGIEREI+IMKL++HPNV+ L +VWE  S LY+VLEY
Sbjct: 148 TDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEY 207

Query: 109 AEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IK 167
            + GELF+ LV KG L E EA+ +F QII G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 208 VDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIK 267

Query: 168 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPF 227
           IADFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFALLTG LPF
Sbjct: 268 IADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

Query: 228 DEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +  D NI+ LLLKVQ+G F++P    ++++A+DL+ +IL  +PEKR+   +IL HPL++K
Sbjct: 328 N--DDNIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEKRLTINEILNHPLIKK 383

Query: 288 YPSIKDSKSIRNLPREDTYLNPLSDNNST---------------------IDKTILQNLV 326
           Y         RN P     LN L    S                      ID++IL++L 
Sbjct: 384 Y---------RNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQ 434

Query: 327 VLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEK 365
           +LWHG     ++ +L   GA  EK  Y+LL ++K+   K
Sbjct: 435 ILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKLKHSK 473

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  357 bits (917), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/430 (44%), Positives = 258/430 (60%), Gaps = 88/430 (20%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSV---FNN------------- 56
           D +GPWKLG+TLG GS+G+V+LA NK TG+ AAIK++ KS    FNN             
Sbjct: 91  DMIGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYD 150

Query: 57  -----------NSAQSSSLTTPDALP----------------------------YGIERE 77
                      N +  S L  P  L                             YGIERE
Sbjct: 151 NKPHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIERE 210

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           I+IMKL++HPNV+ LY+VWE  + LY+VLEY + GELF+ LV KG L E EA+R+F+QII
Sbjct: 211 IVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQII 270

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMAALETEDKLLETSCGSPHYAAPE 196
            G+ YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+  + LL+TSCGSPHYA+PE
Sbjct: 271 RGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPE 330

Query: 197 IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISH 256
           IV G  Y+G  SDVWSCG+ILFALLTG LPF+  D +I+ LL+KVQ+G ++MP  + +S 
Sbjct: 331 IVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP--NYLSK 386

Query: 257 EAQDLLAKILTVDPEKRIRARDILKHPLLQKY--------------------------PS 290
           +A+DL+++IL V+P+ R+    IL+HPL+ KY                           S
Sbjct: 387 DAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLMRGKS 446

Query: 291 IKDSKSIRNLPREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEK 350
             D   ++N+P +   +   S N+  ID +IL+NL +LW+G     +ISKL +   + EK
Sbjct: 447 NTDLAILQNIPDKTDIIQLRSRND--IDDSILRNLQILWNGVPRETLISKLIQDPVSEEK 504

Query: 351 TLYALLDRFK 360
            +Y+LL ++K
Sbjct: 505 LIYSLLWQYK 514

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  329 bits (843), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 174/335 (51%), Positives = 230/335 (68%), Gaps = 16/335 (4%)

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
           YGIEREI+IMKL++HPNV+ LY+VWE  S LY++LEY + GELF+ LV +G L E EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLL-LDHKYNIKIADFGMAALETEDKLLETSCGSP 190
           +F+QII G+SYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 191 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPS 250
           HYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ+G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 251 DDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY-PSIKDSKSIRNLPREDTY-LN 308
           +  +S EA+DL+++IL V P KR+   +IL HPL+ KY  S K    ++     D + L+
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 309 PLSDNNST------IDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKID 362
            +S  N T      ID++IL+NL +LWHG   + II+KL +   + EK  Y+LL ++K  
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYKQR 492

Query: 363 SEKENFKNEQIRKR---QSITSSVSRSPAKKASTP 394
              +       R+     +I SS+S +P K+ + P
Sbjct: 493 HSAKPVVKPAERESLPTATIISSLSHTPMKQKNLP 527

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 32/39 (82%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISK 51
           D +GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  239 bits (611), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 110/120 (91%), Positives = 116/120 (96%)

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGI 140
           MKLL+H NVLRLYDVWETNSNLYMVLEY EKGELFNLLVE+GPL E EA+RFFRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 141 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 200
           SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++DKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  248 bits (633), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 186/280 (66%), Gaps = 17/280 (6%)

Query: 3   ASNNLPSIK-GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQS 61
            SN + S+  G ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q 
Sbjct: 23  VSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQG 82

Query: 62  SSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEK 121
                       IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++
Sbjct: 83  R-----------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQR 130

Query: 122 GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 181
             + EQEA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+  
Sbjct: 131 NKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN 190

Query: 182 LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 241
            L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +
Sbjct: 191 FLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNI 248

Query: 242 QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILK 281
            +G + +P    +S  A DL+ ++L V+P  RI   +I++
Sbjct: 249 SNGVYTLPK--FLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  246 bits (627), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 181/275 (65%), Gaps = 16/275 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA + TT ++ A+K+I+K V + +  Q           
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR--------- 74

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA+  ELF+ +V++  + E E  R
Sbjct: 75  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGRR 131

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+   L+TSCGSP+
Sbjct: 132 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSPN 191

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ LL  RLPFD+E  +I  L   + +G + +P  
Sbjct: 192 YAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP-- 247

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
           + +S  A  L+ K+L V+P  RI   DI++ P  +
Sbjct: 248 NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  245 bits (626), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 99

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + EQEA R
Sbjct: 100 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 156

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 157 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 216

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 273

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 274 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  245 bits (625), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 99

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + EQEA R
Sbjct: 100 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 156

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 157 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 216

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 273

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 274 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  244 bits (624), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 90

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA R
Sbjct: 91  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARR 147

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 148 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 207

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 208 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK- 264

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ K+L V+P  RI  ++I++
Sbjct: 265 -FLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  245 bits (626), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 181/270 (67%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I++ V   +  Q           
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR--------- 88

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA+  ELF+ +V++  + EQEA R
Sbjct: 89  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADN-ELFDYIVQRDKMSEQEARR 145

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 146 FFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 205

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 206 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTLPR- 262

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ K+L V+P  RI   +I++
Sbjct: 263 -FLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  244 bits (624), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 50  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 100

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + EQEA R
Sbjct: 101 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 157

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 158 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 217

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 218 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 274

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 275 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  243 bits (621), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 180/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA + TTG++ A+K+I++ V + +  Q           
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR--------- 86

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP+++RLYDV ++   + M++EYA   ELF+ +V++  + E EA +
Sbjct: 87  --IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEARK 143

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+   L+TSCGSP+
Sbjct: 144 FFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGSPN 203

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP-- 259

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
           + +S  A  L+ K+L V+P  RI   +I++
Sbjct: 260 NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  243 bits (619), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 178/270 (65%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 48  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 98

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA R
Sbjct: 99  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDEARR 155

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 156 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 215

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 216 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSLPK- 272

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 273 -FLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  240 bits (612), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 154/402 (38%), Positives = 233/402 (57%), Gaps = 30/402 (7%)

Query: 11  KGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDAL 70
           +G  +G +++ +TLG GS GKV+LA++ +TG++ A+K+I+K V   +  Q          
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR-------- 79

Query: 71  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAI 130
              IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + EQEA 
Sbjct: 80  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEAR 135

Query: 131 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 190
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 136 RFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 195

Query: 191 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPS 250
           +YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P 
Sbjct: 196 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTIP- 252

Query: 251 DDEISHEAQDLLAKILTVDPEKRIRARDILKHPL----LQKYPSIKDSKSIRNLPREDTY 306
            + +S  A  L+ K+L V+P  RI   +I++       L  Y    +S    N   +   
Sbjct: 253 -NFLSQGAASLIKKMLIVNPVNRITVHEIMQDEWFKVDLPDYLVPAESTHQENSESKTED 311

Query: 307 LNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKE 366
             P S     ID +++Q L     G DV+EI   L+        +L  + D +++  E  
Sbjct: 312 GGP-SVPLELIDDSLVQTLSNTM-GYDVDEIYEALE--SDEDHPSLNEIRDAYQLIKENR 367

Query: 367 NFKNE-QIRKRQS--ITSSVSRSPA---KKASTPQRRKNRIS 402
           N  N+ ++ K+QS  + + +S+SP    +    P   KNR S
Sbjct: 368 NLINDIKVNKQQSNDLDTFLSQSPPTFEQSLHAPPGSKNRHS 409

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  239 bits (611), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 180/275 (65%), Gaps = 16/275 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ TT ++ A+K+I+K V   +  Q           
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR--------- 89

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + +V+E+A   ELF+ ++++  + EQEA R
Sbjct: 90  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEARR 146

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 147 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPN 206

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 207 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPK- 263

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
             +S  A +L+ K+L V+P  RI   +I K    Q
Sbjct: 264 -FLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  238 bits (607), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 181/270 (67%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ TT ++ A+K+I+K +   +  Q           
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR--------- 86

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++  ++ MV+EYA+  ELF+ +V++  + E EA +
Sbjct: 87  --IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEARK 143

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 144 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSPN 203

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   + +G + +P  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLPK- 260

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A +L+ ++L V+P  RI   +I++
Sbjct: 261 -FLSPGAANLIKRMLIVNPLNRISMNEIME 289

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  238 bits (607), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LAH+ +TG++ A+K+I+K V   +  Q           
Sbjct: 33  GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--------- 83

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA R
Sbjct: 84  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARR 140

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 141 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 200

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 201 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK- 257

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A +L+ ++L V+P  RI   +I++
Sbjct: 258 -FLSQGAANLIKRMLIVNPLNRITIHEIME 286

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  238 bits (607), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------- 86

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E+EA R
Sbjct: 87  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEARR 143

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 144 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 203

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 260

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 261 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  239 bits (611), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 184/289 (63%), Gaps = 17/289 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 105

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA R
Sbjct: 106 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEARR 162

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 163 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 222

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 223 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK- 279

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ-KYPSIKDSKSIRN 299
             +S  A  L+ ++L V+P  RI   +I++    +   P    S+ +RN
Sbjct: 280 -FLSQGASSLIKRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  238 bits (606), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 118/270 (43%), Positives = 179/270 (66%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K +   +  Q           
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR--------- 93

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + +V+E+A   ELF+ ++++  + E EA R
Sbjct: 94  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEARR 150

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 151 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPN 210

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 211 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPK- 267

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 268 -FLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  237 bits (604), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/269 (44%), Positives = 176/269 (65%), Gaps = 16/269 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ TT ++ A+K+I+K V   +  Q           
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGR--------- 112

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             +EREI  ++LL HP++++LYDV ++   + MV+EYA   ELF  +V++  + E EA +
Sbjct: 113 --VEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEARK 169

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 170 FFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSPN 229

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   + +G + +P  
Sbjct: 230 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLPK- 286

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDIL 280
             +S  A +L+ K+L V+P  RI   +I+
Sbjct: 287 -FLSEGAANLIKKMLIVNPLNRISMTEII 314

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  236 bits (603), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 178/270 (65%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G  +G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q           
Sbjct: 45  GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR--------- 95

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E+EA R
Sbjct: 96  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEARR 152

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 153 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 212

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 213 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 269

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A  L+ ++L V+P  RI   +I++
Sbjct: 270 -FLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  235 bits (600), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 178/268 (66%), Gaps = 16/268 (5%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q             
Sbjct: 28  RIGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR----------- 76

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA RFF
Sbjct: 77  IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRFF 135

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
           +QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+YA
Sbjct: 136 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 195

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P    
Sbjct: 196 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK--F 251

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILK 281
           +S  A +L+ ++L V+P  RI   +I++
Sbjct: 252 LSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  234 bits (598), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 179/268 (66%), Gaps = 16/268 (5%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q             
Sbjct: 26  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E+EA RFF
Sbjct: 75  IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARRFF 133

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
           +QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+YA
Sbjct: 134 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 193

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P    
Sbjct: 194 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLPK--F 249

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILK 281
           +S  A +L+ ++L V+P  RI   +I++
Sbjct: 250 LSPGAANLIKRMLIVNPLNRITIHEIME 277

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  234 bits (597), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 177/268 (66%), Gaps = 16/268 (5%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +++ +TLG GS GKV+LA++ TTG++ A+K+I+K V   +  Q             
Sbjct: 27  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 75

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA RFF
Sbjct: 76  IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
           +QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L TSCGSP+YA
Sbjct: 135 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPNYA 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P    
Sbjct: 195 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLPK--F 250

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILK 281
           +S  A +L+ ++L V+P  RI   +I++
Sbjct: 251 LSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  233 bits (594), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 178/270 (65%), Gaps = 16/270 (5%)

Query: 12  GDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
           G ++G +++ +TLG GS GKV+LA++ +T ++ A+K+I+K V   +  Q           
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------- 87

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V++  + E EA R
Sbjct: 88  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARR 144

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 145 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 204

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 205 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK- 261

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
             +S  A +L+ K+L V+P  RI   +I++
Sbjct: 262 -FLSPGAANLIKKMLIVNPLNRITIHEIME 290

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  214 bits (545), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 122/287 (42%), Positives = 168/287 (58%), Gaps = 25/287 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG------KQAAIKVISKSVFNNNSAQSSSLTTPD 68
            GP+ +G TLG G  GKV+L  +KT+       KQ AIK+I +     NS +        
Sbjct: 37  FGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKE------- 89

Query: 69  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQE 128
                I REI  +K LNHPN++RL +V + +  + +VLEYA  GE +  + +K  L+E  
Sbjct: 90  ---IKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGP 146

Query: 129 AIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSC 187
           A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E++L++TSC
Sbjct: 147 ACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSC 206

Query: 188 GSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLLKV 241
           GSP YAAPE +V+  PY    +DVWSCGVIL+A+L G LP+D++    DG +I  L   +
Sbjct: 207 GSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYI 266

Query: 242 QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
                + P  D I+   +DLL +IL  DP++RI     LKH  LQ +
Sbjct: 267 TRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  214 bits (544), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 166/287 (57%), Gaps = 25/287 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG------KQAAIKVISKSVFNNNSAQSSSLTTPD 68
            GP+ +G TLG G  GKV++  +KT+       KQ AIK+I +     NS +        
Sbjct: 37  FGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKE------- 89

Query: 69  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQE 128
                I REI  +K LNHPN++RL +V + +  + +VLEYA  GE +  + +K  L+E  
Sbjct: 90  ---VKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESA 146

Query: 129 AIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSC 187
           A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E++L++TSC
Sbjct: 147 ACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSC 206

Query: 188 GSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLLKV 241
           GSP YAAPE +V+  PY    +D+WSCGVI++A+L G LP+D++    DG +I  L   +
Sbjct: 207 GSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYI 266

Query: 242 QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
                + P  D I+   +DLL  IL  DP+KRI     L H  LQ +
Sbjct: 267 TRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  213 bits (541), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 166/283 (58%), Gaps = 24/283 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGK-----QAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ +G TLG G  GKV+L   KTT K     Q AIK+I +    N S + +       
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNYSEKETK------ 90

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L HPN+++L +V + +  + +VLE+A  GE +  + +K  L+E  A
Sbjct: 91  ----IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKETPA 146

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSCG 188
            R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++TSCG
Sbjct: 147 CRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKTSCG 206

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLLKVQ 242
           SP YAAPE +V+  PY    +DVWSCG+IL+A+L G LP+D++    DG +I  L L + 
Sbjct: 207 SPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYIT 266

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
               + P  + I+   +DLL KIL  DP KR+  R+I KH  L
Sbjct: 267 KTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  212 bits (540), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 167/286 (58%), Gaps = 24/286 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-----KQAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ +G TLG G  GKV+L  +KTTG     KQ AIK+I +     NS +         
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKE-------- 92

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + +K  L+E  A
Sbjct: 93  --VKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHAA 150

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSCG 188
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       +++L++TSCG
Sbjct: 151 CRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSCG 210

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 242
           SP YAAPE +V+  PY    +D+WSCGVI++A+L G LP+D++  N     I  L   + 
Sbjct: 211 SPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYIT 270

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
               + P  + I+   +DLL +IL  +P+KR+  R + +H  LQ +
Sbjct: 271 KTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  211 bits (537), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 120/287 (41%), Positives = 168/287 (58%), Gaps = 25/287 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG------KQAAIKVISKSVFNNNSAQSSSLTTPD 68
            GP+ +G TLG G  GKV+L  +K         KQ AIK+I +     NS +        
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNSEKE------- 88

Query: 69  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQE 128
                I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  K  L+E  
Sbjct: 89  ---VKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEAI 145

Query: 129 AIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSC 187
           A R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L++TSC
Sbjct: 146 ACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNELMKTSC 205

Query: 188 GSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DGN-IRNLLLKV 241
           GSP YAAPE +VS  PY    SDVWSCGVIL+A+L G LP+D++    DGN I  L   +
Sbjct: 206 GSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYI 265

Query: 242 QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
                + P  + I+  ++DLL +IL  DP+KRI  R I KH  L+ +
Sbjct: 266 TRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  210 bits (535), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 181/324 (55%), Gaps = 38/324 (11%)

Query: 11  KGDQLGPWKLGETLGLGSTGKVQLAHNKTTG--------KQAAIKVISKSVFNNNSAQSS 62
           K    GP+ +G TLG G  GKV++      G        KQ AIK+I +   +N+ ++  
Sbjct: 35  KCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKEV 94

Query: 63  SLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKG 122
                      I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + ++ 
Sbjct: 95  K----------IYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRR 144

Query: 123 PLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDK 181
            L+E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ++++
Sbjct: 145 VLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNE 204

Query: 182 LLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DG-NIR 235
           L+ TSCGSP YAAPE+V S  PY G  +D+WSCG+ILFA+L G LP+D++    DG +I 
Sbjct: 205 LMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIA 264

Query: 236 NLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPS----- 290
            L   +     + P  + I+   +DLL +IL  DP +R+  R+I  H  L+K+       
Sbjct: 265 KLYYYITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQ 322

Query: 291 ------IKDSKSIRNLPREDTYLN 308
                 I  SK+I  LP+ + + +
Sbjct: 323 PEEWDRISQSKNITRLPKHNKHYS 346

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  208 bits (530), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 163/280 (58%), Gaps = 24/280 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-----KQAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ LG TLG G  G+V+L  +K T      KQ AIK+I +     NS +         
Sbjct: 41  FGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKE-------- 92

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K  L+E  A
Sbjct: 93  --IKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEAVA 150

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSCG 188
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++TSCG
Sbjct: 151 CRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKTSCG 210

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DGN-IRNLLLKVQ 242
           SP YAAPE +VS  PY    +D+WSCGVIL+A+L G LP+D++    DGN I  L   + 
Sbjct: 211 SPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYIT 270

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
               + P  + I+   +DLL +IL  DP++RI  R I KH
Sbjct: 271 RTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKH 308

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  209 bits (533), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/291 (39%), Positives = 166/291 (57%), Gaps = 29/291 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKT----------TGKQAAIKVISKSVFNNNSAQSSSL 64
            GP+ +G T+G G  GKV+L  +K             KQ AIK+I +   + +S++    
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISKDSSKE--- 122

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  K  L
Sbjct: 123 -------LKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKKRL 175

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L+
Sbjct: 176 KETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNELM 235

Query: 184 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE+V S  PY    +D+WSCG+IL+A+L G LP+D++ GN     I  L
Sbjct: 236 KTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRL 295

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
              +     + P  D I+   +DLL KIL  DP +RI  + I KH  L+ +
Sbjct: 296 YYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  205 bits (522), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 172/301 (57%), Gaps = 39/301 (12%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNK--------TTG------------KQAAIKVISKSVF 54
            GP+ +G TLG G  GKV+LA +K        T G            KQ AIK+I +   
Sbjct: 45  FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI 104

Query: 55  NNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGEL 114
             + ++ +           I REI  +K L+HPN+++L +V + +  + +VLEYA  GE 
Sbjct: 105 TKDPSKETK----------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEF 154

Query: 115 FNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 174
           +  +  K  L+E  A R F Q+I  + Y H+ G+VHRDLK ENLLLD++ N+ I DFG  
Sbjct: 155 YKFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFV 214

Query: 175 -ALETEDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE-- 230
                ++ +++TSCGSP YAAPE +VS  PY    +D WSCG+ILFA+L G LP+D++  
Sbjct: 215 NEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPK 274

Query: 231 --DGN-IRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
             DG+ I  L   + +   + P  + I+   +DLL KIL +DP+KRI  R I KHP L+ 
Sbjct: 275 NPDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLES 332

Query: 288 Y 288
           +
Sbjct: 333 H 333

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  206 bits (525), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 168/294 (57%), Gaps = 29/294 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAH-----NKTTG-----KQAAIKVISKSVFNNNSAQSSSL 64
            GP+ LG TLG G  GKV+L       N +T      KQ A+K+I +   +N+  +    
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKE--- 94

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K  L
Sbjct: 95  -------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L+
Sbjct: 148 KETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 184 ETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE +VS  PY    +D+WSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRL 267

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
              + S   + P  D I    +DLL +IL  DP++RI  + I KH  L+ + S 
Sbjct: 268 YNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  206 bits (523), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG----------KQAAIKVISKSVFNNNSAQSSSL 64
            GP+ LG TLG G  GKV+L   K             KQ A+K+I +   +NN  +    
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKE--- 94

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K  L
Sbjct: 95  -------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L+
Sbjct: 148 KETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 184 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE+V S  PY    +D+WSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRL 267

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
              + S   + P  D I    +DLL +IL  DP+KR+  + I KH  L  + S 
Sbjct: 268 YNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSHFSF 319

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  206 bits (523), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 166/294 (56%), Gaps = 29/294 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG----------KQAAIKVISKSVFNNNSAQSSSL 64
            GP+ LG TLG G  GKV+L   K             KQ AIK+I +   +N+  +    
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKE--- 94

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K  L
Sbjct: 95  -------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L+
Sbjct: 148 KEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 184 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE+V S  PY    +D+WSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRL 267

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
              + S   + P  D I    +DLL ++L  DP+KRI  + I KH  L+ + S 
Sbjct: 268 YNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  205 bits (522), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 165/291 (56%), Gaps = 29/291 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTT----------GKQAAIKVISKSVFNNNSAQSSSL 64
            GP+ +G TLG G  GKV+L   K +           KQ AIK+I +   + +S++    
Sbjct: 45  FGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKE--- 101

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  +  K  L
Sbjct: 102 -------IKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRL 154

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLL 183
           +E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG  +   +  +L+
Sbjct: 155 KEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELM 214

Query: 184 ETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE +VS  PY    +D+WSCGVIL+A+L G LP+D++ GN     I  L
Sbjct: 215 KTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRL 274

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
              +     + P  D I+   +DLL +IL  DP +RI  + I KH  L+ +
Sbjct: 275 YHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  199 bits (507), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 163/289 (56%), Gaps = 27/289 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNK--------TTGKQAAIKVISKSVFNNNSAQSSSLTT 66
            GP+ LG T+G G  GKV+   ++        T GKQ AIK+I +        Q      
Sbjct: 52  FGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQE----- 106

Query: 67  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQE 126
                  + REI  +KLL+HPN+++L DV + +  + +VLEYA  GE +  L  K  L+E
Sbjct: 107 -----LKVYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKRLKE 161

Query: 127 QEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLET 185
             A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T +KL++T
Sbjct: 162 PLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKLMKT 221

Query: 186 SCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLL 239
            CGSP YAAPE+V S  PY    +D+WS GVIL+A+L G LP+D++    DG NI  L  
Sbjct: 222 PCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYE 281

Query: 240 KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
            +     + P  D I   A+DL+ KIL + P+ R+    + +H  L+ +
Sbjct: 282 YITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  203 bits (517), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 116/300 (38%), Positives = 168/300 (56%), Gaps = 27/300 (9%)

Query: 4   SNNLPSIKGDQL--GPWKLGETLGLGSTGKVQLA------HNKTTGKQAAIKVISKSVFN 55
           S+ L  +K  Q+  GP+ +G TLG G  GKV+L        N+   KQ AIK+I +    
Sbjct: 28  SDRLSKLKRKQITFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIV 87

Query: 56  NNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELF 115
            NS +             I REI  +K L HPN+++L +V + +  + +VLEYA  GE +
Sbjct: 88  KNSEKE----------IKIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFY 137

Query: 116 NLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 174
             +  K  L+E    R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG   
Sbjct: 138 RYIQRKRRLKETAGCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVN 197

Query: 175 ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDE---- 229
               ++ L++TSCGSP YAAPE+V S  PY    +D+WSCG+IL+A+L G LP+D+    
Sbjct: 198 EFLKDNDLMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQN 257

Query: 230 -EDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
            E  +I  L   +     + P  + IS   +DLL ++L  DP KR+  R I +H  L+ +
Sbjct: 258 PEGDDIARLYYFITRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  200 bits (508), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 163/291 (56%), Gaps = 29/291 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKT--TG--------KQAAIKVISKSVFNNNSAQSSSL 64
            GP+ +G TLG G  GKV+L   +T  TG        KQ AIK+I +     NS +    
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKE--- 97

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L HPNV+RL +V + +  + +VLEYA  GE +  +  K  L
Sbjct: 98  -------IKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRL 150

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q+I G++Y H+  +VHRDLK ENLLLD   N+ I DFG       +++ +
Sbjct: 151 KESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYM 210

Query: 184 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE+V S  PY    +DVWSCG+IL+A+L G LP+D++  N     I  L
Sbjct: 211 KTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKL 270

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
              +     + P  + I+   +DLL KIL  DP KR+  + I +H  L+ +
Sbjct: 271 YQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  204 bits (518), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 177/309 (57%), Gaps = 26/309 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           LG W   ET+G GS GKV+LA N+ T +  AIK+++++     + +S  ++ P       
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIMN 153

Query: 75  EREII---------------------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGE 113
           E++I+                     + ++L HP++ RL++++  +++ YM+ EY   G+
Sbjct: 154 EKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGGQ 213

Query: 114 LFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGM 173
           L + +++ G L+E  A  F RQI+  + Y HA  IVHRDLK EN+++    NIKI DFG+
Sbjct: 214 LLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFGL 273

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN 233
           + L  + K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ N
Sbjct: 274 SNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 333

Query: 234 IRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIK 292
           +  L  K++ G    P    +S E   LL+ +L VDP KR     ++KH  + K Y SI 
Sbjct: 334 V--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSIP 389

Query: 293 DSKSIRNLP 301
           D+   + +P
Sbjct: 390 DAHLPKRVP 398

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  200 bits (509), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 167/290 (57%), Gaps = 26/290 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLA---HNKTT--GKQAAIKVISK-SVFNNNSAQSSSLTTPD 68
            GP+ +G TLG G  GKV+L     N++T   KQ AIK+I + S+  +   +        
Sbjct: 31  FGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRDSILQDREKE-------- 82

Query: 69  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQE 128
                I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + +K  L+E  
Sbjct: 83  ---IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEPI 139

Query: 129 AIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSC 187
           A + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++TSC
Sbjct: 140 ACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKTSC 199

Query: 188 GSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRN-----LLLKV 241
           GSP YAAPE +V+  PY    +DVWSCG+ILFA+L G LP+D++  N R      L   +
Sbjct: 200 GSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYI 259

Query: 242 QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
            +   + PS   IS   +DLL KIL  +P +R+  R+I  H  L+ + S 
Sbjct: 260 TTSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  203 bits (516), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 170/307 (55%), Gaps = 43/307 (14%)

Query: 4   SNNLPSIKGD------QLGPWKLGETLGLGSTGKVQLAHNKTTG------KQAAIKVISK 51
           S+N+P  KG+        GP+ +G TLG G  GKV+L   K +       KQ AIK+I +
Sbjct: 52  SSNIPENKGNGRRKHITFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR 111

Query: 52  SVFNNNSAQSSSLTTPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNSNLYMV 105
                           DA+  G E+EI I      +K L HPN++RL +V + +  + +V
Sbjct: 112 ----------------DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIV 155

Query: 106 LEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN 165
           LEYA  GE +  + +K  L+E  A   F Q++ G+ Y H  G+VHRDLK ENLLLD   N
Sbjct: 156 LEYASGGEFYKYIQKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGN 215

Query: 166 IKIADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTG 223
           + I DFG         +L++TSCGSP YAAPE+V S  PY    +D+WSCG+ILFA+L G
Sbjct: 216 LIITDFGFVNEFSKFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAG 275

Query: 224 RLPFDEE----DGN-IRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARD 278
            LP+D++    DGN I  L   + +   + P  + IS  A+DLL  IL   P+KR   + 
Sbjct: 276 YLPWDDDPKNPDGNDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQ 333

Query: 279 ILKHPLL 285
           ILKH  L
Sbjct: 334 ILKHQWL 340

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  199 bits (505), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 162/293 (55%), Gaps = 27/293 (9%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTT--------GKQAAIKVISKSVFNNNSAQSSSLT 65
           + G + LG TLG G  GKV+L  +  +         KQ AIK+I +      S +     
Sbjct: 42  RFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKE---- 97

Query: 66  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQ 125
                   I REI  +KLL HPN++RL +V + +  + +VLE+A  GE +  L  K  L+
Sbjct: 98  ------IKIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLK 151

Query: 126 EQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLE 184
           E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++
Sbjct: 152 EPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMK 211

Query: 185 TSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLL 238
            SCGSP YAAPE+V S  PY     D+WSCG+IL+A+L G LP+D++  N     I  L 
Sbjct: 212 RSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLY 271

Query: 239 LKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
             +     + P+   IS  A+DL+ KILT +P +RI    I KH  L+ + S 
Sbjct: 272 QYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  200 bits (509), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 165/291 (56%), Gaps = 29/291 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG----------KQAAIKVISKSVFNNNSAQSSSL 64
            GP+ LG TLG G  GKV+L   K+            KQ A+K+I +   +N+  +    
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKKE--- 94

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + ++  L
Sbjct: 95  -------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRRRL 147

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L+
Sbjct: 148 KEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 184 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE+V S  PY    +D+WSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRL 267

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
              +     + P  D I    +DLL +IL  DP++RI  + I KH  L+ +
Sbjct: 268 YNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  199 bits (507), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 177/332 (53%), Gaps = 55/332 (16%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-------------------------KQAAIKVI 49
            GP+ +G T+G G  GKV+L  +K+                           KQ AIK+I
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKLI 117

Query: 50  SKSVFNNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA 109
            +   + +  +             I REI  +K L HPN+++L +V + +  + +VLEYA
Sbjct: 118 RRDTISKDPRRE----------IKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYA 167

Query: 110 EKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIA 169
             GE +  +  K  L+E  A + F Q+I G++Y H+ G++HRDLK EN+LLD   N+ I 
Sbjct: 168 SGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIIT 227

Query: 170 DFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPF 227
           DFG      T ++L++TSCGSP YAAPE+V S  PY     D+WSCG+ILFA+L G LP+
Sbjct: 228 DFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPW 287

Query: 228 DEE-----DGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           D++       NI  L   + +   + P  + I+   +DLL +IL  DP+KR+  R ILKH
Sbjct: 288 DDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYILKH 345

Query: 283 -------PLL----QKYPSIKDSKSIRNLPRE 303
                  P L    +++ +I  S+SI  LP+ 
Sbjct: 346 QWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  195 bits (496), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 174/300 (58%), Gaps = 37/300 (12%)

Query: 11  KGDQLGPWKLGETLGLGSTGKVQLAHNK--------TTG----------KQAAIKVISKS 52
           K  + G + LG+TLG G  GKV+L +          ++G          KQ AIK+I + 
Sbjct: 52  KQPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRD 111

Query: 53  VFNNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
             +  +++ S +         + REI  +K+L HPN+++L +V + +  + +VLEYA  G
Sbjct: 112 TLS--ASKESEIK--------LYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGG 161

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           E +  +  K  L+E +A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ I DFG
Sbjct: 162 EFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFG 221

Query: 173 MAALETE-DKLLETSCGSPHYAAPEIVSGI-PYHGFASDVWSCGVILFALLTGRLPFDEE 230
                T+ +KL+ T CGSP YAAPE+V+ + PY+   +D+WSCGVIL+A+L G LP+D++
Sbjct: 222 FVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDD 281

Query: 231 DGNIRN-----LLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             NI       L   +++   + P  + I+   +DLL ++L +DP KR+  + IL+H  +
Sbjct: 282 PKNINGTDIVKLYKYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQHAWI 339

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  199 bits (506), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 159/284 (55%), Gaps = 22/284 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKT----TGKQAAIKVISKSVFNNNSAQSSSLTTPDAL 70
            GP+ +G TLG G  GKV+L  +K       +  AIK+I +     NS +          
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKE--------- 92

Query: 71  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAI 130
              I RE+  +KLL+HPN++RL +V + +  + +VL+YA  GE +  + +K  L+E  A 
Sbjct: 93  -IKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPAC 151

Query: 131 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 190
           R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L+ TSCGSP
Sbjct: 152 RLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMRTSCGSP 211

Query: 191 HYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQSG 244
            YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+D++  N     I  L   +   
Sbjct: 212 CYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHT 271

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
             + P  + I    +DLL +IL  +PE R+   DI +H  LQ +
Sbjct: 272 SLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  200 bits (508), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 167/289 (57%), Gaps = 21/289 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           LG W   ET+G GS GKV+LA +  T +  AIK+++++   +   + +SL  P +    +
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRAT-KSFLQKEASLPPPKSEEEAL 209

Query: 75  ER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLL 118
           ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 210 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYI 269

Query: 119 VEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 178
           ++ G L+E  A +F R I   + Y H   IVHRDLK EN+++    +IKI DFG++ L  
Sbjct: 270 IQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYD 329

Query: 179 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLL 238
             K L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFD+E+ ++  L 
Sbjct: 330 SKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LH 387

Query: 239 LKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
            K++ G+ + P    +S E   LL+K+L VDP+KR   + I+ HP + +
Sbjct: 388 EKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  196 bits (497), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 160/288 (55%), Gaps = 28/288 (9%)

Query: 14  QLGPWKLGETLGLGSTGKVQLA-------HNKTT--GKQAAIKVISKSVFNNNSAQSSSL 64
           + GP+ +G TLG G  GKV++          K T   KQ AIK+I +      S +    
Sbjct: 34  KFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKE--- 90

Query: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124
                    I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  +  K  L
Sbjct: 91  -------MKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRL 143

Query: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLL 183
           +E  A R F Q+I G+SY H+ GIVHRDLK ENLLLD   N+ I DFG       +++L+
Sbjct: 144 KEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELM 203

Query: 184 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 237
           +TSCGSP YAAPE+V +  PY    +D+WSCG+IL+ +L G LP+D++  N     I  L
Sbjct: 204 KTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRL 263

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
              +     + P  + I+   +DLL  IL  +P +R+ +R I KH  L
Sbjct: 264 YHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  199 bits (505), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 167/288 (57%), Gaps = 24/288 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS--VF--NNNSAQSSSLTTPDAL 70
           LG W   ET+G GS GKV+LA N+ T +  AIK+++++  +F     +A+ +  T P + 
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLSE 127

Query: 71  PYGIER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGEL 114
              IER                E  + ++L HP++ RLY++   +++ YM+ EY   G+L
Sbjct: 128 KEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQL 187

Query: 115 FNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 174
            + +++ G L+E  A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG++
Sbjct: 188 LDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGLS 247

Query: 175 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNI 234
            L  +   L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ N+
Sbjct: 248 NLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNV 307

Query: 235 RNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
             L  K++ G+   P    +S E   LL+K+L VDP KR     ++ H
Sbjct: 308 --LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  198 bits (504), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 168/291 (57%), Gaps = 25/291 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSV--FNNNSAQSSSLTTPDALPY 72
           LG W   ET+G GS GKV+LA ++ T +  AIK+++++   F +   Q   +T P +   
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQ---MTPPKSEQE 132

Query: 73  GIER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFN 116
            +ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L +
Sbjct: 133 ALERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 192

Query: 117 LLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 176
            +++ G L+E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +
Sbjct: 193 YIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNM 252

Query: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRN 236
               K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 253 YDPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV-- 310

Query: 237 LLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           L  K++ G+ E P    +S E   LL+K+L VDP KR   + ++ H  +Q+
Sbjct: 311 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  196 bits (499), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 159/286 (55%), Gaps = 24/286 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-----KQAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ +G TLG G  GKV+L   K +      KQ AIK+I +     ++ +         
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKEVK------ 96

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L+E  A
Sbjct: 97  ----IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSCG 188
            R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG       +++L+ TSCG
Sbjct: 153 CRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMNTSCG 212

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 242
           SP YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYIT 272

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
               + P  + I+   +DLL +IL  +P +R+  R I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  198 bits (503), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 174/310 (56%), Gaps = 40/310 (12%)

Query: 2   TASNNLPSIKG-------DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVF 54
           T+ + +PS +G         LG W+  ET+G GS GKV+LA ++ T +  A+K++     
Sbjct: 95  TSQSRVPSSQGMPKQFHRKSLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIV----- 149

Query: 55  NNNSAQSSSLTTPDALP------------YGIEREII----------IMKLLNHPNVLRL 92
             N A  + L     LP              +E+EI           + ++L HP++ RL
Sbjct: 150 --NRATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRL 207

Query: 93  YDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRD 152
           +++   +++ YM+ EY   G+L + +++ G ++E +A +F R I   + Y HA  IVHRD
Sbjct: 208 FEMCTLSNHFYMLFEYVSGGQLLDYIIQHGSIREHQARKFARGIASALMYLHANNIVHRD 267

Query: 153 LKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWS 212
           LK EN+++     IKI DFG++ L    K L T CGS ++AAPE++   PY G   DVWS
Sbjct: 268 LKIENIMISDSSEIKIIDFGLSNLYDSRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWS 327

Query: 213 CGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEK 272
            GV+LF L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   LL+K+L VDP++
Sbjct: 328 FGVVLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKR 383

Query: 273 RIRARDILKH 282
           R   + +++H
Sbjct: 384 RATLKQVVEH 393

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  198 bits (504), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 166/288 (57%), Gaps = 19/288 (6%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSV-------------FNNNSA-- 59
           LG W   ET+G GS GKV+LA ++ TG+  AIK+++++               NN     
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIME 164

Query: 60  QSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
           +   L    +      RE  + ++  HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 165 RQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYII 224

Query: 120 EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
           + G L+E  A +F R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 225 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYDT 284

Query: 180 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 285 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 342

Query: 240 KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           K++ G+ E P    +S E   LL+K+L VDP +R   + +++HP + K
Sbjct: 343 KIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  191 bits (486), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 156/289 (53%), Gaps = 30/289 (10%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKT-----------TGKQAAIKVISKSVFNNNSAQSSS 63
            GP+ +G TLG G  GKV++   +            T +Q AIK+I +     NS + + 
Sbjct: 47  FGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTIVRNSDKETK 106

Query: 64  LTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGP 123
                     I REI  +K L HPN++ L ++ + +  + +VLEYA  GE +  +  K  
Sbjct: 107 ----------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQRKRR 156

Query: 124 LQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKL 182
           L+E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E+ L
Sbjct: 157 LKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNENVL 216

Query: 183 LETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRN 236
           ++TSCGSP YAAPE +VS   Y G   D+WSCGVIL+A+L G LP+D++  N     I  
Sbjct: 217 MKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISK 276

Query: 237 LLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           L   + +   + P  D ++   +DLL +IL  DP +R     I  H  L
Sbjct: 277 LYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  196 bits (498), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 169/288 (58%), Gaps = 19/288 (6%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVI---SKSVFNNNSAQSSSLTTPDALP 71
           LG W   ET+G GS GKV+LA ++ T +  AIK++   +K++ +  S Q    T  + L 
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVLE 240

Query: 72  Y--GIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
               +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 241 RERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 300

Query: 120 EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
           + G L+E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 301 QHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFNP 360

Query: 180 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 361 KKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 418

Query: 240 KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           K++ G+ E P    +S E   LL+K+L VDP KR   + ++ H  +Q+
Sbjct: 419 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  196 bits (498), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 187/349 (53%), Gaps = 42/349 (12%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W   ET+G GS GKV+LA +  T +  AIK++       N A  + L    ++P   
Sbjct: 161 LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIV-------NRATKAFLHKEQSMPPPK 213

Query: 72  ---------YGIEREI----------IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 214 NEQEIAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 273

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y H   IVHRDLK EN+++ +   IKI DFG
Sbjct: 274 QLLDYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFG 333

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   DVWS G++L+ L+ G++PFD+E+ 
Sbjct: 334 LSNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENS 393

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIK 292
           ++  L  K++ G+ E P  + +S E   LL+K++ VDP KR   R +++HP + +     
Sbjct: 394 SV--LHEKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRG---Y 446

Query: 293 DSKSIRNLPREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKL 341
           D   +  LPR      PL+     ID  +L+ +  L    DV E  + L
Sbjct: 447 DFPPLSYLPRRI----PLTP--EAIDNNVLREMFRLEFIDDVEECQNSL 489

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  195 bits (496), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 165/284 (58%), Gaps = 21/284 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           LG W   ET+G GS GKV+LA ++ T +  AIK+++++  N    +  SL  P      +
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRAT-NAFLHKEQSLPPPKKEEEIL 133

Query: 75  ER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLL 118
           ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 134 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 193

Query: 119 VEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 178
           ++ G L+E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 194 IQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNLFD 253

Query: 179 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLL 238
           + K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 254 KSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 311

Query: 239 LKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
            K++ G+ E P    +S E   LL+K+L VDP +R   + +++H
Sbjct: 312 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  194 bits (493), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 158/284 (55%), Gaps = 22/284 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKT----TGKQAAIKVISKSVFNNNSAQSSSLTTPDAL 70
            GP+ +G TLG G  GKV+L  + +      K  AIK++ +     +S +          
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPKHSEKEVK------- 114

Query: 71  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAI 130
              I REI  +K LNHPN++RL +V + +  + +VL+YA  GE +  + +K  L+E  A 
Sbjct: 115 ---IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPAC 171

Query: 131 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 190
           R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L++TSCGSP
Sbjct: 172 RLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSP 231

Query: 191 HYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDE-----EDGNIRNLLLKVQSG 244
            YAAPE +V+  PY    +DVWSCGVIL+A+L G LP+D+     E  +I  L   +   
Sbjct: 232 CYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKS 291

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
             + P  + I    +DLL +IL  +P+ R+   +I  H  L+ +
Sbjct: 292 ALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  192 bits (489), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 157/286 (54%), Gaps = 24/286 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKT-----TGKQAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ +G TLG G  GKV+L   K        KQ AIK+I +     ++ +         
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEVK------ 96

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L+E  A
Sbjct: 97  ----IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED-KLLETSCG 188
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ED +L+ TSCG
Sbjct: 153 CRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMRTSCG 212

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 242
           SP YAAPE +VS   Y    +DVWSCGVIL+A+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYIT 272

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
               + P  + I+   +DLL +IL  +P +R+  R I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  192 bits (489), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 159/286 (55%), Gaps = 24/286 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-----KQAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ +G TLG G  GKV+L  +K +      KQ AIK+I +     ++ +         
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDADKEVK------ 96

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L+E  A
Sbjct: 97  ----IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED-KLLETSCG 188
            R F Q+I G++Y H  G+VHRDLK ENLL+D   N+ I DFG      ED +L+ TSCG
Sbjct: 153 CRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMRTSCG 212

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 242
           SP YAAPE +VS   Y    +DVWSCGVIL+A+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYIT 272

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
               + P  + I+   +DLL +IL  +P +R+  R I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  194 bits (493), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 166/290 (57%), Gaps = 33/290 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W+  ET+G GS GKV+LA ++ T +  A+K++       N A  + L     LP   
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIV-------NRATKAFLHKEQMLPPPK 167

Query: 72  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 168 NEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGG 227

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G ++E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG
Sbjct: 228 QLLDYIIQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFG 287

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ L    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ 
Sbjct: 288 LSNLYDSRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENS 347

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           ++  L  K++ G+ E P    +S E   LL+K+L VDP++R   + +++H
Sbjct: 348 SV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  194 bits (493), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 165/290 (56%), Gaps = 33/290 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W+  ET+G GS GKV+LA +  T +  A+K++       N A  + L     LP   
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIV-------NRATKAFLHKEQMLPPPK 180

Query: 72  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 181 NEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGG 240

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G ++E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG
Sbjct: 241 QLLDYIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFG 300

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ L    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ 
Sbjct: 301 LSNLYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENS 360

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           ++  L  K++ G+ E P    +S E   LL+K+L VDP++R   + +++H
Sbjct: 361 SV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  194 bits (493), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 166/290 (57%), Gaps = 33/290 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W+  ET+G GS GKV+LA ++ T +  A+K++       N A  + L     LP   
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIV-------NRATKAFLHKEQMLPPPK 169

Query: 72  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 170 NEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGG 229

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G ++E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG
Sbjct: 230 QLLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFG 289

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ 
Sbjct: 290 LSNIYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENS 349

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           ++  L  K++ G+ E P    +S E   LL+K+L VDP++R   + +++H
Sbjct: 350 SV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  193 bits (491), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 162/294 (55%), Gaps = 37/294 (12%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-------KQAAIKVISKSVFNNNSAQSSSLTTP 67
            GP+ L  TLG G  GKV+L  +K +        KQ AIK+I +S               
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSI------------- 127

Query: 68  DALPYG------IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEK 121
             LP G      + REI  +K L HPN+++L DV + +  + +VLEYA  GE +  +  K
Sbjct: 128 --LPKGSNKEIKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRK 185

Query: 122 GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETED 180
             L+E  A + F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        +
Sbjct: 186 KRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTN 245

Query: 181 KLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEE----DGN-I 234
           +L+ T CGSP YAAPE+V S  PY    +D+WSCG+IL+A+L G LP+D++    DGN I
Sbjct: 246 ELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDI 305

Query: 235 RNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
             L   + +   + P  + I    +DLL KIL  + +KRI  R I+ H  L+ +
Sbjct: 306 ARLYYYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 159/286 (55%), Gaps = 24/286 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG-----KQAAIKVISKSVFNNNSAQSSSLTTPDA 69
            GP+ +G TLG G  GKV+L   K +      KQ AIK+I +     ++ +         
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKE-------- 94

Query: 70  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEA 129
               I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L+E  A
Sbjct: 95  --IKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 130 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED-KLLETSCG 188
            R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG      ED +L++TSCG
Sbjct: 153 CRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTSCG 212

Query: 189 SPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 242
           SP YAAPE +VS   Y    +DVWSCGVIL+A+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYIT 272

Query: 243 SGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
               + P  + I+   +DLL +IL  +P +RI  + I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  194 bits (492), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 170/293 (58%), Gaps = 22/293 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVIS---KSVFNNNSAQSSSLTTPDALP 71
           LG W   ET+G GS GKV+LA +  T +  AIK+++   K+  +   +     T  + L 
Sbjct: 159 LGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVLE 218

Query: 72  YG--IEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
               +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 219 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 278

Query: 120 EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
           + G L+E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 279 QHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDR 338

Query: 180 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 339 KKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 396

Query: 240 KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK---YP 289
           K++ G+ + P  + +S E   LL+K+L VDP +R   + +++HP + +   YP
Sbjct: 397 KIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 166/295 (56%), Gaps = 33/295 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG- 73
           LG W+  ET+G GS GKV+L  ++ T +   IK++       N A  + L     LP   
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIV-------NRASKAYLHKQHTLPSPK 155

Query: 74  -----------IEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 156 NENEILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 215

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG
Sbjct: 216 QLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFG 275

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ 
Sbjct: 276 LSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENS 335

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +I  L  K++ G+ + PS   +S EA  LL +++ +DP KR   ++++ HP + +
Sbjct: 336 SI--LHEKIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 165/289 (57%), Gaps = 21/289 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           LG W   ET+G GS GKV+LA ++ T +  AIK+++++  +    Q+  L  P      +
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQ-LPPPKTEEELM 153

Query: 75  ER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLL 118
           ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 154 ERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 213

Query: 119 VEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 178
           ++ G L+E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 214 IQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 273

Query: 179 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLL 238
             K L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFD+E+ ++  L 
Sbjct: 274 NKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LH 331

Query: 239 LKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
            K++ G+ E P    +S E   LL+K+L VDP KR   + +  H  +Q+
Sbjct: 332 EKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  193 bits (490), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 162/290 (55%), Gaps = 33/290 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W   ET+G GS GKV+LA +  T +  AIKV+       N A    L     LP   
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVV-------NRATKGFLHKEQTLPPPQ 232

Query: 72  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 233 TEQEILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 292

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG
Sbjct: 293 QLLDYIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFG 352

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ L    + L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 353 LSNLYDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENS 412

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           ++  L  K++ G+ + P    +S E   LL+K+L VDP+KR   R +++H
Sbjct: 413 SV--LHEKIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 165/295 (55%), Gaps = 33/295 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W   ET+G GS GKV+LA +  T +  AIK++       N A  + L     LP   
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIV-------NRATKAFLHKEQNLPPPK 158

Query: 72  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 159 SEQEILQRQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 218

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG
Sbjct: 219 QLLDYIIQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFG 278

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  
Sbjct: 279 LSNVYDPRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVS 338

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           ++  L  K++ G  E P  + +S E   LL+K+L VDPE+R   + +++HP + +
Sbjct: 339 SV--LHEKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNR 389

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 166/290 (57%), Gaps = 21/290 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN-NNSAQSSSLTTPDALPYG 73
           LG W   ET+G GS GKV+LA ++ T +  AIK+++++  +  +  Q   L  P      
Sbjct: 51  LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEEL 110

Query: 74  IER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNL 117
           +ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L + 
Sbjct: 111 LERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 170

Query: 118 LVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 177
           +++ G L+E+ A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ + 
Sbjct: 171 IIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSNMY 230

Query: 178 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNL 237
              K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++  L
Sbjct: 231 DPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV--L 288

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
             K++ G+ E P    +S +   LL+K+L VDP KR   + ++ H  +QK
Sbjct: 289 HEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 164/287 (57%), Gaps = 21/287 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           LG W   ET+G GS GKV+LA +  T +  AIK+++++       +  SL  P      +
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRAT-KAYLHKEQSLAPPKNENEML 156

Query: 75  ER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLL 118
           ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 157 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 216

Query: 119 VEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 178
           ++ G L+E  A +F R +   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 217 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFD 276

Query: 179 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLL 238
             K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 277 TRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--LH 334

Query: 239 LKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
            K++ G+ E P  + +S E   LL+K+L VDP KR     +++HP +
Sbjct: 335 EKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  192 bits (487), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 162/290 (55%), Gaps = 33/290 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY-- 72
           LG W   ET+G GS GKV+LA +  T +  AIK++       N A  + L    +LP   
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIV-------NRATKAFLHKEQSLPAPA 194

Query: 73  ----------GIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 195 NDQEIMERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 254

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A RF R I   + Y HA  IVHRDLK EN+++     IK+ DFG
Sbjct: 255 QLLDYIIQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFG 314

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ L    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 315 LSNLYDNRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENS 374

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           ++  L  K++ G+ E      +S E   LL+K+L VDP++R   + ++ H
Sbjct: 375 SV--LHEKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  191 bits (486), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 166/290 (57%), Gaps = 21/290 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNN-NSAQSSSLTTPDALPYG 73
           LG W   ET+G GS GKV+LA ++ T +  AIK+++++  +  +  Q   L  P      
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFIHKQQQQQLPPPSNEEEL 171

Query: 74  IER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNL 117
           +ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L + 
Sbjct: 172 MERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 231

Query: 118 LVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 177
           +++ G L+E+ A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ L 
Sbjct: 232 IIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSNLY 291

Query: 178 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNL 237
              K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++  L
Sbjct: 292 DPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV--L 349

Query: 238 LLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
             K++ G+ E P    +S +   LL+K+L VDP KR   + ++ H  +QK
Sbjct: 350 HEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  191 bits (486), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 103/307 (33%), Positives = 169/307 (55%), Gaps = 33/307 (10%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG- 73
           LG W+  ET+G GS GKV+L  ++ T +   IK++       N A  + L    +LP   
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIV-------NRASKAYLHKQHSLPSPK 156

Query: 74  -----------IEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 157 NENEVLERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 216

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG
Sbjct: 217 QLLDYIIQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFG 276

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ 
Sbjct: 277 LSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENS 336

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIK 292
           +I  L  K++ G+ + PS   +S EA  LL K++ VDP +R   + ++ HP + +    K
Sbjct: 337 SI--LHEKIKKGKVDYPS--HLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNRGYDFK 392

Query: 293 DSKSIRN 299
               I N
Sbjct: 393 APSYILN 399

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/295 (33%), Positives = 167/295 (56%), Gaps = 33/295 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG- 73
           LG W+  ET+G GS GKV+L  ++ T +   IK++       N A  + L    +LP   
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIV-------NRASKAYLHKQHSLPSPK 148

Query: 74  -----------IEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 149 NESEILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 208

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG
Sbjct: 209 QLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFG 268

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ 
Sbjct: 269 LSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENS 328

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +I  L  K++ G+ + PS   +S E   LL +++ VDP +R   +++++HP + +
Sbjct: 329 SI--LHEKIKKGKVDYPS--HLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 166/295 (56%), Gaps = 33/295 (11%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALP--- 71
           LG W+  ET+G GS GKV+L  +  T +   IK++       N A  + L    +LP   
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIV-------NRASKAFLHKQHSLPPPK 156

Query: 72  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKG 112
                      +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G
Sbjct: 157 NENELLERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 216

Query: 113 ELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 172
           +L + +++ G L+E  A +F R I   + Y HA  IVHRDLK EN+++ +   IKI DFG
Sbjct: 217 QLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFG 276

Query: 173 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG 232
           ++ +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ 
Sbjct: 277 LSNIFDSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENS 336

Query: 233 NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +I  L  K++ G+ + PS   +S +A  LL +++ VDP KR   +++  HP + +
Sbjct: 337 SI--LHEKIKKGKVDYPS--HLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  186 bits (473), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 148/280 (52%), Gaps = 25/280 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K   KS  N                  
Sbjct: 38  EVGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPN------------------ 79

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +  ++P + +LY+V  T + ++M LEY    EL++ L+ K  L   E    F
Sbjct: 80  VVREVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELF 139

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y 
Sbjct: 140 AQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYM 199

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++   PY GF  D+WS GVIL+ LL G LPFDE+D      LL  Q    + P  DE
Sbjct: 200 APEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVIDE 254

Query: 254 --ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
                EAQ+L+ ++L+ DP +R     IL HP LQ Y ++
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  187 bits (476), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 161/286 (56%), Gaps = 25/286 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS--VFNNNSAQSSSLTTPDALPY 72
           LG W   ET+G GS GKV++A +  T +  AIK+I+++   F +   Q   L  P     
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQ---LPPPQNEQE 193

Query: 73  GIER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFN 116
            +ER                E  + + L HP++ RL+++   +++ YM+ EY   G+L +
Sbjct: 194 ALERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 253

Query: 117 LLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 176
            +++ G L+E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +
Sbjct: 254 YIIQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNM 313

Query: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRN 236
                 L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 314 FDPRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 371

Query: 237 LLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           L  K++ G+ + P    +S E   LL+K+L VDP KR   + +++H
Sbjct: 372 LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  185 bits (469), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 155/284 (54%), Gaps = 22/284 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTG---KQAAIKVISKSVFNNNSAQSSSLTTPDALP 71
            GP+ +G TLG G  GKV+L  +K+     K  AIK+I +     NS +           
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKE---------- 102

Query: 72  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIR 131
             I REI  +K L HPN++ L +V + +  + +VL YA  GE +  + +K  L+E  A R
Sbjct: 103 VKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACR 162

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSCGSP 190
            F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      + + L++TSCGSP
Sbjct: 163 LFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSP 222

Query: 191 HYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRL-----PFDEEDGNIRNLLLKVQSG 244
            YAAPE +V+   Y    +DVWSCGVIL+A+L G L     P + +  +I  L   +   
Sbjct: 223 CYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKT 282

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
             + P  + I+   +D+L +IL  DP KRI    ILKH  LQ +
Sbjct: 283 SLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  184 bits (466), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 152/276 (55%), Gaps = 21/276 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           +G +K+ + +G GS GKV LA+++ T ++  +K  +K+  N                  +
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKNDPN------------------V 75

Query: 75  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134
            RE+   +  + P++ +LY+V  T S ++M LEY    EL+  L+ +  +  +E+ + F 
Sbjct: 76  VREVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLFA 135

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194
           QI+  + Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  Y A
Sbjct: 136 QIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYMA 195

Query: 195 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254
           PE++    Y GF  D+WS GVIL+ ++ G +PFDEED       +     E    +DD +
Sbjct: 196 PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKI---INEEPFYNDDVV 252

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPS 290
           S +A+DL++++L  DP +R +   +L HP LQ Y S
Sbjct: 253 SKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  183 bits (465), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 158/288 (54%), Gaps = 19/288 (6%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVF---------------NNNSA 59
           L  W   ET+G GS GKV+LA NK + +  AIK++ ++                 N    
Sbjct: 64  LSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAKE 123

Query: 60  QSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
           +   L    +      RE  + ++L HPNV +LY++   +++ YM  E+   G+L + ++
Sbjct: 124 RQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYII 183

Query: 120 EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
           + G L+E  A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ +   
Sbjct: 184 QHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYDP 243

Query: 180 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
            K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  N   L  
Sbjct: 244 RKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALHE 301

Query: 240 KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           K++ G+   P    +S +   LL+KIL VDP+KR   + ++ H  + K
Sbjct: 302 KIKKGKVTYPQ--FLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 162/283 (57%), Gaps = 19/283 (6%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS----VFNNNSA---QSSS---- 63
           LG W    T+G GS GKV+LA ++      A+K+++++    ++   SA   QS +    
Sbjct: 115 LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIKE 174

Query: 64  ----LTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
               L    A      RE  + ++L+H N+ +LY +   +++ YM+ EY   G+L + ++
Sbjct: 175 RERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYII 234

Query: 120 EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179
           + G L+E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG++ L   
Sbjct: 235 QHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFDP 294

Query: 180 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239
              L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++PFD+E+ N   L  
Sbjct: 295 RAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LHE 352

Query: 240 KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           K++ G+   P+   +S E   LL K+LTV+P++R   ++I+ H
Sbjct: 353 KIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  181 bits (459), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 155/292 (53%), Gaps = 25/292 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA +K T ++  +K   KS  N                  
Sbjct: 33  EVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKSDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFN--LLVEKGPLQEQEAIR 131
           + RE+   +  + P + +LY+V  T + ++M LEY    EL+   L++ + PL E    +
Sbjct: 75  LVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDE--CAK 132

Query: 132 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 191
            F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 133 LFAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTV 192

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD 251
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDE+D       +     +F   +D
Sbjct: 193 YMAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFND 249

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRE 303
           + +SHEA+DL+ ++L   P +R     IL HP LQ Y  I  S++ + + R+
Sbjct: 250 NFVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  172 bits (436), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 151/272 (55%), Gaps = 17/272 (6%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG G+ G V+ A   TTG+  A+K++ K     N+ Q   L            E+ 
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGNNVQLQMLYD----------ELA 103

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HPN++   D +E+    Y+V + A  GELF+ +++KG   E +A+    Q+I  
Sbjct: 104 ILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLISA 163

Query: 140 ISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEDKLLETSCGSPHYAAP 195
           +SY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++ D L+    GS  Y AP
Sbjct: 164 VSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYVAP 223

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSDDE 253
           E+++    HG   D+WS GVI + LL+G   F  E  +G +          +F  P  D 
Sbjct: 224 EVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYWDN 282

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           IS EA+D + + LT+DP  R  A ++L+ P +
Sbjct: 283 ISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  172 bits (435), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 157/276 (56%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG G+ G V+ A N  TG+  A+K++ K     N  Q  +L            E
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYD----------E 86

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y++ + A+ GELF+ +++KG   E++A+R   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEIL 146

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++LL    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYV 206

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMP 249
           APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +GE    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHRP 263

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D +S++A+  + K L +DP KR  A ++L+ P +
Sbjct: 264 YWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 168/314 (53%), Gaps = 28/314 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T  +  +K  +KS  N                  
Sbjct: 34  EVGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKSDPN------------------ 75

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           I RE+   +  ++P + +LY+V  T S ++M  EY    +L++ ++    +     I  F
Sbjct: 76  IVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIELF 135

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y 
Sbjct: 136 TQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYM 195

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMP--SD 251
           APE++    Y GF  D+WS GVIL+ +L G +PFDE+D        K+ +   EMP  +D
Sbjct: 196 APELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET--KTEWKIMN---EMPVFND 250

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLS 311
             +S +A+DLL K+L+ DP +R   ++IL HP LQ Y S+   K+ R L ++    N   
Sbjct: 251 TILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQ---RNGTI 307

Query: 312 DNNSTIDKTILQNL 325
             +S +++ +L+NL
Sbjct: 308 HFHSKLERKLLKNL 321

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  170 bits (431), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 159/300 (53%), Gaps = 29/300 (9%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG GS G V+ A   +TG   A+K++ K     N  Q   L            E++
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYD----------ELM 97

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ LNHPN+++  D +E+    Y+V + A  GELF+ +++KG   E +A++   QI+  
Sbjct: 98  ILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILKA 157

Query: 140 ISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEDKLLETSCGSPHYAAP 195
           + Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ +  L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYVAP 217

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMPSD 251
           E+++    HG   D+WS GVI + LL G  PF  E  ++   L +  SG+    F  P  
Sbjct: 218 EVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPYW 274

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK--------YPSIKDSKSIRNLPRE 303
           + IS EA+  + ++LT+ P+KR  A D+L    +           P I+   + RN  RE
Sbjct: 275 NNISKEAKLFILRVLTISPKKRPTATDLLSDAWITSKTQQTNDLLPEIRKGFNARNKFRE 334

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  178 bits (451), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 191/367 (52%), Gaps = 30/367 (8%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           +G +K+ E +G GS GKV LA ++ T ++  IK             SS    P+     I
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK-------------SSVKNDPN-----I 84

Query: 75  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134
            RE+   +   +  + +LY++  T S ++M LEY    EL++ +++   +  +E I+ F 
Sbjct: 85  VREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLFS 144

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194
           QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  Y A
Sbjct: 145 QIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVYMA 204

Query: 195 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254
           PE+    PY GF  D+WS GVIL+ +L+G +PFDE+D       +  +  E+   +   +
Sbjct: 205 PELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKFM 261

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN 314
           + E +DL+ K+L  D   R   R+IL+H  LQ Y +   +++   + R+       ++ +
Sbjct: 262 TAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGTTVLTQTDNLIARQ---RKGATNFH 318

Query: 315 STIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKNEQIR 374
           S +++ +L+ L     G D   I   + +   ++   L+ LL    ++ EK+  K +Q+R
Sbjct: 319 SKLERRVLKRLNRC--GFDTQSIKQSVIKKKCDSLAGLWCLL----LEKEKKYQKRKQLR 372

Query: 375 KRQSITS 381
           + +SI S
Sbjct: 373 RSKSILS 379

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  177 bits (450), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 102/280 (36%), Positives = 149/280 (53%), Gaps = 25/280 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +++   +G GS GKV LAH+  T ++  +K  +KS  N                  
Sbjct: 33  EVGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKSDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +    P + +LY++  T + ++M LEY    EL+  L+    +   E  R F
Sbjct: 75  VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y 
Sbjct: 135 AQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  DVWS GVIL+ LL G +PFDEE    +N   K+ +   EMPS D 
Sbjct: 195 APELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDS 249

Query: 254 --ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
             +  +A DLL+K+L  DP  R   +++L+HP LQ Y ++
Sbjct: 250 TLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 152/278 (54%), Gaps = 25/278 (8%)

Query: 13  DQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPY 72
           +++G +K+ + +G GS GKV LA +K T K+  +K             SS  T P+ +  
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLK-------------SSDKTDPNVV-- 78

Query: 73  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
              REI   +  + P + +LY+V  T + ++MV+EY    EL++ L+ K  +   E+ R 
Sbjct: 79  ---REIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESARI 135

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 192
           F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG     +++  LET CG+  Y
Sbjct: 136 FAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTVY 195

Query: 193 AAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFE--MPS 250
            APE++    Y G+  D+W+ G++L+ ++ G +PFDE+D     L +   S +++    +
Sbjct: 196 MAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFN 255

Query: 251 DDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
           DD I     DL+ ++L+ DP  R     IL HP L  Y
Sbjct: 256 DDSI-----DLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  176 bits (445), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 150/277 (54%), Gaps = 21/277 (7%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T  +  +K             SS    P+     
Sbjct: 34  EVGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLK-------------SSDKNDPN----- 75

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           I RE+   +  ++P + +LY+V  T + ++M LEY    EL++ ++    +   E ++ F
Sbjct: 76  IVREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLF 135

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+ G+ Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y 
Sbjct: 136 AQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVYM 195

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  D+WS GVIL+ ++ G +PFDE+D       +  Q+ +    +++ 
Sbjct: 196 APELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENI 252

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPS 290
           ++ +A+DL+ ++L  +P  R     ILKHP LQ + S
Sbjct: 253 VTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  168 bits (425), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 153/276 (55%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           ++ G+T+G G+ G V+ A   +TG++ A+K+I K     N  Q   L            E
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGNDIQLQMLYD----------E 90

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L HPN++     +E+   +Y+V + A  GELF+ ++++G   E +A+    QI+
Sbjct: 91  LAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQIL 150

Query: 138 IGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE E  L+  + GS  Y 
Sbjct: 151 KAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGYV 210

Query: 194 APEIV--SGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMP 249
           APE++  SG   HG   D+WS G+I + LL G  PF  E  DG +  ++   +   F  P
Sbjct: 211 APEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHSP 267

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             DEIS+EA+  + + +T+DP +R  A ++LK P +
Sbjct: 268 YWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  168 bits (425), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 154/276 (55%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG G+ G V+ A N  TG+  A+K++ K     N  Q  +L            E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y++ + A+ GELF+ +++KG   E +A+R   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMP 249
           APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +GE    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFHRP 263

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D +S +A+  + K L +DP KR  A  +L+ P +
Sbjct: 264 YWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  174 bits (442), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 118/373 (31%), Positives = 191/373 (51%), Gaps = 40/373 (10%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA +K T ++  +K   K+  N                  
Sbjct: 33  EVGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDKNDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +  ++  + RLY+V  T + ++M LEY    EL+  L+    +   E  R F
Sbjct: 75  VVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRLF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+  I Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+  Y 
Sbjct: 135 AQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMP--SD 251
           APE+     Y GF  D+W+ GVIL+ ++ G +PFDE+D        K+ +   EMP  ++
Sbjct: 195 APELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDE--AKTKWKIVN---EMPEINE 249

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY--PSI-KDSKSIRNLPREDTYLN 308
           D +S +A+DL+ ++L  DP +R     IL HP LQ Y  P + K  K +R   R   +  
Sbjct: 250 DLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRRGSVHF- 308

Query: 309 PLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENF 368
                +S +++ +L+ L  +  G D   + + +++   +A   L+ LL   ++  EK+  
Sbjct: 309 -----HSKLERKLLKRLKQM--GFDTQSMKASVQKKKCDALSGLWLLLVERELALEKQ-- 359

Query: 369 KNEQIRKRQSITS 381
             E+ R+ +S+ S
Sbjct: 360 --ERPRRSRSVLS 370

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  167 bits (422), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 157/276 (56%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           ++ G+TLG GS G V+ A  K+  ++ AIK++ K     N  Q   L            E
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYD----------E 76

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I+K L+HPN++   + +ET+  +Y+V + A  GELF+ +++KG   E +A++   QI+
Sbjct: 77  LTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQIL 136

Query: 138 IGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL L  K +  + IADFG+A  L+  ++L+  + GS  Y 
Sbjct: 137 SAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYV 196

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMP 249
           APE+++ +  HG   D+WS GVI + LL+G   F  E   +   L +  SG+    F  P
Sbjct: 197 APEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKFHKP 253

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D IS +A++ + K L ++P+KR  A ++L  P +
Sbjct: 254 YWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  167 bits (422), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 156/276 (56%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG G+ G V+ A N  TG+  A+K++ K     N  Q  +L            E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+N   Y++ + A+ GELF+ +++KG   E +A+R   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++++L+  + GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGYV 206

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMP 249
           APE+++    HG   D+WS GVI + LL G   F  E   + + L +  +G+    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHRP 263

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D +S +A+  + K L ++P KR  A ++L+ P +
Sbjct: 264 YWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  166 bits (419), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 147/274 (53%), Gaps = 21/274 (7%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G TLG GS G V+ A   +TG+  A+K++ K        Q   L            E+ 
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGKDVQLQMLYD----------ELS 97

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++KG   E++A+R   QI+  
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILKA 157

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYAAP 195
           + Y H+  IVHRDLKPENLL   + +   + + DFG+A  L  ED+L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVAP 217

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMPSD 251
           E+++    HG   D+WS GV+ + LL G  PF  E  ++   L +  SG     F  P  
Sbjct: 218 EVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPYW 274

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             IS +A+D + + LTV P  R  A ++L H  +
Sbjct: 275 SSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  165 bits (418), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 150/272 (55%), Gaps = 17/272 (6%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG G+ G V+ A   ++ +  A+K++ K+    N  Q   L            E+ 
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGNDVQLQMLYD----------ELS 89

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HPN++   D +E+    Y+V + A  GELF+ +++KG   E +A+    Q++  
Sbjct: 90  ILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDA 149

Query: 140 ISYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMAA-LETEDKLLETSCGSPHYAAP 195
           + Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++ D L+    GS  Y AP
Sbjct: 150 VKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAP 209

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSDDE 253
           E+++    HG   D+WS GVI + LL+G  PF  E  +G +          +F  P  D 
Sbjct: 210 EVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDS 268

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           IS EA+D + K LT+DPE+R  A +++  P +
Sbjct: 269 ISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  166 bits (419), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 153/276 (55%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG G+ G V+ A N  TG+  A+K++ K     N  Q  +L            E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y++ + A+ GELF+ +++KG   E +A+R   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMP 249
           APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +GE    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHRP 263

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D +S +A+  + K L +DP +R  A  +L  P +
Sbjct: 264 YWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  172 bits (435), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 154/283 (54%), Gaps = 21/283 (7%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K  +K   N                  
Sbjct: 33  EIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNKRDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +  + P + +LY+V  T S ++MVLEY    EL+  L+++  L  +E+ + F
Sbjct: 75  VVREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y 
Sbjct: 135 SQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  D+WS G+IL+ ++ G +PFDE+D +I+   LK+ + E +  + + 
Sbjct: 195 APELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQEW 251

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKS 296
           IS +A DL+  +L  +P +RI    +L HP LQ +  +   K+
Sbjct: 252 ISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKT 294

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  165 bits (417), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 119/394 (30%), Positives = 194/394 (49%), Gaps = 38/394 (9%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG G+ G V+ A    T +  A+K++ K     N  Q   L            E+ 
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYD----------ELS 96

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I+++L HPN++   D +E+    Y+V + A  GELF+ ++ KG   E++A+    QI+  
Sbjct: 97  ILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSA 156

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEDKLLETSCGSPHYAAP 195
           + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+  D L+  + GS  Y AP
Sbjct: 157 VDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAP 216

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSDDE 253
           E+++    HG   D+WS GVI++ LL G   F  E  DG +           F  P  D 
Sbjct: 217 EVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDN 275

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK--------YPSIKDSKSIRNLPREDT 305
           IS EA++ + + LT+DP +R  A +++K P +          YP I+    +R   R+  
Sbjct: 276 ISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRDAI 335

Query: 306 YLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEK 365
            +  L   N+ I K  L++L ++    D+ E ++ +      A  TL + L+  ++ S+K
Sbjct: 336 EIVKL---NNRIKK--LRSLYMVETDTDIEENVASV------AFNTLASSLNDLRLHSQK 384

Query: 366 E--NFKNEQIRKRQSITSSVSRSPAKKASTPQRR 397
                  EQ R + ++T        + A+  + R
Sbjct: 385 RVGQLTAEQRRLKSALTQDTFAQIVRAATKNKER 418

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  164 bits (416), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 152/276 (55%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG GS G V+ A   +TG+  A+K++ K     N  Q   L            E
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGNCVQIEMLYD----------E 87

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++     +E+    Y+  + A  GELF+ ++ +G   E +A+R   Q++
Sbjct: 88  LSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQLL 147

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEDKLLETSCGSPHYA 193
            GI Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++ D L+  + GS  Y 
Sbjct: 148 QGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLGYV 207

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG----EFEMP 249
           APE+++ +  HG   D+WS GVI + LL G  PF  E  ++   L +  SG    +F  P
Sbjct: 208 APEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHRP 264

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D IS EA++ + + L ++P KR  A ++L+ P +
Sbjct: 265 YWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  164 bits (414), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 149/269 (55%), Gaps = 21/269 (7%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG G+ G V+ A   ++G+  A+K++ K      S Q   L            E+ 
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYD----------ELS 97

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ LNHPN++R  D +E+    Y+V + A  GELF+ ++EKG   E +A+   +QI+ G
Sbjct: 98  ILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQG 157

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYAAP 195
           + Y H   IVHRDLKPEN+L  +K +   + I DFG+A  L+ +++L+  + GS  Y AP
Sbjct: 158 VQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAP 217

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMPSD 251
           E+++    HG   D+WS GVI + LL G  PF  E  +    + +  SG+    F  P  
Sbjct: 218 EVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESAD--GFIEECTSGQYPVVFHKPYW 274

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDIL 280
           + +S  A++ +   LTV P++R  A D++
Sbjct: 275 NNVSKTAKEFILWALTVSPKRRPTATDLI 303

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  170 bits (431), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 148/277 (53%), Gaps = 25/277 (9%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K             SSS T P+ +   
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLK-------------SSSKTDPNVV--- 76

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
             RE+   +  +HP + +LY++  T + ++M LEY    EL++ L+    +   E  R F
Sbjct: 77  --REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+  + Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+  Y 
Sbjct: 135 AQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  D+WS GVIL+ L+ G +PFDEED   R     +     E P  +E
Sbjct: 195 APELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDYNE 249

Query: 254 ISHEAQ--DLLAKILTVDPEKRIRARDILKHPLLQKY 288
               A   +L+  +L  DP+KR    +ILKH  L+ Y
Sbjct: 250 KIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  161 bits (407), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 146/276 (52%), Gaps = 26/276 (9%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
           +G  LG G  GKV    +K +G   A+KV+ K+               D L Y +ER+ I
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT---------------DILQYKLERQFI 159

Query: 80  ----IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ 135
               I   LNHPN+ +LY  +     +Y+++EY   GEL+  L   GP +   A  +  Q
Sbjct: 160 REVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVYQ 219

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAP 195
           I   I Y H   I+HRD+KPEN+L+     +K+ DFG + +  +     T CG+  Y +P
Sbjct: 220 IASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLSP 279

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQSGEFEMPSDDEI 254
           EIV    Y     D+W+ G++ + LL G  PF+E   N ++L   +++ G+   P   ++
Sbjct: 280 EIVDYKEY-DHNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFPK--QV 333

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPS 290
           + EA+D + +IL ++P+KR+  ++I+ HP + KY S
Sbjct: 334 TPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  162 bits (411), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 154/298 (51%), Gaps = 25/298 (8%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG GS G V+ A   +TG+  A+K++ K     N      L            E+ 
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQMLYD----------ELS 89

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HP+++   D +E+    Y+V + A  GELF+ ++ +G   E +A++   Q++  
Sbjct: 90  ILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLDA 149

Query: 140 ISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEDKLLETSCGSPHYAAP 195
           + Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+  D ++  + GS  Y AP
Sbjct: 150 VKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYVAP 209

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSDDE 253
           E+++ +  HG A D+WS GVI + LL+G   F  E  +G +           F  P  D+
Sbjct: 210 EVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWDK 268

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK--------YPSIKDSKSIRNLPRE 303
           IS EA+  +   LT++PE+R  A  +L HP +           PS+++    R   RE
Sbjct: 269 ISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFRE 326

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  169 bits (427), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 148/280 (52%), Gaps = 25/280 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA++K T ++  +K   K   N                  
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEKKDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +  + P + +LY+V  T S ++M LEY    EL++ L++K  +   E  + F
Sbjct: 75  VVREVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+  + Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  Y 
Sbjct: 135 AQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPS--D 251
           APE++    Y G+  D WS G+IL+ +L G +PFDEED  +    LK+ +   EMP   D
Sbjct: 195 APELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIVD 249

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
              +  A+DL+ K+L   P +R     +L+HP LQ Y +I
Sbjct: 250 AYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  162 bits (409), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 150/274 (54%), Gaps = 17/274 (6%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG G+ G V+ A   +T +  A+K++ K     NS Q   L            E
Sbjct: 32  YIFGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEGNSVQLQMLYD----------E 81

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ LNHPN++   D +ET    ++V + A  GELF+ +V+KG   E++AI+   QI+
Sbjct: 82  LSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEEDAIKILVQIL 141

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L++ D+L+  + GS  Y 
Sbjct: 142 GAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIFKAAGSLGYV 201

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++    HG   D+WS GVI + LL G   F  E  +G +       +   F  P  
Sbjct: 202 APEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQNDKPVVFHKPYW 260

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           D +S +A+  + + LT+DP KR  A  +L+ P +
Sbjct: 261 DNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  161 bits (408), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 146/268 (54%), Gaps = 17/268 (6%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG GS G V+ A   ++G+  AIK++ K        +   L            E+ 
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYD----------ELS 97

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E++A+R   QI+  
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 140 ISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEDKLLETSCGSPHYAAP 195
           + Y H+  IVHRDLKPENLL         + + DFG+A  L+ +D+L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSDDE 253
           E+V+    HG   D+WS GV+ + LL G  PF  E  +G +    +      F  P    
Sbjct: 218 EVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSN 276

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILK 281
           IS+EA+D + + LTV+P  R  A ++L+
Sbjct: 277 ISNEAKDFILRALTVNPHDRPTATELLQ 304

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  167 bits (424), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 152/287 (52%), Gaps = 33/287 (11%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
           + E +G G+   V+ A  +TTGK  A+K+ISK     N               G+ RE+ 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD-------------GVTRELE 246

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           +++ LNHP ++RL   +E   + YMV+E+   G+L + +   G + E       RQI+  
Sbjct: 247 VLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTA 306

Query: 140 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 197
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 198 VSGIPYHG----------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSG 244
           + G               ++S  D+WS G +++ +LTG LPF    G+ ++ L K +  G
Sbjct: 367 IRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRG 423

Query: 245 EF-EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYP 289
            + E P  D  IS EA+D +  +L VDP  R+ A   L HP ++  P
Sbjct: 424 SYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  167 bits (423), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 147/276 (53%), Gaps = 23/276 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA +  T ++  +K+ SK+  N                  
Sbjct: 33  EVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSKNDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +  ++ ++ +LY+V  T + ++M LEY    EL+  L+ K  +  +E    F
Sbjct: 75  VVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+  + Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+  Y 
Sbjct: 135 SQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSD-D 252
           APE++   PY G+  D WS G+IL+ ++ G +PFDE D     +  K +   +    D D
Sbjct: 195 APELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD----EVKTKYKIVHYNPTYDND 250

Query: 253 EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288
            I    ++L++++L  DP +R     +L+HP LQ Y
Sbjct: 251 YIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 149/280 (53%), Gaps = 25/280 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +++ + +G GS GKV LA +K T ++  +K  +KS  N                  
Sbjct: 33  EVGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPN------------------ 74

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           + RE+   +   +P + +LY+V  T + ++M LEY    EL++ L+ K  +   E  R F
Sbjct: 75  VVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI+  + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  Y 
Sbjct: 135 AQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYM 194

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPS--D 251
           APE++    Y G+  D WS G+IL+ +L G +PFDE+D  +R  L  +     E P+  D
Sbjct: 195 APELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGLKIMH----EEPAVLD 249

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
           +  S +A+DL+ ++L  +  +R    ++L+HP LQ Y ++
Sbjct: 250 EYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  166 bits (421), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 148/285 (51%), Gaps = 33/285 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  +TTGK  A+K+ISK     N               G+ RE+ ++
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD-------------GVTRELEVL 248

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + LNHP ++RL   +E   + YMV+E+   G+L + +   G + E       RQI+  I 
Sbjct: 249 QKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIK 308

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 309 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIR 368

Query: 200 GIPY------------HGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF 246
           G               +    D+WS G +++ +LTG LPF    G+ ++ L K +  G +
Sbjct: 369 GKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSY 425

Query: 247 -EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYP 289
            E P  D  IS EA+D +  +L VDP  R  A   L HP ++  P
Sbjct: 426 HEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSP 470

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  167 bits (422), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 147/280 (52%), Gaps = 25/280 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K   K+  N                  
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDKNDPN------------------ 78

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           I RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+    L   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELF 138

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  D+WS GVIL+ L+TG LPFD++D  ++     V     E P  D 
Sbjct: 199 APELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EVKTKWKIVN----EEPKYDS 253

Query: 254 --ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
             I  +A+DL++++L  +P +R     +L+HP LQ Y S+
Sbjct: 254 KFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  166 bits (421), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 153/292 (52%), Gaps = 25/292 (8%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K   K+  N                  
Sbjct: 37  EVGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDKNDPN------------------ 78

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           I RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAELF 138

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  D+WS GVIL+ L+TG LPFD++D  ++     V     E P+ D 
Sbjct: 199 APELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNYDS 253

Query: 254 --ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRE 303
             I  +A+DL++++L  +P++R     +L H  LQ Y S+   ++ + L R+
Sbjct: 254 TLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 154/294 (52%), Gaps = 34/294 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  + TGK  A+K+I+K     N               G+ RE+ ++
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD-------------GVSRELEVL 238

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + LNHP ++ L   +E  +N YMV+E+   G+L + +   G + E+      RQI+  I 
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++    +++T CG+  Y APE++ 
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIG 358

Query: 200 GIP-------------YHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQSGE 245
           G                +    D+WS G ++F +LTG LPF    G+ +  L  +++ G 
Sbjct: 359 GFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKGS 415

Query: 246 F-EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSI 297
           + E P  D  IS EA+D +  +L VD  KR+   D L HP +++  S  D+ S+
Sbjct: 416 YHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  160 bits (405), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 153/270 (56%), Gaps = 17/270 (6%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           ++ G+TLG GS G V+ A   ++ ++ A+K++ K     N+ Q   L           +E
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENAIQLRMLY----------QE 80

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I+K L+H N++   + +ET+  LY+V + A  GELF+ ++ +G   E +A++   QI+
Sbjct: 81  LSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIVQIL 140

Query: 138 IGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPENLL    +    + IADFG+A  L++ ++L+  + GS  Y 
Sbjct: 141 SAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSLGYV 200

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++ +  HG   D+WS GVI + LL G   F  E  +G +   +   Q  +F+ P  
Sbjct: 201 APEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQKPYW 259

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILK 281
           D IS  A++ + K L + PE+R  A ++LK
Sbjct: 260 DNISQSAKNFILKCLDLTPEQRPTATELLK 289

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  166 bits (420), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 146/278 (52%), Gaps = 21/278 (7%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K   K+  N                  
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDKNDPN------------------ 78

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           I RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELF 138

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE++    Y GF  D+WS GVIL+ L+TG LPFD++D       +  +  +++      
Sbjct: 199 APELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKV--- 255

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
           I  +A+DL++++L  +P +R     +L+HP LQ Y S+
Sbjct: 256 IPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 150/288 (52%), Gaps = 35/288 (12%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
           + E +G G+   V+ A  +TTGK  A+K+ISK     N               G+ RE+ 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD-------------GVTRELE 246

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           +++ LNHP ++RL   +E   + YMV+E+   G+L + +   G + E       RQI+  
Sbjct: 247 VLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILAA 306

Query: 140 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 197
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 198 VSGI-------------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQS 243
           + G               Y     D+WS G +++ +LTG LPF    G+ ++ L K +  
Sbjct: 367 IRGKDSSVSPDECEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 244 GEF-EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYP 289
           G + E P  D  IS EA+D +  +L VDP  R+ A   L HP ++  P
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  166 bits (420), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 146/281 (51%), Gaps = 27/281 (9%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           ++G +K+ + +G GS GKV LA ++ T ++  +K   K+  N                  
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDKNDPN------------------ 78

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
           I RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELF 138

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFE---MPS 250
           APE++    Y GF  D WS GVIL+ L+TG LPFD++D       +  +  +++   +P 
Sbjct: 199 APELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPD 258

Query: 251 DDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
           D      A+DL++++L  +P +R     +L+HP LQ Y S+
Sbjct: 259 D------AKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  165 bits (418), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 145/271 (53%), Gaps = 21/271 (7%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74
           +G +++ + +G GS GKV LA ++ T ++  +K+ SK+  N                  +
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSKNDPN------------------V 75

Query: 75  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134
            RE+   +  ++  + +LY+V  T ++++M LEY    EL+  L+ K  +   E    F 
Sbjct: 76  VREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLFS 135

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194
           QI+  + Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYMA 195

Query: 195 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254
           PE++   PY G+  D WS G+IL+ ++ G +PFDEED +I+     V +  F    D+ I
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNFI 252

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
               +DL+ ++L  DP +R     +L+HP +
Sbjct: 253 DANGKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  165 bits (417), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 150/275 (54%), Gaps = 27/275 (9%)

Query: 24  LGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIMKL 83
           +G G+   V+ A  ++TGK  A+K+I K                D    G++RE+ +++ 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKR------------KVMDKFD-GVKRELDVLQK 244

Query: 84  LNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYC 143
           LNHP +++L D +E N N YM++E+   G+L + +   G + E       RQ++  + Y 
Sbjct: 245 LNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYM 304

Query: 144 HALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           H  GI HRDLKP+N+++  D    IKI DFG+A ++ ++  L T CG+  Y APE++ G 
Sbjct: 305 HDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGK 364

Query: 202 --------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEF-EMP-SD 251
                     +    D+WS G +++ +LTG LPF  +  N   L  +++ G + E P  D
Sbjct: 365 NAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKD 422

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
             IS EA++ +  +L VDP++R+ A   L+HP ++
Sbjct: 423 YRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  157 bits (397), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/274 (31%), Positives = 147/274 (53%), Gaps = 16/274 (5%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYG 73
           +L  +++G  LG G  GKV    +K +G   A+KV++K    N + Q             
Sbjct: 114 KLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ----------- 162

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
            +REI I   LNH N+ +LY  +  + N+Y+V+EY   GEL+ LL + GP+ +  A  + 
Sbjct: 163 FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITASNYV 222

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +     ++  +T CG+  Y 
Sbjct: 223 YQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTIDYL 282

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           +PE++S   Y     DVW+ G++ + L+ G  PF+E+         ++   + + P +  
Sbjct: 283 SPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFPPN-- 337

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
           +S EA+DL+  +L V P +R   + ++ HP ++K
Sbjct: 338 VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  164 bits (416), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 152/293 (51%), Gaps = 35/293 (11%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
           + E +G G+   V+ A  +TTGK  A+K+ISK     N               G+ RE+ 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD-------------GVTRELE 246

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           +++ L+HP ++RL   +E   + YMV+E+   G+L + +   G + E       RQI+  
Sbjct: 247 VLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEA 306

Query: 140 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 197
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 198 VSGI-------------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQS 243
           + G               Y     D+WS G +++ +LTG LPF    G+ ++ L K +  
Sbjct: 367 IRGKDSSVSPDEYEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 244 GEF-EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDS 294
           G + E P  D  IS EA+D +  +L VDP  R+ A   L HP ++  P +  S
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  158 bits (400), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 150/278 (53%), Gaps = 22/278 (7%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIMK 82
           TLG GS G V+ A    + +  A+K++ K     N                I  E+ I++
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEP-----------IYDELNIIQ 118

Query: 83  LLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISY 142
            L+HPN+++  D +ET S  Y+V + A  GELF+ ++  G   E++A+    QI+  + Y
Sbjct: 119 HLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEY 178

Query: 143 CHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPHYAAPEIV 198
            H+  I+HRDLKPENLL LD   +  I +ADFG+A  LE +D ++    GS  Y APE+ 
Sbjct: 179 LHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVF 238

Query: 199 SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMPSDDEI 254
           +    HG  SD+WS GVI + LL G  PF  E  ++   L +V S E    F+ P  D I
Sbjct: 239 TS-DGHGKPSDIWSVGVITYTLLCGYSPFKAE--SVDGFLDEVTSDENPVKFQRPYWDGI 295

Query: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIK 292
           S  A++ + +IL +DP  R  A ++L  P +Q   S++
Sbjct: 296 SELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  164 bits (414), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 150/280 (53%), Gaps = 31/280 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  +TTGK  A+K+I+K     N               G+ RE+ ++
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKRKVMGNLD-------------GVTRELEVL 237

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           K LNHP ++ L   +E N + YMV+E+   G+L + +   G + E       RQI+  + 
Sbjct: 238 KRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAVK 297

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 298 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 357

Query: 200 GIPYHG--------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-E 247
               +         ++S  D+WS G +++ +LTG LPF    G+ +  L K +  G + E
Sbjct: 358 SSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHE 414

Query: 248 MP-SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
            P  D  IS EA+D +  +L VDP  R+ A   L+HP ++
Sbjct: 415 GPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  164 bits (414), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 148/282 (52%), Gaps = 32/282 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A    TG+  A+K+I+K     N               G+ RE+ ++
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKVMGNLD-------------GVTRELTVL 252

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + L+HP+++ L   +E   N YMV+E+   G+L + +   GP+ E       RQI+  + 
Sbjct: 253 QKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAVK 312

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     + T CG+  Y APE+V+
Sbjct: 313 YIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVVN 372

Query: 200 G--------IP-----YHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEF 246
           G        +P     ++    D+WS G +++ +LTG LPF       + L  ++    +
Sbjct: 373 GRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKASY 430

Query: 247 -EMP-SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
            E+P  D  IS +A+D +  +L VDP  R+ A   L+HP +Q
Sbjct: 431 HEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/284 (32%), Positives = 154/284 (54%), Gaps = 21/284 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG G+ G V+ A   +T +  A+K++ K     N  Q   L            E
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGNDVQLQLLYD----------E 89

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++ KG   E +A++   QI+
Sbjct: 90  LKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQIL 149

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L++ D+L+  + GS  Y 
Sbjct: 150 SAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGYV 209

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG----EFEMP 249
           APE+++    HG   D+WS GV+ + LL+G  PF  E  ++   L +   G    +F  P
Sbjct: 210 APEVLT-TSGHGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKFHKP 266

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKD 293
             D IS +A++ + + L + P KR  A ++L+ P +    S K+
Sbjct: 267 YWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 147/269 (54%), Gaps = 23/269 (8%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG G+ G V+ A N    +  AIK++ K     N  Q             +  E+ 
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQM------------LYDELS 105

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++KG   E +A++   Q++  
Sbjct: 106 ILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTA 165

Query: 140 ISYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMA-ALETEDKLLETSCGSPHYAAP 195
           + Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS  Y AP
Sbjct: 166 VEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAP 225

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE----FEMPSD 251
           E+++    HG   D+WS GVI + LL G  PF  E  +    L +V SG     F  P  
Sbjct: 226 EVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAE--STEGFLEEVFSGSDPVTFHSPYW 282

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDIL 280
           + IS EA+  + + LT+ P +R  A ++L
Sbjct: 283 NNISKEAKQFILRALTLTPARRPTAAELL 311

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  161 bits (408), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 140/229 (61%), Gaps = 7/229 (3%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL  +  L E E +RFF   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 137 IIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 194
           I+G + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE+++G    H +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G+F  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLP 301
           IS EA  L+  IL++DP +R    +I+ +   +  +PS  D+  + + P
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 130/207 (62%), Gaps = 6/207 (2%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           EI I K + HPN++   D +E ++N+Y++LE    G L +L+ ++  L E E +RFF   
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 137 IIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 194
           I G + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+   ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE++ G    H F  D+WS GV+++ALL G+ PF  +D N+  +  ++++ ++  P D  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDIL 280
           +S EA+ L+A IL VDP +R   R+I+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  162 bits (411), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 147/278 (52%), Gaps = 30/278 (10%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  + TGK  A+K+I+K     N               G+ RE+ ++
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKVMGNMD-------------GVTRELEVL 238

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + LNHP ++ L   +E   + Y+V+E+   G+L + +   G + E       RQ++  + 
Sbjct: 239 RRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVK 298

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVIS 358

Query: 200 GI--------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-EMP 249
           G          Y     D+WS G +++ +LTG LPF    G+ +  L K + +G + E P
Sbjct: 359 GKNSEEKEGNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHEGP 414

Query: 250 -SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
             D  IS +A+D +   L V+P  R+ A   LKHP ++
Sbjct: 415 LKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 149/269 (55%), Gaps = 18/269 (6%)

Query: 8   PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTP 67
           PS+   +   +  G  LG G   +        +GK  A K ++K    +   +   L+  
Sbjct: 69  PSLIKTRGRDYHRGHFLGEGGFARC-FQIKDDSGKIFAAKTVAKISIKSEKTRKKLLS-- 125

Query: 68  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQ 127
                    EI I K + H N+++  D +E ++N+Y++LE    G L +LL  +  L E 
Sbjct: 126 ---------EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEP 176

Query: 128 EAIRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-T 185
           E +RFF   I+G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T
Sbjct: 177 E-VRFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYT 235

Query: 186 SCGSPHYAAPEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            CG+P+Y APE+++G    H +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G
Sbjct: 236 VCGTPNYIAPEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCG 293

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKR 273
           ++  P D  IS EA  L+  IL++DP +R
Sbjct: 294 DYVFPRDKCISQEALTLIRDILSIDPLER 322

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  155 bits (392), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 155/286 (54%), Gaps = 17/286 (5%)

Query: 3   ASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSS 62
           A +N+ S    Q   +++G  LG G  GKV    +K +G  +A+KV+ K    + +A+  
Sbjct: 160 AISNINSKNKLQFSDFEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ 219

Query: 63  SLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELF-NLLVEK 121
                       +RE+ +   LNHPN+++++  ++    +Y+++EY   GEL+ +L    
Sbjct: 220 -----------FKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNN 268

Query: 122 GPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 181
           GP  +  A  +  QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +     + 
Sbjct: 269 GPFNDILASNYIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNL 328

Query: 182 LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 241
             +T CG+  Y APE+V+   Y  +  D+W+ G++ + L+ G  PF+EE  ++     ++
Sbjct: 329 RRKTICGTIDYLAPELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDLT--YKRI 385

Query: 242 QSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK 287
            + +   P    +S +A+DL+ ++L  DP KR+   D++KHP + K
Sbjct: 386 INVDLNFP--QTVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  155 bits (393), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 117/390 (30%), Positives = 190/390 (48%), Gaps = 33/390 (8%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G TLG GS G V+ A   +T +  AIK++ K     N+ Q   L            E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNIQLQMLY----------EE 96

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQIL 156

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEDKLLETSCGSPHYA 193
             + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYW 275

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK--------YPSIKDSKSIRNLPRE 303
           D IS +A+  + K L ++P  R  A ++L  P +           P +K   S+R   R+
Sbjct: 276 DNISVDAKRFILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

Query: 304 DTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLD-RFKID 362
              +  L   N+ I +  L+N+ +L  G D +  I +    G+  +    +L D RF+  
Sbjct: 336 AIEIVKL---NNRIKR--LRNMYLL--GDDGDNDIEENSPTGSCLDGITRSLHDLRFQPQ 388

Query: 363 SEKENFKNEQIRKRQSITSSVSRSPAKKAS 392
            +      EQ++ + ++T        K A+
Sbjct: 389 KKVVELSKEQMKLKSALTKDAFVQIVKAAT 418

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  161 bits (408), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 151/287 (52%), Gaps = 39/287 (13%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISK-SVFNNNSAQSSSLTTPDALPYGIEREIII 80
           E +G G+   V+ A  ++TGK  A+K+ISK  V  +N               G+ RE+ +
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMD-------------GVSRELEV 252

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGI 140
           ++ L+HP ++RL   +E + N YM++E+   G+L + +   G + E       RQI+  I
Sbjct: 253 LQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAI 312

Query: 141 SYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 198
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APEI+
Sbjct: 313 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEII 372

Query: 199 SGI----------------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-V 241
           SG                  Y     D+WS G +++ +LTG LPF    G+ +  L K +
Sbjct: 373 SGKNDGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQKQLYKQI 428

Query: 242 QSGEF-EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
             G + E P  D  IS EA+D +  +L V P  R+ A   L+HP ++
Sbjct: 429 SRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 149/275 (54%), Gaps = 17/275 (6%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+TLG GS G V+ A   +T +  A+K+I K     N  Q   L            E
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGNDVQLQMLYD----------E 96

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q++
Sbjct: 97  LSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQML 156

Query: 138 IGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEDKLLETSCGSPHYA 193
             I Y H+  IVHRDLKPEN+L         + IADFG+A  L+  D L+  + GS  Y 
Sbjct: 157 KAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSLGYV 216

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++    HG   D+WS GVI + LL G   F  E  +G +      +   +F  P  
Sbjct: 217 APEVLT-TNGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHEPYW 275

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
           + +S EA++ + K LT++P++R  A ++L  P ++
Sbjct: 276 NNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  156 bits (395), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 159/311 (51%), Gaps = 43/311 (13%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           + LG+ LG G    V+ A NKTTG+  A+K+      N++  ++             E  
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQ-NDDQKKNKQFR---------EET 242

Query: 78  IIIMKLLNHPNVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
            I+MK+ +HPN++ L D     + +T    Y+VLE  + GELF+ +V+K  L ++E+   
Sbjct: 243 TILMKI-HHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAI 301

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------YNIKIADFGM 173
           F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIADFG+
Sbjct: 302 FKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGL 361

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVILFALLTGRLPFDEED 231
           A    E +   T CG+P Y APE++      G+ S  D+WS GVIL+  L G  PF ++ 
Sbjct: 362 AKFTGEMQFTNTLCGTPSYVAPEVLVK---KGYTSKVDLWSAGVILYVCLCGFPPFSDQL 418

Query: 232 G--NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYP 289
           G  +++  ++  +   F  P  DEI   A  L++ +L +DPE R        HP L    
Sbjct: 419 GPPSLKEQIMSAKYA-FYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSVS 477

Query: 290 SIKDSKSIRNL 300
            +  S +++ L
Sbjct: 478 HLDVSHNLKRL 488

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 149/278 (53%), Gaps = 30/278 (10%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  + TGK  A+K+ISK            +   D    G+ RE+ ++
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKR---------KVVGVMD----GVARELEVL 238

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + L+HP ++ L   +E   + Y+V+E+   G+L + +   G + E       RQI+  + 
Sbjct: 239 QRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 298

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 200 GI--------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-EMP 249
           G          Y     D+WS G +++ +LTG LPF    G+ +N L K + +G + E P
Sbjct: 359 GKNSGEKEGNTYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHEGP 414

Query: 250 -SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
             D  IS +A+D +   L VDP  R+ A   L+HP ++
Sbjct: 415 LKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/274 (34%), Positives = 145/274 (52%), Gaps = 17/274 (6%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G TLG GS G V+ A   +T +  AIK++ K     N+ Q   L            E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY----------EE 96

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    QI+
Sbjct: 97  LSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 138 IGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPHYA 193
             + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYW 275

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           D IS +A+  + K L +DP  R  A ++L  P +
Sbjct: 276 DSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 161/311 (51%), Gaps = 25/311 (8%)

Query: 8   PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTP 67
           PS+   +   +  G  LG G   +        +G+  A K ++K+   +   +   L+  
Sbjct: 72  PSLIKTRGKDYHRGHFLGEGGFARC-FQIKDDSGEIFAAKTVAKASIKSEKTRKKLLS-- 128

Query: 68  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQ 127
                    EI I K + HPN+++  D +E +SN+Y++LE    G L  LL  +  L E 
Sbjct: 129 ---------EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEP 179

Query: 128 EAIRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLET 185
           E +RFF   I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T
Sbjct: 180 E-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYT 238

Query: 186 SCGSPHYAAPEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            CG+P+Y APE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++  
Sbjct: 239 ICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCR 296

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY--PSI-----KDSKSI 297
           +F  P D  IS E + L+  IL++DP +R    +I+ +   +    PSI      ++ + 
Sbjct: 297 DFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNF 356

Query: 298 RNLPREDTYLN 308
            N+P E + +N
Sbjct: 357 DNIPEEQSLIN 367

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 117/189 (61%), Gaps = 4/189 (2%)

Query: 99  NSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENL 158
           +++ YM+ EY   G+L + +++ G L+E+ A +F R I   + Y H   IVHRDLK EN+
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENI 64

Query: 159 LLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILF 218
           ++     IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+LF
Sbjct: 65  MISTSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLF 124

Query: 219 ALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARD 278
            L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   LL+K+L VDP KR   + 
Sbjct: 125 VLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQ 180

Query: 279 ILKHPLLQK 287
           ++ H  +Q+
Sbjct: 181 VVNHQWMQR 189

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 148/279 (53%), Gaps = 30/279 (10%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  ++TG+  A+K+I+K     N +             G+ RE+ I+
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVMGNLS-------------GVTRELEIL 247

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + L+HP ++RL   +E   + Y+V+E+   G+L + +   G + E       RQI+  ++
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVA 307

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H  GI HRD+KP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++S
Sbjct: 308 YMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIS 367

Query: 200 G----------IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEF-EM 248
           G          I Y     D+WS G +++ +LT  LPF       + L  ++  G + E 
Sbjct: 368 GKNAATENDDRIEYSSLV-DMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHEG 424

Query: 249 P-SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
           P  D  +S EA+D +  ++ VDP  R+ A+D LKH  ++
Sbjct: 425 PLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  154 bits (388), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 145/268 (54%), Gaps = 19/268 (7%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
            G+TLG G+ G V+ A N    +  A+K++ K     +                +  E++
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKGDELNM------------LYDELM 103

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I++ L+HP++++  D +E+    Y+V + A  GELF+ +++KG   E +A++   Q++  
Sbjct: 104 ILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQMLEA 163

Query: 140 ISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEDKLLETSCGSPHYAAP 195
           I Y H+  +VHRDLKPEN+L         + I+DFG+A  L +ED L+  + GS  Y AP
Sbjct: 164 IEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGYVAP 223

Query: 196 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSDDE 253
           E+++    HG   D+WS GVI + LL G  PF  E  +G +  +        F  P  + 
Sbjct: 224 EVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPYWNS 282

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILK 281
           IS EA++ + K LT+DP +R  A ++L+
Sbjct: 283 ISVEAKEFILKALTLDPSERPTATELLQ 310

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/280 (31%), Positives = 149/280 (53%), Gaps = 32/280 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  + TGK  A+K+ISK     N               G+ RE+ ++
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVMGNID-------------GVTRELEVL 238

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + LNHP ++RL   +E + + Y+++E+   G+L + +   G + E       +Q++  + 
Sbjct: 239 RRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAVK 298

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H +GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 200 GI----------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-E 247
           G            Y     D+WS G +++ +LTG LPF    G+ ++ L K +  G + E
Sbjct: 359 GKNSEDKSQNKNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYHE 414

Query: 248 MPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
            P  D  IS EA++ +  +L V+P+ R+ A   L HP ++
Sbjct: 415 GPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  153 bits (387), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 152/300 (50%), Gaps = 25/300 (8%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G TLG GS G V+ A   +T +  AIK++ K     N+ Q   L            E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY----------EE 96

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQIL 156

Query: 138 IGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPHYA 193
             + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E+ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYV 216

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYW 275

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK--------YPSIKDSKSIRNLPRE 303
           D IS + +  + K L ++P  R  A ++L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 150/280 (53%), Gaps = 32/280 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  ++TGK  A K+ISK     N               G+ RE+ ++
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKVMGNMD-------------GVTRELEVL 243

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + LNHP ++RL   +E +   Y+++E+   G+L + +   G + E       RQ++ G+ 
Sbjct: 244 RKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGVK 303

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+++
Sbjct: 304 YIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIA 363

Query: 200 GIP----------YHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-E 247
           G            Y     D+WS G +++ +LTG LPF    G+ +  L K +++G + E
Sbjct: 364 GKANAEENEKRNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYHE 419

Query: 248 MPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
            P  D  IS EA+D +  +L V+P  R  A+  L+HP ++
Sbjct: 420 GPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/265 (34%), Positives = 149/265 (56%), Gaps = 18/265 (6%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G  LG G   +        +GK  A K ++K    +   +   L+           EI I
Sbjct: 76  GMFLGEGGFARC-FQMKDDSGKVFAAKTVAKISIKSEKTRKKLLS-----------EIQI 123

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG- 139
            K + HPN+++  D +E ++N+Y++LE    G L +LL ++  L E E +RFF   I+G 
Sbjct: 124 HKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQIVGA 182

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIV 198
           I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y APE++
Sbjct: 183 IKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVL 242

Query: 199 SG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHE 257
           +G    H F  D+WS GV+++ALL G+ PF  ++ N   +  +++  +F  P D  IS E
Sbjct: 243 TGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKPISSE 300

Query: 258 AQDLLAKILTVDPEKRIRARDILKH 282
           A+ L+  IL++DP +R    +I+++
Sbjct: 301 AKVLIKDILSLDPLERPSLAEIMEY 325

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 102/311 (32%), Positives = 162/311 (52%), Gaps = 25/311 (8%)

Query: 8   PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTP 67
           PS+   +   +  G  LG G   +        +G+  A K ++K+   +   +   L+  
Sbjct: 72  PSLIKTRGKDYHRGHFLGEGGFARC-FQIKDDSGEIFAAKTVAKASIKSEKTRKKLLS-- 128

Query: 68  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQ 127
                    EI I K ++HPN+++  D +E +SN+Y++LE    G L  LL  +  L E 
Sbjct: 129 ---------EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEP 179

Query: 128 EAIRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLET 185
           E +RFF   I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T
Sbjct: 180 E-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYT 238

Query: 186 SCGSPHYAAPEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            CG+P+Y APE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++  
Sbjct: 239 ICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCR 296

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY--PSI-----KDSKSI 297
           +F  P D  IS E + L+  IL++DP +R    +I+ +   +    PSI      ++ + 
Sbjct: 297 DFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNF 356

Query: 298 RNLPREDTYLN 308
            ++P E + +N
Sbjct: 357 EDIPEEQSLVN 367

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 19/291 (6%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G  LG G   +     N  +GK  A K ++K    +   +   L+           EI I
Sbjct: 86  GHFLGEGGFARC-FQFNDDSGKIFAAKTVAKLSIKSEKTRRKLLS-----------EIQI 133

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG- 139
            K + + N+++  D +E ++N+Y++LE    G L +LL ++  L E E +RFF   I G 
Sbjct: 134 HKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGA 192

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIV 198
           I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y APE++
Sbjct: 193 IKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 252

Query: 199 SG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHE 257
            G    H +  D+WS GV+L+ALL G+ PF  +D N   +  +++  +F  P D  IS E
Sbjct: 253 MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKYISPE 310

Query: 258 AQDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLPREDTYL 307
           A+ L+  +L++DP +R    +I+ +   +  +P   +S  + N+P  D  L
Sbjct: 311 AKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 132/209 (63%), Gaps = 6/209 (2%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           EI I K + HPN+++  D +E ++N+Y++LE    G L +LL ++  L E E +RFF   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 137 IIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 194
           I+G I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE+++G    H F  DVWS GV+++ALL G+ PF  ++ N   +  +++  +F  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKP 296

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKH 282
           IS EA+ L+  IL++DP +R    +I+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  157 bits (397), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 137/242 (56%), Gaps = 13/242 (5%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           EI I K + HPN+++  D +E +SN+Y++LE    G L  LL  +  L E E +RFF   
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQ 187

Query: 137 IIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 194
           I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++  +F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY--PSIKDS-----KSIRNLPREDTY 306
           IS E + L+  IL++DP +R    +I+ +   +    PSI  +      +  N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVPNFGNIPEEQSL 365

Query: 307 LN 308
           +N
Sbjct: 366 VN 367

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  157 bits (397), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 148/278 (53%), Gaps = 18/278 (6%)

Query: 8   PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTP 67
           PS+   +   +  G  LG G   +        +G+  A K ++K+   +   +   L+  
Sbjct: 72  PSLIKTRGKDYHRGHFLGEGGFARC-FQIKDDSGEIFAAKTVAKASIKSEKTRKKLLS-- 128

Query: 68  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQ 127
                    EI I K ++HPN+++  D +E +SN+Y++LE    G L  LL  +  L E 
Sbjct: 129 ---------EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEP 179

Query: 128 EAIRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLET 185
           E +RFF   I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T
Sbjct: 180 E-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYT 238

Query: 186 SCGSPHYAAPEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            CG+P+Y APE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++  
Sbjct: 239 ICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCR 296

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           +F  P D  IS E + L+  IL++DP +R    +I+ +
Sbjct: 297 DFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  150 bits (380), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 147/280 (52%), Gaps = 16/280 (5%)

Query: 6   NLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLT 65
           NLP  K   L  ++LG+ LG G  GKV    +++TG   A+KV+ K      + Q     
Sbjct: 92  NLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGFICALKVMEKEEIIKYNLQRQ--- 148

Query: 66  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQ 125
                     RE+ I   LNHPN+ + Y  +     +Y+++EY   GE++ LL   GP  
Sbjct: 149 --------FRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFN 200

Query: 126 EQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLET 185
           +  A  +  QI   + Y H   I+HRD+KPEN+L+     IK+ DFG + +   D   +T
Sbjct: 201 DILASDYVYQIANALDYMHKKNIIHRDIKPENILIGFNNIIKLTDFGWSIINPPDSRRKT 260

Query: 186 SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE 245
            CG+  Y +PE++    Y     D W+ GV+ F LLTG  PF+EE  +      ++ + +
Sbjct: 261 VCGTIDYLSPEMIESREY-DHTIDAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALD 317

Query: 246 FEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
            ++PS+  IS +AQDL+ K+L  DP+ R+R  D+  HP +
Sbjct: 318 IKIPSN--ISQDAQDLILKLLKYDPKDRMRLEDVKMHPWI 355

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  158 bits (399), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 161/306 (52%), Gaps = 19/306 (6%)

Query: 8   PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTP 67
           PS+   +   ++ G+ LG G   +     +++ GK  A K ++K        +   L+  
Sbjct: 132 PSLIKTRGRDYRRGQFLGEGGFARCFQIKDES-GKIFAAKTVAKISIKTEKTRRKLLS-- 188

Query: 68  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQ 127
                    EI I K + H N+++  D +E + N+Y++L     G L  LL ++  L E 
Sbjct: 189 ---------EIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEP 239

Query: 128 EAIRFFR-QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-T 185
           E +RFF  QI   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T
Sbjct: 240 E-VRFFTVQICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYT 298

Query: 186 SCGSPHYAAPEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            CG+P+Y APE++ G    H +  D+WS GV++FALL G+ PF  +D N   +  ++++ 
Sbjct: 299 VCGTPNYIAPEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNS 356

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ-KYPSIKDSKSIRNLPRE 303
           E+  P +  IS EA+ L+  IL  DP  R    +I+++   +  +PS+  +     +P  
Sbjct: 357 EYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEY 416

Query: 304 DTYLNP 309
           D +L P
Sbjct: 417 DQFLTP 422

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  150 bits (380), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 138/260 (53%), Gaps = 24/260 (9%)

Query: 32  VQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIER----EIIIMKLLNHP 87
           V    +  TG   AIK++ KS               + L Y + +    EI I   LNH 
Sbjct: 140 VYCCRHIKTGFICAIKIMDKS---------------EILTYNVTKQFRNEIEIQSNLNHE 184

Query: 88  NVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALG 147
           N+ +LY  +  +  +Y+++EY   GEL+++L + GP  +  A  F  Q+   I Y H   
Sbjct: 185 NLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKR 244

Query: 148 IVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFA 207
           I+HRDLKPEN+L+D    IKI DFG +         +T CG+  Y +PE+++   Y G  
Sbjct: 245 IIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGLI 304

Query: 208 SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILT 267
            DVW+ G+I + L+ G  PF+E+   +     ++++ +   P+   +S +A++L++ +L 
Sbjct: 305 -DVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISSLLK 359

Query: 268 VDPEKRIRARDILKHPLLQK 287
           ++P +RI   D+LKHP + K
Sbjct: 360 LNPSERITLTDVLKHPWINK 379

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  157 bits (398), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 147/278 (52%), Gaps = 30/278 (10%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  ++TGK  A+K+ISK     N               G+ RE+ ++
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME-------------GVSRELEVL 245

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + L+HP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+  + 
Sbjct: 246 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 305

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 306 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIG 365

Query: 200 GIP--------YHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-EMP 249
           G          Y     D+WS G +++ +LTG LPF    G+ +  L K +  G + E P
Sbjct: 366 GKGETNEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGP 421

Query: 250 SDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
             D  IS EA+  +  +L V+P  R+ A   L+HP ++
Sbjct: 422 LKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 149/276 (53%), Gaps = 17/276 (6%)

Query: 16  GPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIE 75
           G +  G+TLG G+ G V+ A   +T +  A+K+I K     N  Q   L           
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKGNDIQLQMLYD--------- 87

Query: 76  REIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ 135
            E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ KG   E +A++   Q
Sbjct: 88  -ELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVVQ 146

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEDKLLETSCGSPH 191
           I+  I Y H+  +VHRDLKPEN+L     +   I IADFG+A  L+ ++ L+  + GS  
Sbjct: 147 ILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSLG 206

Query: 192 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMP 249
           Y APE+++    HG   D+WS GVI + LL G   F  E  +G +          +F  P
Sbjct: 207 YVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTRSKFPVKFHKP 265

Query: 250 SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
             D IS EA++ + + LT++P++R  A ++L+ P +
Sbjct: 266 YWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 154/300 (51%), Gaps = 25/300 (8%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G TLG GS G V+ A   +T +  AIK++ K     N+ Q   L            E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY----------EE 96

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 138 IGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPHYA 193
             + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGEFEMPSD 251
           APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F +P  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYW 275

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK--------YPSIKDSKSIRNLPRE 303
           D IS +A+  + K L ++P +R  A ++L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDAKRFILKALRLNPTERPTATELLDDPWITSKRIGTSNILPDVKKGFSLRKKLRD 335

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  149 bits (377), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 134/254 (52%), Gaps = 16/254 (6%)

Query: 32  VQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLR 91
           V    +K TG   A+KV+ K+     + Q               RE+ I   LNHPN+ +
Sbjct: 105 VYCVRHKETGFICALKVMDKAEIVQYNLQKQ-----------FRREVEIQTSLNHPNLTK 153

Query: 92  LYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHR 151
           LY  +     +Y+++EY   GEL+ LL   GP  +  A RF  QI   ++Y H   I+HR
Sbjct: 154 LYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQIIHR 213

Query: 152 DLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVW 211
           DLKPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y     DVW
Sbjct: 214 DLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KVDVW 272

Query: 212 SCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPE 271
           + GV+ + L+ G  PF+E+   +     ++   + + P  + +SH+ +DL++K+L  +P 
Sbjct: 273 ALGVLTYELIVGSPPFEEDTKEL--TYKRILKNDIKFP--ETVSHDVKDLISKLLKYNPS 328

Query: 272 KRIRARDILKHPLL 285
           +RI  RD++KHP +
Sbjct: 329 ERISMRDVMKHPWI 342

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  157 bits (397), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 147/280 (52%), Gaps = 32/280 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  ++TGK  A+K+I+K     N               G+ RE+ ++
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKRKVMGNMD-------------GVTRELDVL 243

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + L+HP ++RL   +E   + Y+++E+   G+L + +   G + E       RQI+  + 
Sbjct: 244 RKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 303

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 304 YIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 363

Query: 200 G----------IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-E 247
           G          I Y     D+WS G +++ +LTG LPF    G+ ++ L K +  G + E
Sbjct: 364 GKNSAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYHE 419

Query: 248 MPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
            P  D  IS EA+D +  +L V P KR+ A   L HP ++
Sbjct: 420 GPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 151/279 (54%), Gaps = 20/279 (7%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G  LG G   +        +GK  A K ++K    +   +   L+           EI I
Sbjct: 98  GHFLGEGGFARC-FQIRDDSGKIFAAKTVAKISIKSEKTRKKLLS-----------EIQI 145

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG- 139
            K + H N+++  D +E ++N+Y++LE    G L +LL ++  L E E +RFF   I G 
Sbjct: 146 HKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGA 204

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIV 198
           I Y H+  ++HRDLK  N+  D KYN+KI DFG+AA    D+  + T CG+P+Y APE++
Sbjct: 205 IKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIAPEVL 264

Query: 199 SG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHE 257
            G    H +  D+WS GV+++AL+ GR PF  +D N   +  +++  +F  P D  IS E
Sbjct: 265 MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKLISSE 322

Query: 258 AQDLLAKILTVDPEKRIRARDILKHPLLQKY--PSIKDS 294
           A+ L+  IL++DP +R    +I+ +   +    PS K+S
Sbjct: 323 AKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKES 361

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 156/291 (53%), Gaps = 19/291 (6%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G  LG G   +        +GK  A K ++K    +   +   L+           EI I
Sbjct: 85  GHFLGEGGFARC-FQIKDDSGKIFAAKTVAKLSIKSEKTRKKLLS-----------EIQI 132

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG- 139
            K + H NV++  D +E ++N+Y++LE    G L +LL ++  L E E +RFF   I G 
Sbjct: 133 HKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQICGA 191

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIV 198
           I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y APE++
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 251

Query: 199 SG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHE 257
            G    H +  D+WS GV+L+ALL G+ PF  +D N   +  +++  +F  P +  IS+E
Sbjct: 252 MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKHISNE 309

Query: 258 AQDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLPREDTYL 307
           A+ L+  +L++DP +R    +I+ +   +  +P   +S  +  +P  D  L
Sbjct: 310 AKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 154/287 (53%), Gaps = 17/287 (5%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G  LG G   +        +GK  A K ++K    +   +   L+           EI I
Sbjct: 80  GHFLGEGGFARC-FQMKDDSGKIFAAKTVAKISIKSEKTRKKLLS-----------EIQI 127

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGI 140
            K + HPN+++  D +E ++N+Y++LE    G L +LL ++  L E E   F  QI+  I
Sbjct: 128 HKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQIVGAI 187

Query: 141 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIVS 199
            Y H   ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y APE+++
Sbjct: 188 KYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLA 247

Query: 200 G-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEA 258
           G    H +  D+WS GV+++ALL G+ PF  ++ NI  +  +++SG++  P +   S E 
Sbjct: 248 GKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPTSKEV 305

Query: 259 QDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLPRED 304
             L+  IL++DP +R    +I+ +   +  +P+  +   + ++P  D
Sbjct: 306 MVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 158/294 (53%), Gaps = 25/294 (8%)

Query: 19  KLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREI 78
           +LG T+G GS G V+ A  K     +++ V  K V     A+S  L+  D     + RE+
Sbjct: 15  ELGGTIGEGSFGCVRSARLKF---DSSVVVAVKFVHLPTCAESG-LSQKD-----VSREV 65

Query: 79  IIM-KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           ++  K   H NVLR+ D       L+++LE A+ G+LF+ +     +    A  +F+Q+I
Sbjct: 66  VLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLI 125

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSC---GSPHYA 193
             ++Y H +G+ HRD+KPEN+LLD K N+K+ADFG+A+    +D  L  S    GSP Y 
Sbjct: 126 RALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQRGSPPYM 185

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFD---EEDGNIRNLL---LKVQSGEFE 247
           APEI+S   Y+   +D+WS GV+LF LLTG +P+    +ED N    +    KV  G +E
Sbjct: 186 APEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVSLGPWE 245

Query: 248 MPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLP 301
                 +     +LL KIL  DP KR+    +  HP L     + +S+ + N P
Sbjct: 246 -----RVELRQMNLLRKILQPDPRKRVSLEKLRHHPWLTSRSKLANSEGLCNNP 294

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 156/298 (52%), Gaps = 24/298 (8%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G  LG G   +        +GK  A K ++K    +   +   L+           EI I
Sbjct: 94  GHFLGEGGFARC-FQIKDESGKIFAAKTVAKISIKSEKTRKKLLS-----------EIQI 141

Query: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGI 140
            K + H NV++  D +E ++N+Y++LE    G L  LL ++  + E E   F  QI   I
Sbjct: 142 HKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQICGAI 201

Query: 141 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIVS 199
            Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y APE++ 
Sbjct: 202 KYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLM 261

Query: 200 G-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEA 258
           G    H +  D+WS GV+++ALL G+ PF  +D N+  +  ++++ +F  P D  IS+EA
Sbjct: 262 GKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYISNEA 319

Query: 259 QDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLPR-------EDTYLN 308
           + L+  IL+ DP +R    +I+ +   +  +PS   S  +   P        E++Y+N
Sbjct: 320 KTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIISAEESYIN 377

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score =  148 bits (374), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 146/279 (52%), Gaps = 16/279 (5%)

Query: 7   LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTT 66
           LP  K   L  ++LG+ LG G  GKV    +++TG   A+KV+ K      + Q      
Sbjct: 93  LPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQ---- 148

Query: 67  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQE 126
                    RE+ I   LNHPN+ + Y  +     +Y+++EY   GE++ LL   GP  +
Sbjct: 149 -------FRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFND 201

Query: 127 QEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 186
             A  +  QI   + Y H   I+HRD+KPEN+L+     IK+ DFG + +   +   +T 
Sbjct: 202 ILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTV 261

Query: 187 CGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEF 246
           CG+  Y +PE+V    Y     D W+ GV+ F LLTG  PF+EE  +      ++ + + 
Sbjct: 262 CGTIDYLSPEMVESREY-DHTIDAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDI 318

Query: 247 EMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           +MPS+  IS +AQDL+ K+L  DP+ R+R  D+  HP +
Sbjct: 319 KMPSN--ISQDAQDLILKLLKYDPKDRMRLGDVKMHPWI 355

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  148 bits (373), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 91/269 (33%), Positives = 145/269 (53%), Gaps = 25/269 (9%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISK-SVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           TLG GS G+V L  +   G+  AIKV+ K  V      + ++           ER +  +
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTN----------DERRM--L 95

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           KL++HP ++R++  ++ + NL+MV++Y E GELF+LL +        A  +  ++I+ + 
Sbjct: 96  KLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 155

Query: 142 YCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           Y HA  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++  
Sbjct: 156 YLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATK 213

Query: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDL 261
           PY+  + D WS G+++F +L G  PF   D        K+  G+   P       +  DL
Sbjct: 214 PYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDVVDL 268

Query: 262 LAKILTVDPEKRI-----RARDILKHPLL 285
           L+K++T D  +R+       +D+  HP  
Sbjct: 269 LSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score =  148 bits (374), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 146/279 (52%), Gaps = 16/279 (5%)

Query: 7   LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTT 66
           LP  K   L  ++LG+ LG G  GKV    +K+TG   A+KV+ K      + Q      
Sbjct: 93  LPKFKSLSLDDFELGKKLGKGKFGKVYCVRHKSTGYICALKVMEKEEIIRYNLQRQ---- 148

Query: 67  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQE 126
                    RE+ I   LNHPN+ + Y  +     +Y+++EY   GE++ LL   GP  +
Sbjct: 149 -------FRREVEIQMSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFND 201

Query: 127 QEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 186
             A  +  QI   + Y H   I+HRD+KPEN+L+     IK+ DFG + +   +   +T 
Sbjct: 202 ILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNTIKLTDFGWSIINPPESRRKTV 261

Query: 187 CGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEF 246
           CG+  Y +PE++    Y     D W+ G++ F LLTG  PF+EE  +      ++ + + 
Sbjct: 262 CGTIDYLSPEMIESREY-DHTIDAWALGILAFELLTGAPPFEEEMKD--TTYKRIAALDI 318

Query: 247 EMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           ++PS+  +S +AQDL+ K+L  DP+ R+R  D+  HP +
Sbjct: 319 KIPSN--VSQDAQDLILKLLKYDPKDRMRLEDVKMHPWI 355

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  155 bits (393), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 160/301 (53%), Gaps = 36/301 (11%)

Query: 4   SNNLPSIKGDQLGPWK----LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSA 59
           S+N+ SIK   LG +K      E +G G+   V+ A  ++TGK  A+K+ISK     N  
Sbjct: 181 SSNIKSIK--PLGIFKDFTIKDEVVGQGAFAIVKKAVERSTGKTFAVKIISKRKVMGNMD 238

Query: 60  QSSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119
                        G+ RE+ +++ L+HP ++RL   +E   + Y+++E+   G+L + + 
Sbjct: 239 -------------GVTRELEVLRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVA 285

Query: 120 EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALE 177
             G + E       RQI+  + Y H+  I HRDLKP+N+L+  D    +KI DFG+A ++
Sbjct: 286 AHGSVGEDAGREITRQILEAVKYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQ 345

Query: 178 TEDKLLETSCGSPHYAAPEIVSG---------IPYHGFASDVWSCGVILFALLTGRLPFD 228
                ++T CG+  Y APEI+SG            +    D+WS G +++ +LTG LPF 
Sbjct: 346 GNGTFMKTFCGTLAYVAPEIISGSNNLEENEERNEYSSLVDMWSIGCLVYVILTGHLPF- 404

Query: 229 EEDGNIRNLLLK-VQSGEF-EMPSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
              G+ +  L K V++G + E P  D  IS EA++ +  +L V+P  R+ A   L+HP +
Sbjct: 405 --SGSTQEQLYKQVRNGSYHEGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWI 462

Query: 286 Q 286
           +
Sbjct: 463 K 463

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  155 bits (392), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 148/284 (52%), Gaps = 30/284 (10%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  + TGK  A+K+I+K     N               G+ RE+ ++
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD-------------GVTRELEVL 267

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + LNHP ++ L   +E + + Y+++E+   G+L + +   G + E       RQI+  + 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIG 387

Query: 200 GIPYHGFAS---------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGEF-EM 248
           G    G  +         D+WS G +++ +LTG LPF    G+ +  L K + +G + E 
Sbjct: 388 GKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHEG 444

Query: 249 PSDDE-ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
           P  D  IS EA+D +  +L ++P  R+ A   L+HP L    SI
Sbjct: 445 PLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  154 bits (390), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 135/229 (58%), Gaps = 7/229 (3%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           EI I K + H N+++  D +E ++N+Y++LE    G L  LL ++  L E E +RFF   
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 137 IIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 194
           I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVCGTPNYIA 310

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE++ G    H +  DVWS GV+++ALL G+ PF  +D N   +  +++  +F  P +  
Sbjct: 311 PEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKP 368

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLP 301
           ISHEA+ L+  +L++DP +R    +I+ +   +  +P    S  +  +P
Sbjct: 369 ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVP 417

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  150 bits (378), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 146/276 (52%), Gaps = 21/276 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G TLG G+ G V+ A   +T +  A+K++ K     N  Q   L            E
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKGNDVQLQMLYD----------E 108

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           + I++ L HPN++R  D +E+    Y+V + A  GELF+ ++ KG   E++A++   Q++
Sbjct: 109 LSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVVQML 168

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 193
             + Y H+  IVHRDLKPEN+L     +   + IADFG+A  L   D+L+  + GS  Y 
Sbjct: 169 NAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSLGYV 228

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE+++    HG   D+WS GVI + LL G  PF  E  ++   L +V    + +   ++
Sbjct: 229 APEVLT-TNGHGKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKFHEQ 285

Query: 254 ----ISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
               IS EA+  + + L ++P+ R  A ++L  P +
Sbjct: 286 YWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 145/267 (54%), Gaps = 16/267 (5%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +  G+ LG G   +        +GK  A K ++K    +   +   L+           E
Sbjct: 81  YHRGQFLGEGGFARC-FQIKDDSGKIFAAKTVAKISIKSEKTRKKLLS-----------E 128

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           I I K ++H N+++  D +E N N+Y++LE    G L  L+ ++  + E E   F  QI 
Sbjct: 129 IQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQIC 188

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPE 196
            GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y APE
Sbjct: 189 GGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPE 248

Query: 197 IVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEIS 255
           ++ G    H +  D+WS GV+L+ALL G+ PF  +D N   +  +++   F  P D +IS
Sbjct: 249 VLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKIS 306

Query: 256 HEAQDLLAKILTVDPEKRIRARDILKH 282
            +A+ L+  IL+++P +R   ++I+ +
Sbjct: 307 QDAKYLIDDILSLNPMERPSIQEIMDY 333

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 128/207 (61%), Gaps = 6/207 (2%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL ++  L E E +RFF   
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 137 IIG-ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 194
           I G I Y H+  I+HRDLK  N+  D  YN+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE++ G    H F  D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D  
Sbjct: 261 PEVLMGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKY 318

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDIL 280
           +S EA+ L+  IL+++P +R    DI+
Sbjct: 319 VSKEAEILIHDILSLNPLQRPTIIDII 345

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/269 (33%), Positives = 144/269 (53%), Gaps = 25/269 (9%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISK-SVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           TLG GS G+V L  +   G+  AIKV+ K  V      + ++           ER +  +
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTN----------DERRM--L 95

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           KL++HP ++R++  ++ + NL+MV++Y E GELF+LL +        A  +  ++I+ + 
Sbjct: 96  KLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 155

Query: 142 YCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++  
Sbjct: 156 YLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATK 213

Query: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDL 261
           PY+  + D WS G+++F +L G  PF   D        K+  G+   P       +  DL
Sbjct: 214 PYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDVVDL 268

Query: 262 LAKILTVDPEKRI-----RARDILKHPLL 285
           L K++T D  +R+       +D+  HP  
Sbjct: 269 LCKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 140/291 (48%), Gaps = 39/291 (13%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G+ LG G    V+ A NK TG+  A+K+      N++  ++   T           E  I
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKIFHPQQ-NDDDKRTKKFT----------EETKI 249

Query: 81  MKLLNHPNVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ 135
           +  + HPN+++L D     V +T    Y+VLE    GELF  +V K  L+E E    FRQ
Sbjct: 250 LLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQ 309

Query: 136 IIIGISYCHALGIVHRDLKPENLLL-------------------DHKYNIKIADFGMAAL 176
           ++ G+ Y H+  I+HRD+KPEN+LL                   +    +KIADFG+A  
Sbjct: 310 LLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKF 369

Query: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG--NI 234
             E K   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF E+    ++
Sbjct: 370 TGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAPPSM 428

Query: 235 RNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           +  +L+ +   F  P  D I      L++ +L V+P  R    D L HP  
Sbjct: 429 KEQILQGKFA-FYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa]
           {ON} 
          Length = 528

 Score =  150 bits (379), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 160/290 (55%), Gaps = 17/290 (5%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
           LG+T+G G+ G V+ AH K   K     +I+    +  + + + L+  D     I +E+I
Sbjct: 17  LGDTIGQGTFGCVKNAHLKIDPKV----IIAVKFIHIPTCKKNGLSDKD-----ITKEVI 67

Query: 80  IM-KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIII 138
           +  K   HPNVLRL D   +N+ +++V+E A+ G+LF+ +     +  + A  +F+Q+I 
Sbjct: 68  LHSKCSKHPNVLRLIDCNISNAYMWIVMEMADGGDLFDKIEPDIGVDSEVAQFYFQQLIR 127

Query: 139 GISYCH-ALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSC---GSPHYA 193
            ISY H   GI HRD+KPEN+LLD   N+K+ADFG+A+  +  D  +  +    GSP Y 
Sbjct: 128 AISYLHDECGIAHRDIKPENILLDRNGNLKLADFGLASQFKRNDGTIRVASDQRGSPAYM 187

Query: 194 APEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ-SGEFEMPSD 251
           APEI+ S   Y+  ++D+WS G++LF LLTG +P++      +N    +Q +G   +   
Sbjct: 188 APEILYSKGGYYANSTDIWSIGILLFVLLTGEIPWELPVMEEKNFACFIQNNGNLNLGPW 247

Query: 252 DEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLP 301
            +I     +LL K+L  DP+KR   + +  HP   K     +S+ +   P
Sbjct: 248 AKIDFSHLNLLRKMLQPDPKKRASLKILRTHPWFTKGVRFANSEGLCKDP 297

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 148/277 (53%), Gaps = 25/277 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYG 73
           L  +++  TLG GS G+V L  +   G+  AIKV+ K  +      + ++          
Sbjct: 90  LQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMKQIEHTN---------- 139

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
            ER +  +KL+ HP ++RL+  ++ + NL+MV++Y E GELF+LL +        A  + 
Sbjct: 140 DERRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 197

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            ++++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    +  T CG+P Y 
Sbjct: 198 AEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYI 255

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE+++  PY+  + D WS GV+++ +L G  PF   D        K+  G+   P    
Sbjct: 256 APEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG-- 310

Query: 254 ISHEAQDLLAKILTVDPEKRI-----RARDILKHPLL 285
              +  DLL +++T D  KR+      +RD+  HP  
Sbjct: 311 FHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 132/256 (51%), Gaps = 16/256 (6%)

Query: 32  VQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVLR 91
           V    +K TG   A+K + KS     + Q               RE+ I   L HPN+ R
Sbjct: 137 VYCVKHKRTGFICALKAMKKSEIVQYNVQKQ-----------FRREVEIQSSLKHPNLTR 185

Query: 92  LYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHR 151
           LY  +     +Y+++EY   GEL+  L   GP  +  A  F  Q+   ++Y H+  I+HR
Sbjct: 186 LYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKNILHR 245

Query: 152 DLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVW 211
           D+KPEN+LL  +  +K+ DFG +     +   +T CG+  Y +PE++    Y     DVW
Sbjct: 246 DIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDN-KVDVW 304

Query: 212 SCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPE 271
           + GV+ + LL G  PF+E+   +     ++   +   P  D++S  A+DL++++L  DP+
Sbjct: 305 ALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQVSPHARDLISRLLEYDPQ 360

Query: 272 KRIRARDILKHPLLQK 287
            RI  +D+ +HP ++K
Sbjct: 361 NRIPLKDVKRHPWIKK 376

>KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.336
           YBR274W
          Length = 534

 Score =  150 bits (378), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 155/290 (53%), Gaps = 24/290 (8%)

Query: 20  LGETLGLGSTGKVQLAHNKTTGKQ--AAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +GET+G GS G V+ A  K + +    AIK I        SA    +T  +     I RE
Sbjct: 17  IGETIGQGSFGIVKSARIKDSNQNNIFAIKFIHLP-----SANDKGITERE-----ISRE 66

Query: 78  III-MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
           + I MK  NHPN+L+  D   TN  L+MVLE A+ G+LF+ +     +    A  +F+Q+
Sbjct: 67  VSIHMKCSNHPNILKFIDCNVTNKFLWMVLEMADGGDLFDKIEPDYGVDSHIAQFYFQQL 126

Query: 137 IIGISYCH-ALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLETSC---GSPH 191
           I  + Y H   GI HRD+KPEN+LLD   N+K+ADFG+A + + +D  +  S    GSP 
Sbjct: 127 IRALDYLHNTCGIAHRDIKPENILLDKDGNLKLADFGLASSFKRKDGTMRLSHDQRGSPP 186

Query: 192 YAAPEIVS-GIPYHGFASDVWSCGVILFALLTGRLPFD---EEDGNIRNLLLKVQSGEFE 247
           Y APEI++   PYH   +D+WS GV+LF LL G++P++    ED +  N  +K  +G   
Sbjct: 187 YMAPEILTLNSPYHANITDIWSVGVLLFVLLAGQVPWELPVNEDSD-YNAFIK-NNGNIN 244

Query: 248 MPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSI 297
                +I  +  +LL KIL  DP KR     +  H    K     +SK +
Sbjct: 245 AGPWSKIKLDQLNLLRKILHSDPSKRATLTTLKSHRWFLKKNMYANSKGL 294

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (58%), Gaps = 7/229 (3%)

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR-Q 135
           EI I K + H N+++  D +E  +N+Y++LE    G L  LL ++  L E E +RFF  Q
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQ 206

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 194
           I  GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 207 ICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 266

Query: 195 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           PE++ G    H +  D+WS GV+++ALL G+ PF  +D N   +  +++  +F  P +  
Sbjct: 267 PEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKY 324

Query: 254 ISHEAQDLLAKILTVDPEKRIRARDILKHPLLQK-YPSIKDSKSIRNLP 301
           IS EA+ L+  +L++DP +R    ++L +   +  +P    S  +  +P
Sbjct: 325 ISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVP 373

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  149 bits (376), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 112/374 (29%), Positives = 183/374 (48%), Gaps = 40/374 (10%)

Query: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVI--SKSVFNN--NSAQSSSLTTPDA 69
           QLG W    TLG G+ G V+LA ++ +G+  A+K+    +SV  N  N+     +     
Sbjct: 51  QLGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQSVILNKCNTQNIEDVKCSKE 110

Query: 70  LPYGIE------REIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGP 123
               I+      +E  + ++L HP++ + Y + E   + YM LEY +   L   +  +  
Sbjct: 111 FKTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRYHYYMFLEYIQGCTLLEYVSSQNA 170

Query: 124 --LQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL-DHKYNIKIADFGMAALETED 180
             L E+ A  F  QI+  ++Y H+  IVHRDLK EN+++ +    IK+ DFG+     ++
Sbjct: 171 KKLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENIMVTNEDKTIKLIDFGLGCFYDQN 230

Query: 181 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240
             L   CGS +YAAPE++    Y G   D+WS GV+L+ ++TG+LPF    G  +  L+K
Sbjct: 231 STLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVLYIMVTGKLPF---KGRSKGRLMK 287

Query: 241 -VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ---------KYPS 290
            + SG+ + P  + +S +   LL++IL +D   R    DI+KH              YP 
Sbjct: 288 HILSGQVKFP--NFLSMDVISLLSRILEIDLSFRFSLSDIIKHQWFWICDIKYWELIYPM 345

Query: 291 IKDSKSIR-----NLPREDTYLNPLSDNNSTIDKTILQNLVVLWHG---RDVNE--IISK 340
            K  K        ++  E  +LN + D + T D   L ++V  W      D+++  ++  
Sbjct: 346 CKREKITEYTISFSVLSEMRHLNFIFDIDETYDD--LCDIVTEWRYLRLADISQYIVLDY 403

Query: 341 LKEPGANAEKTLYA 354
           L +P  N     YA
Sbjct: 404 LWDPKGNENLLPYA 417

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  149 bits (375), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 144/291 (49%), Gaps = 39/291 (13%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G+ LG G    V+ A NK TG+ AA+K+        N  Q  +    D        E  I
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKIFHP---QQNDDQKKTKQFRD--------ETKI 240

Query: 81  MKLLNHPNVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ 135
           +  + H N+++L D     V +++   Y+VLE    GELF+ +V K  L++ E    F+Q
Sbjct: 241 LMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAIFKQ 300

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDHK-------------------YNIKIADFGMAAL 176
           ++ G+ Y H+  I+HRD+KPEN+LL  +                     +KIADFG+A  
Sbjct: 301 LLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGLAKF 360

Query: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG--NI 234
             E K   T CG+P Y APE+++   Y     D+WS GV+L+  L G  PF E+    ++
Sbjct: 361 TGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSPPSM 419

Query: 235 RNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           +  +L+ +   F  P  DEI   A  L++ +L V+P +R    D + HP  
Sbjct: 420 KEQILQGKYA-FYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  145 bits (367), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 146/274 (53%), Gaps = 25/274 (9%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYGIER 76
           +++  TLG GS G+V L  +   G+  AIKV+ K  V      + ++           ER
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTN----------DER 119

Query: 77  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQI 136
            +  +KL+ HP ++R++  ++   N++MV++Y E GELF+LL +        A  +  ++
Sbjct: 120 RM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV 177

Query: 137 IIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPE 196
           I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE
Sbjct: 178 ILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPE 235

Query: 197 IVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISH 256
           +++  PY+  + D WS GV+++ +L G  PF   D        K+  G+   P       
Sbjct: 236 VITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYPP--YFHP 290

Query: 257 EAQDLLAKILTVDPEKRI-----RARDILKHPLL 285
           +  DLL+K++T D  +RI      +RDI  HP  
Sbjct: 291 DVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  145 bits (365), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 144/269 (53%), Gaps = 25/269 (9%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           TLG GS G+V L  +   G+  AIKV+ K+ V      + ++           ER +  +
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTN----------DERRM--L 103

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           KL+ HP ++R++  ++ + NL+MV++Y E GELF LL +        A  +  ++ + + 
Sbjct: 104 KLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALE 163

Query: 142 YCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE+++  
Sbjct: 164 YLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVIATK 221

Query: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDL 261
           PY+  + D WS GV+++ +L G  PF   D        K+  G+   P     + +  DL
Sbjct: 222 PYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYPQ--FFNSDVIDL 276

Query: 262 LAKILTVDPEKRI-----RARDILKHPLL 285
           L+K+LT D  +RI      A+DI  HP  
Sbjct: 277 LSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  145 bits (367), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 143/269 (53%), Gaps = 25/269 (9%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           TLG GS G+V L  +   G+  AIKV+ K  V      + ++           ER +  +
Sbjct: 77  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTN----------DERRM--L 124

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           KL+ HP ++R++  ++   N++MV++Y E GELF+LL +        A  +  ++I+ + 
Sbjct: 125 KLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 184

Query: 142 YCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE+++  
Sbjct: 185 YLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTK 242

Query: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDL 261
           PY+  + D WS GV+++ +L G  PF   D        K+  G+   P       +  DL
Sbjct: 243 PYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPP--YFHPDVVDL 297

Query: 262 LAKILTVDPEKRI-----RARDILKHPLL 285
           L+K++T D  +RI      +RDI  HP  
Sbjct: 298 LSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 144/256 (56%), Gaps = 18/256 (7%)

Query: 21  GETLGLGSTGKV-QLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREII 79
           G  LG G   +  Q+  +K  GK  A K ++K    +   +   L+           EI 
Sbjct: 93  GHFLGEGGFARCFQMKDDK--GKVFAAKTVAKLSIKSEKTRRKLLS-----------EIQ 139

Query: 80  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIG 139
           I K + HPN+++  D +E ++N+Y++LE    G +  LL ++  L E E      QII  
Sbjct: 140 IHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGA 199

Query: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPEIV 198
           I Y H+  ++HRDLK  N+  D +YN+KI DFG+AA+   DK  + T CG+P+Y APE++
Sbjct: 200 IRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVL 259

Query: 199 SG-IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHE 257
           +G    H +  D+WS GV+L+ALL G+ PF  ++  +  +  +++  +F  P+D  +S +
Sbjct: 260 TGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPVSSD 317

Query: 258 AQDLLAKILTVDPEKR 273
           A++L++ +L ++P  R
Sbjct: 318 AKNLISHLLQLNPAAR 333

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  148 bits (374), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 145/296 (48%), Gaps = 43/296 (14%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           + LG  LG G    V+   NK TG+  A+K+      N++  +S               E
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKIFHPQQ-NDDQKKSKQF----------REE 245

Query: 78  IIIMKLLNHPNVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
             I+  ++HPN++ L D     + +  +  Y+VLE  + GELF+ +V+K  L++ E    
Sbjct: 246 TNILMRIHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDETKAI 305

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLL--------DHK-----------YNIKIADFGM 173
           F QI+ G+ Y H   I+HRD+KPEN+LL        D K             +KIADFG+
Sbjct: 306 FTQILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIADFGL 365

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVILFALLTGRLPFDEED 231
           A    E +   T CG+P Y APE++      G+ S  D+WS GVIL+  L G  PF ++ 
Sbjct: 366 AKFTGEMQFTNTLCGTPSYVAPEVLIK---KGYTSKVDMWSSGVILYVCLCGFPPFSDQL 422

Query: 232 G--NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           G   ++  +L+ +   F  P  D I      L++ +L +DPE+R    D   HP L
Sbjct: 423 GPPALKEQILQAKFA-FYTPYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  151 bits (382), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 146/279 (52%), Gaps = 31/279 (11%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  ++TGK  A K+ISK     N               G++RE+ ++
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKRKLMGNWD-------------GVDRELAVL 236

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           + L+HP ++RL   +E     Y+++E+   G+L + +   G + E       RQ++  ++
Sbjct: 237 RKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVA 296

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 297 YIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 356

Query: 200 GI---------PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQSGEF-EM 248
           G           Y     D+WS G +++ +LTG LPF    G+ +  L  ++  G + E 
Sbjct: 357 GKNDNTEEEKNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHEG 412

Query: 249 PSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
           P  D  IS EA+D +  +L V+P  R  A   L+HP ++
Sbjct: 413 PLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  152 bits (384), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 147/279 (52%), Gaps = 30/279 (10%)

Query: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           E +G G+   V+ A  + TGK  A+K+ISK     N               G+ RE+ ++
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKRKVMGNVE-------------GVTRELEVL 240

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
             LNHP ++ L   +E   + Y+++E+   G+L + +   G + E       RQI+  + 
Sbjct: 241 HRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 300

Query: 142 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 199
           Y H   I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 301 YIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVID 360

Query: 200 G-------IPYHGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQSGEF-EM 248
           G       +  + ++S  D+WS G +++ +LTG LPF    G+ +  L  ++  G + E 
Sbjct: 361 GKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHEG 417

Query: 249 PSDD-EISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
           P  D +IS EA+D +  +L V+P  R+ A   LKHP +Q
Sbjct: 418 PLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  145 bits (366), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 143/269 (53%), Gaps = 25/269 (9%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           TLG GS G+V L  +   G+  AIKV+ K  V      + ++           ER +  +
Sbjct: 76  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTN----------DERRM--L 123

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
           KL+ HP ++R++  ++   N++MV++Y E GELF+LL +        A  +  ++I+ + 
Sbjct: 124 KLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 183

Query: 142 YCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE+++  
Sbjct: 184 YLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTK 241

Query: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDL 261
           PY+  + D WS GV+++ +L G  PF   D        K+  G+   P       +  DL
Sbjct: 242 PYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPP--YFHPDVVDL 296

Query: 262 LAKILTVDPEKRI-----RARDILKHPLL 285
           L+K++T D  +RI      +RDI  HP  
Sbjct: 297 LSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  148 bits (373), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 91/296 (30%), Positives = 149/296 (50%), Gaps = 43/296 (14%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           + LG+ LG G    V+ A NK TG+Q A+K+      N++  ++               E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQ-NDDQKKNKQF----------REE 248

Query: 78  IIIMKLLNHPNVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
             I+  + HPN++ L D     + ++    Y+VLE  + GELF  +V K  L++ E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKYNIKIADFGM 173
           F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +KIADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVILFALLTGRLPFDEED 231
           A    E +   T CG+P Y APE+++     G+ S  D+WS GVIL+  L G  PF ++ 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 232 G--NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285
           G  +++  +L+ +   F  P  D+I      L++ +L ++P++R    + L HP  
Sbjct: 426 GPPSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  146 bits (368), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 152/285 (53%), Gaps = 29/285 (10%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISK-SVFNNNSAQSSSLTTPDALPYGIEREIIIM 81
           TLG GS G+V L  +   G+  A+KV+ K ++      + ++             E  ++
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTN------------DERRML 160

Query: 82  KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGIS 141
            +++HP  +R++  ++    ++M+++Y E GELF+LL +        A  +  ++ + + 
Sbjct: 161 SVVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALE 220

Query: 142 YCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 201
           Y H++ I++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y APE+VS  
Sbjct: 221 YLHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTK 278

Query: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISH-EAQD 260
           PY+  + D WS G+++F +L G  PF   D N       + + E + PS   I H +AQD
Sbjct: 279 PYNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFPS---IFHPDAQD 332

Query: 261 LLAKILTVDPEKRI-----RARDILKHPLLQKYPSIKDSKSIRNL 300
           LL +++T D  KR+      + D+ +HP   +   + D    RN+
Sbjct: 333 LLCRLITRDLSKRLGNLQNGSEDVKRHPWFSE--VVWDKLLCRNI 375

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  148 bits (373), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 150/297 (50%), Gaps = 43/297 (14%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           + LG+ LG G    V+ A NK TG+Q A+K+      N++  ++               E
Sbjct: 200 YLLGKELGSGHYALVKEAKNKKTGQQVAVKIFHAQQ-NDDQKKNKQF----------REE 248

Query: 78  IIIMKLLNHPNVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRF 132
             I+  + HPN++ L D     + ++    Y+VLE  + GELF  +V K  L++ E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------YNIKIADFGM 173
           F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +KIADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 174 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVILFALLTGRLPFDEED 231
           A    E +   T CG+P Y APE+++     G+ S  D+WS GVIL+  L G  PF ++ 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 232 G--NIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQ 286
           G  +++  +L+ +   F  P  D+I      L++ +L ++P++R    D + HP  +
Sbjct: 426 GPPSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDDAMNHPWFK 481

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 148/277 (53%), Gaps = 25/277 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYG 73
           L  +++  TLG GS G+V L  +   G+  AIKV+ K+ V      + ++          
Sbjct: 81  LNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQVVRMKQIEHTN---------- 130

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
              E  ++KL+ HP ++R++  ++   NL+MV++Y E GELF+LL +        A  + 
Sbjct: 131 --DERRMLKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 188

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y 
Sbjct: 189 AEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-SVTWTLCGTPDYI 246

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE+++  PY+  + D WS G+++F +L G  PF   D        K+  G+   P    
Sbjct: 247 APEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYPP--F 301

Query: 254 ISHEAQDLLAKILTVDPEKRI-----RARDILKHPLL 285
              +  DLL+K++T D  +RI      ++DI +HP  
Sbjct: 302 FHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 142/257 (55%), Gaps = 18/257 (7%)

Query: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIERE 77
           +++  TLG GS G+V L  +   G+  A+KVI K    N   +   +   +      ER 
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKK----NTVVRLKQIEHTND-----ERR 148

Query: 78  IIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQII 137
           +  + ++NHP ++R++  ++ +  ++M+++Y E GELF+LL          A  +  ++ 
Sbjct: 149 M--LSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAAEVC 206

Query: 138 IGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 197
           + + Y H+L I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+
Sbjct: 207 LALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEV 264

Query: 198 VSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHE 257
           VS  PY+  + D WS G++++ +L+GR PF   D +       + S     PS   +  +
Sbjct: 265 VSSKPYNK-SVDWWSFGILIYEMLSGRTPF--YDRSTIKTYENILSAPLTFPS--YLHED 319

Query: 258 AQDLLAKILTVDPEKRI 274
            QDLL +++T D  KR+
Sbjct: 320 VQDLLNRLITRDLSKRL 336

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 148/277 (53%), Gaps = 25/277 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYG 73
           L  +++  TLG GS G+V L  +   G+  AIKV+ K  +      + ++          
Sbjct: 60  LNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTN---------- 109

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
            ER +  +KL+ HP ++R++  ++ ++NL+MV++Y E GELF+LL +        A  + 
Sbjct: 110 DERRM--LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 167

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A   T   +  T CG+P Y 
Sbjct: 168 AEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVT--TVTWTLCGTPDYI 225

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE+++  PY+  + D WS G++++ +L G  PF   D        K+  G    PS   
Sbjct: 226 APEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYPS--F 280

Query: 254 ISHEAQDLLAKILTVDPEKRI-----RARDILKHPLL 285
            + +  DLL+K++T D  +RI       ++I  HP  
Sbjct: 281 FNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 150/278 (53%), Gaps = 18/278 (6%)

Query: 8   PSIKGDQLGPWKLGETLGLGSTGKVQLAHNKT-TGKQAAIKVISKSVFNNNSAQSSSLTT 66
           PS+  D    +   E LG G  G  +  H K   G   A K++SK           S+ T
Sbjct: 83  PSVIKDNSKKYFRRECLGEG--GFARCFHIKDDVGISFACKIVSKK----------SIKT 130

Query: 67  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQE 126
            +   + +  EI I + L + ++++  D +E   N+Y++LE    G L +LL ++  L E
Sbjct: 131 -ERTKFKLLSEIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTE 189

Query: 127 QEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLET 185
            E      Q+   I+Y H+  I+HRDLK  N+  D  +NIKI DFG+AA L    +   T
Sbjct: 190 AEVKFMTTQVCGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKYT 249

Query: 186 SCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244
            CG+P+Y APE++ S    H F +D+WS G++++A++ G+ PF  +D  +  +  K++  
Sbjct: 250 MCGTPNYIAPEVILSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKD--VTTIYEKIKLC 307

Query: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282
           ++E P D  I+++ + L+  +L +DP +R R  DILK+
Sbjct: 308 QYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKY 345

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 143/270 (52%), Gaps = 23/270 (8%)

Query: 23  TLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIMK 82
           TLG GS G+V L  ++  G+  A+KV+ K +         +             E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHT-----------NDERLMLS 140

Query: 83  LLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISY 142
           ++ HP ++R++  ++ +  ++M+++Y E GELF+LL +        A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 143 CHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIP 202
            H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKP 258

Query: 203 YHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLL 262
           Y+  + D WS G++++ +L G  PF   D N      K+ + E   P     + + +DLL
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPP--FFNEDVKDLL 313

Query: 263 AKILTVDPEKRI-----RARDILKHPLLQK 287
           ++++T D  +R+        D+  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 134/257 (52%), Gaps = 16/257 (6%)

Query: 31  KVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIMKLLNHPNVL 90
           +V    +K TG   A+KV+ K      + Q               RE+ I   LNH N+ 
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQEIMQYNVQKQ-----------FRREVEIQSSLNHQNLT 170

Query: 91  RLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVH 150
           +LY  +  +  +Y+++EY   GEL+ LL  KGPL +  A  +  Q+   + Y H   I+H
Sbjct: 171 KLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQRNIIH 230

Query: 151 RDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDV 210
           RD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PE+++   Y     DV
Sbjct: 231 RDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD-KVDV 289

Query: 211 WSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDP 270
           W+ GV+ F L+    PF+E+   + +   ++  G+ + P  + IS +AQDL+ K+L  + 
Sbjct: 290 WALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NHISSDAQDLITKLLRHNS 345

Query: 271 EKRIRARDILKHPLLQK 287
           + RI  R++ +HP + K
Sbjct: 346 KDRISLREVKQHPWITK 362

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  143 bits (360), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 93/275 (33%), Positives = 147/275 (53%), Gaps = 25/275 (9%)

Query: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS-VFNNNSAQSSSLTTPDALPYG 73
           L  +++  TLG GS G+V L  +   G+  AIKV+ K  V      + ++          
Sbjct: 41  LHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTN---------- 90

Query: 74  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFF 133
              E  ++KL+ HP ++R++  ++ + NL+MV++Y E GELF+LL +        A  + 
Sbjct: 91  --DERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 148

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 193
            ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG P Y 
Sbjct: 149 AEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGPPDYI 206

Query: 194 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDE 253
           APE+++  PY+  + D WS GV++F +L G  PF   D        K+  G+   P+   
Sbjct: 207 APEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYPT--F 261

Query: 254 ISHEAQDLLAKILTVDPEKRI-----RARDILKHP 283
              +  DLL K++T D  +RI      ++DI  HP
Sbjct: 262 FHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHP 296

>KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON} 
          Length = 590

 Score =  148 bits (373), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 104/310 (33%), Positives = 158/310 (50%), Gaps = 28/310 (9%)

Query: 3   ASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGK-QAAIKVISKSVFNNNSAQS 61
           AS ++P + G       +GETLG G+ G V+ A  +       A+K I     N N  Q 
Sbjct: 61  ASEDVPPVGG-----LLMGETLGQGAFGCVKSASLEVDKNIVVAVKFIHMPTCNENGLQE 115

Query: 62  SSLTTPDALPYGIEREIIIM-KLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120
                       I RE+++  K   HPNVLRL D    +  +Y++LE A+ G+LF+ +  
Sbjct: 116 RD----------IMREVVLHNKCSQHPNVLRLIDCNTVDDYIYIILEMADGGDLFDKIEP 165

Query: 121 KGPLQEQEAIRFFRQIIIGISYCH-ALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LET 178
              +       +F+Q++  I+Y H   G+ HRD+KPEN+LLD   N+K+ADFG+A+  + 
Sbjct: 166 DLGVDLLITQFYFQQLVNVITYLHEQCGVAHRDIKPENILLDKSGNLKLADFGLASQFKR 225

Query: 179 EDKLLETSC---GSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFD---EED 231
           +D   + S    GSP Y APEI+ S  PY+   +D+WS G+  F L+TG +P++    ED
Sbjct: 226 KDGTWKRSMDQRGSPPYLAPEILYSKKPYYANVTDIWSIGIFTFVLITGAIPWELPAWED 285

Query: 232 GNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSI 291
            N  + L     G  +M     +  +   LL KIL  DP +RI    +  HP   +   +
Sbjct: 286 VNYSSFL--ENDGNVDMGPWKRVDIQQLSLLRKILQQDPSERITLSKLRSHPWFTQKNKL 343

Query: 292 KDSKSIRNLP 301
            +SK + N P
Sbjct: 344 MNSKGLCNDP 353

>AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL101C
           (DUN1)
          Length = 472

 Score =  145 bits (367), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/308 (32%), Positives = 149/308 (48%), Gaps = 41/308 (13%)

Query: 21  GETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIII 80
           G+ LG G    V+ A NK TG+  A+K+       N+ A+ +              E  I
Sbjct: 158 GKELGSGHYAIVKEAINKITGQSVAVKIFHPQ--KNDDAKKTR---------QFREETKI 206

Query: 81  MKLLNHPNVLRLYDVW-----ETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ 135
           +  LNH N+++L + +     ++    Y+VLE  + GELF+ +V K  L + E    F+Q
Sbjct: 207 LMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQ 266

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDHK-------------------YNIKIADFGMAAL 176
           I+ G+ Y H   I+HRD+KPEN+LL  +                     +KIADFG+A  
Sbjct: 267 ILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKF 326

Query: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDG--NI 234
             E +   T CG+P Y A E+++   Y     D+WS GV+L+  L G  PF ++    ++
Sbjct: 327 TGEMQFTTTLCGTPSYVAAEVLTKTGYTS-KVDLWSAGVLLYVCLCGFPPFSDQLAPPSM 385

Query: 235 RNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDS 294
           +  +L+ +   F  P  DEI      L++ +L VDP KR   RD + H  L K    K S
Sbjct: 386 KEQILQGKFA-FYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWLTKTDDSKTS 444

Query: 295 KSIRNLPR 302
           K  R  PR
Sbjct: 445 KVER--PR 450

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,312,284
Number of extensions: 5182345
Number of successful extensions: 28715
Number of sequences better than 10.0: 2217
Number of HSP's gapped: 25053
Number of HSP's successfully gapped: 2524
Length of query: 1117
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 997
Effective length of database: 39,721,479
Effective search space: 39602314563
Effective search space used: 39602314563
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)