Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D039601.81ON66466432250.0
YNL272C (SEC2)1.81ON75953414130.0
Smik_14.651.81ON79052114100.0
Skud_14.681.81ON75252514050.0
Suva_14.701.81ON75151714010.0
NCAS0A005801.81ON68964813730.0
NDAI0F042301.81ON70154913401e-176
TDEL0C062001.81ON70051813311e-175
SAKL0C02596g1.81ON73451913271e-174
Kpol_2000.671.81ON82464913211e-172
CAGL0J08228g1.81ON75252012841e-167
ZYRO0F16698g1.81ON77955512111e-156
KNAG0F004601.81ON65452111831e-153
TBLA0A054301.81ON79553611741e-150
Ecym_10851.81ON70551811641e-150
KLTH0F02354g1.81ON73352911491e-147
Kwal_33.133891.81ON69453511361e-146
AFR670W1.81ON71751611331e-145
TPHA0B045001.81ON73352011221e-143
KLLA0C02299g1.81ON65850511101e-142
Skud_14.2122.154ON49374761.6
ZYRO0C10868g5.259ON139638752.5
TDEL0E033205.296ON85556743.1
Kpol_1050.695.88ON108460733.6
Skud_8.975.305ON64438724.3
KAFR0E007108.581ON46964706.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D03960
         (664 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...  1246   0.0  
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   548   0.0  
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   547   0.0  
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...   545   0.0  
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   544   0.0  
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   533   0.0  
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   520   e-176
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   517   e-175
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   515   e-174
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   513   e-172
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   499   e-167
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   471   e-156
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   460   e-153
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   456   e-150
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   452   e-150
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   447   e-147
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   442   e-146
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   441   e-145
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   436   e-143
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   432   e-142
Skud_14.212 Chr14 (391083..392564) [1482 bp, 493 aa] {ON} YNL119...    34   1.6  
ZYRO0C10868g Chr3 (832924..837114) [4191 bp, 1396 aa] {ON} simil...    33   2.5  
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    33   3.1  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    33   3.6  
Skud_8.97 Chr8 complement(165465..167399) [1935 bp, 644 aa] {ON}...    32   4.3  
KAFR0E00710 Chr5 (151558..152967) [1410 bp, 469 aa] {ON} Anc_8.5...    32   6.6  

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score = 1246 bits (3225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/664 (92%), Positives = 613/664 (92%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           MDDLAEENNRISAQVTSLSTQLMESIQR                SQEGSIAKYDILKADY
Sbjct: 1   MDDLAEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADY 60

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
           DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA
Sbjct: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLG 180
           RREKHITEILNTKLVEQLRE                     FEDENVTNKASSIAPDFLG
Sbjct: 121 RREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVTNKASSIAPDFLG 180

Query: 181 SEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSES 240
           SEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSES
Sbjct: 181 SEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSES 240

Query: 241 KLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVSSS 300
           KLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVSSS
Sbjct: 241 KLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVSSS 300

Query: 301 DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDG 360
           DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDG
Sbjct: 301 DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDG 360

Query: 361 SITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFTEVTRA 420
           SITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFTEVTRA
Sbjct: 361 SITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFTEVTRA 420

Query: 421 IKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTNIQRAWVQLC 480
           IKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTNIQRAWVQLC
Sbjct: 421 IKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTNIQRAWVQLC 480

Query: 481 KLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDVASVLTGNTENVSNSIKDT 540
           KLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDVASVLTGNTENVSNSIKDT
Sbjct: 481 KLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDVASVLTGNTENVSNSIKDT 540

Query: 541 VSAPERNAYNQASIDSPQFDENKTKSQNLDDGVEHFSTDTNSKNGISSITVSTERAENSN 600
           VSAPERNAYNQASIDSPQFDENKTKSQNLDDGVEHFSTDTNSKNGISSITVSTERAENSN
Sbjct: 541 VSAPERNAYNQASIDSPQFDENKTKSQNLDDGVEHFSTDTNSKNGISSITVSTERAENSN 600

Query: 601 DAAENDSPDGELRHQSPETQTDTHSINILEEYENTVGTVSQIXXXXXXXXXXXXXXANET 660
           DAAENDSPDGELRHQSPETQTDTHSINILEEYENTVGTVSQI              ANET
Sbjct: 601 DAAENDSPDGELRHQSPETQTDTHSINILEEYENTVGTVSQISDGSSSSDDEKFDDANET 660

Query: 661 KDSN 664
           KDSN
Sbjct: 661 KDSN 664

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/534 (52%), Positives = 371/534 (69%), Gaps = 24/534 (4%)

Query: 3   DLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDK 62
           D +EE  R+S QVTSLSTQL+ES+ +                SQ+ +I  Y+ LK DY+ 
Sbjct: 2   DASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYNT 61

Query: 63  LKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARR 122
           LK  +S+R+ E++ L+ ++ +E++LR+ AE E   L++EVEDLTASLF EAN+MVADAR+
Sbjct: 62  LKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARK 121

Query: 123 EKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDE----NVTNKASSIAPDF 178
           EK+  EILN +L EQLRE                      ++E    N +N+ S+I  D 
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDS 181

Query: 179 LGSEQKS-----ASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNL 233
             S   S      S SL+++  D  +  VYSP IS+IRYD++LYNEFLKF+A LP C+N+
Sbjct: 182 ATSSSTSLNKVPTSYSLASQ--DIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCENI 239

Query: 234 KDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQ 293
           K TS+ESKL+RRL+NDEIQPIL+ID+A+GIGWL KK++L+L+IDGLVV+EPLSGVN  YQ
Sbjct: 240 KATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATYQ 299

Query: 294 LGHVSSSDQ----SNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMH 349
           +G+ SSS      SN P M        F +P DSPPVAVH  CSFCGE+RDDI+EHARM+
Sbjct: 300 IGYNSSSPAKQATSNMPKM--------FKFPLDSPPVAVHAACSFCGESRDDIIEHARMY 351

Query: 350 VLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKG 409
           +LKT  K++DG   VTN+YPLC WCL K+RQTCEIFAFLRSLK+G W+LEK+T  +I K 
Sbjct: 352 ILKTLHKTDDGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKE 411

Query: 410 ESNKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGAS-TIGNAGQP 468
           +  KF+EVT+  K +    S +KK KR SFM GLGIN+S+   P++E+ +S T    GQP
Sbjct: 412 DLEKFSEVTKHTKRDGRVSSQDKKTKRLSFMAGLGINSSTKNKPKMEIFSSETNAKPGQP 471

Query: 469 TTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDV 522
           TTNIQRAW+QLCKLR +LHWT++GIW+VD+SIS KIGP V+DD++E     + V
Sbjct: 472 TTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDDSDEDQNDAISV 525

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/521 (53%), Positives = 364/521 (69%), Gaps = 14/521 (2%)

Query: 3   DLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDK 62
           D +EE  RIS QVTSLSTQL+ES+ +                SQ+ +I  Y+ LK DY+ 
Sbjct: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61

Query: 63  LKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARR 122
           LK TV E++ E+  L+ ++ +E++LR+ AE E   L++EVEDLTASLF EAN+MV+DAR+
Sbjct: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121

Query: 123 EKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLGSE 182
           EK+  EILN +L EQLRE                      ++E+V   +S+     L   
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181

Query: 183 QKSASASL-------SNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKD 235
             S+S SL       S+   D  +  VYSP IS+IRYD++LYNEFLKF+A LP C N+K 
Sbjct: 182 ATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKA 241

Query: 236 TSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLG 295
           TSSESKL+RRL+NDEIQPIL+ID+A+GIGWL KK++L+L+IDGLVV+EPLSGVN  YQ+G
Sbjct: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIG 301

Query: 296 HVSSSD-QSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQ 354
           + SSS  +   P+M       +F +P DSPPVAVH  CSFCGE+RDDI+EHARM++LKT 
Sbjct: 302 YNSSSPVKQATPNM-----PRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTL 356

Query: 355 SKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKF 414
            K++DG+  VTN+YPLC WCL K+RQTCEIFAFLRSLK+G W+LEK+   SI KG+  KF
Sbjct: 357 HKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKF 416

Query: 415 TEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTI-GNAGQPTTNIQ 473
           +EVT+  K++    S +KK KR SFM GLGIN+SS    ++EV +S      GQPTTNIQ
Sbjct: 417 SEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQ 476

Query: 474 RAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNE 514
           RAW+QLCKLR +LHW+++GIW+VD+SIS KIGP V D++++
Sbjct: 477 RAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSD 517

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/525 (52%), Positives = 365/525 (69%), Gaps = 22/525 (4%)

Query: 3   DLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDK 62
           D +EE  RIS QVTSLSTQL+ES+ +                SQ+ +I  Y+ L+ D++ 
Sbjct: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNT 61

Query: 63  LKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARR 122
           LK T+SER+ E++ L  ++ +E++LR+ AE E   L++EVEDLTASLF EAN MVADARR
Sbjct: 62  LKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARR 121

Query: 123 EKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLGSE 182
           EK+  EILN +L EQLRE                      ++E+     S+     L   
Sbjct: 122 EKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDS 181

Query: 183 QKSASASLSNEV--------GDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLK 234
             S+S SL N+V         D  +  VYSP IS+IRYD++LYNEFLKF+A LP C+N+K
Sbjct: 182 ATSSSTSL-NKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240

Query: 235 DTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQL 294
            TSSESKL+RRL+NDEIQPIL+ID+A+GIGWL KK++L+L+IDGLV++EPLSGVN  Y +
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300

Query: 295 GHVSSS----DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHV 350
           G+ SSS      +N P M        F +P +SPPVAVH  CSFCGE+RDDI+EHARM+V
Sbjct: 301 GYNSSSPVKQSTANMPKM--------FKFPLNSPPVAVHAACSFCGESRDDIIEHARMYV 352

Query: 351 LKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGE 410
           LKT  K++DG+  VTN+YPLC WCL K+RQTCEIFAFLRSLK+G W+LEK+ + +IAKG+
Sbjct: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGD 412

Query: 411 SNKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTI-GNAGQPT 469
             KF+EVT+  K+     S +KK KR SFM GLGIN+++   P++EV +S I    GQPT
Sbjct: 413 LVKFSEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPT 472

Query: 470 TNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNE 514
           TNIQRAW+QLCKLR +LHWT++GIW+VD+SIS KIGP V D++++
Sbjct: 473 TNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDEDSD 517

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/517 (53%), Positives = 356/517 (68%), Gaps = 16/517 (3%)

Query: 5   AEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLK 64
           +EE  RIS QVTSLSTQL+ES+ +                 Q+ +I  Y+ LK DYD LK
Sbjct: 4   SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYDTLK 63

Query: 65  TTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREK 124
            T+ ER+ E+  L  N+ +E++LR+ AE E   L++EVEDLTASLF EAN MVADAR+EK
Sbjct: 64  KTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADARKEK 123

Query: 125 HITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLGSEQK 184
           +  EILN +L EQLRE                      ++E+     S      L     
Sbjct: 124 YAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTILSDSAT 183

Query: 185 SASASLSNEVG--------DPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDT 236
           S+S SL N+V         D  +  VYSP IS+IRYD  LYNEFLKF+A LP+C+N+K T
Sbjct: 184 SSSTSL-NKVPTSNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHCENIKAT 242

Query: 237 SSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGH 296
           SSESKL+RRL+NDEIQPIL+ID+A+GIGWL KK++L+L+IDG+VV+EPLSGVN  YQ+G+
Sbjct: 243 SSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNATYQIGY 302

Query: 297 VSSSD-QSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQS 355
            SSS  +   P+M       +F +P DSPPVAVH  CSFCGE+RDDI+EHARM+VLKT  
Sbjct: 303 NSSSPVKQAAPNM-----PKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYVLKTLH 357

Query: 356 KSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFT 415
           K++DG+  VTN+YPLC WCL KVRQTCEIFAFLRSLK+G W+LEKVT+ +I KG+  +F+
Sbjct: 358 KADDGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGDLERFS 417

Query: 416 EVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIG-NAGQPTTNIQR 474
           EVT+  K++      +K  KR SFM GLGIN+S+   P+VEV +S +    G PTTNIQR
Sbjct: 418 EVTKRTKADGRVSPHDKMAKRLSFMAGLGINSSTKSKPRVEVPSSEMTVKPGHPTTNIQR 477

Query: 475 AWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDD 511
           AW+QLCKLR +LHW+++GIW+VD+SIS KIGP V D+
Sbjct: 478 AWIQLCKLRCILHWSHIGIWAVDDSISSKIGPFVDDE 514

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/648 (45%), Positives = 415/648 (64%), Gaps = 42/648 (6%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           M + +EE+ RIS QVT+LSTQL+ESI +                SQ+ S+ KY  LK ++
Sbjct: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
           +KLK +  ++ +E+ N +V ++ E +LR +AE EV  LS+EVEDLTA+LF EAN+MVADA
Sbjct: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVT----NKASSIAP 176
           R++K+  E+LNTKLVEQL E                      EDEN +    N+ S I P
Sbjct: 121 RKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYSIIQP 180

Query: 177 DFLGSEQK--------SASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLP 228
           D   +           +  +S S  + + +N  +YSP IS+IRYDL LY EFLKFIAV+P
Sbjct: 181 DSATTSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFIAVIP 240

Query: 229 YCKNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGV 288
           +C+ +KDTSS+SKL+RRL+NDEI P+L++D+A+G+GW+ +K++L+ M++GLVV+EPLSGV
Sbjct: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300

Query: 289 NENYQLGHVSSSDQSNRPSMESKRESH-----LFNYPTDSPPVAVHEPCSFCGENRDDIL 343
           NE +Q+G+   S Q       +K ES      LF +P  SPP+A+HEPCSFCGE+RDDI+
Sbjct: 301 NETFQMGN---STQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDII 357

Query: 344 EHARMHVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTL 403
           EHARM+VLKTQ+K EDG+I VTN++PLC WCL KVRQTCEIFAFLRSLK G WNLEKVT+
Sbjct: 358 EHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTM 417

Query: 404 NSIAKGESNKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIG 463
            SI+  +S++F+ VT AI   +  K+++++ KR SF+ GL  N+S+  T QVE   +++ 
Sbjct: 418 KSISSKDSSRFSVVTSAI---RQTKTEDRRSKRMSFIGGLTKNSSAINTAQVE-STTSME 473

Query: 464 NAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTV--- 520
             G PTTNIQRAW+QLCKLRS+LHW ++GIWS+D+SI+ KIGP++KD ++++   ++   
Sbjct: 474 ITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEAN 533

Query: 521 ----------DVASVLTGNTENVSNSIKDTVSAPERNAYNQASIDSPQFDENKTKSQNLD 570
                     DV S+++ N  N   S     SA    A   +S +     E++TK     
Sbjct: 534 IKITKKQIEKDVESIISEN--NQGESFDFESSASTSGATEASSEEKSIAGESETKVHASQ 591

Query: 571 DGVEHFSTDT---NSKNGISSITVSTERAENSNDAAENDSPDGELRHQ 615
           D  EH S +     +KN    +T      E+ ++    ++ D  L H+
Sbjct: 592 DNSEHQSANALEQETKNNFEEVTKKDIEQESESERKPKEAGDETLTHE 639

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  520 bits (1340), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 273/549 (49%), Positives = 368/549 (67%), Gaps = 32/549 (5%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           M + +EE+ RIS QV+SLSTQL+ESI +                SQ+ S+ +  +L+   
Sbjct: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
            +L+ +++ R  E+  L+  L  E KLR SAE EV  LS+EVEDLTA+LF EAN+MVADA
Sbjct: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFL- 179
           R+E H  EILN++L+ QLRE                      E EN  N+ S I PD   
Sbjct: 121 RKEAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETEN--NRYSMILPDSAT 178

Query: 180 ---GSEQKSASASLSNEVGDPSNKGV-YSPYISTIRYDLALYNEFLKFIAVLPYCKNLKD 235
               S  K  + + S+    P N G+ YSP IS+IRYDL+LY EFLKFIAV+P+CK++KD
Sbjct: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238

Query: 236 TSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLG 295
           TSS+SKL+RRLI DEI P+L+ID+ANG+GWL KK++L+ M++GLV++EPLSG+NE YQ+G
Sbjct: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298

Query: 296 HVSSSDQSN-RPSMESKRE-SHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKT 353
           H +     N +   +++R+   +F +P+ SPPVAV +PC+FCGE R+DI+EHARM++LKT
Sbjct: 299 HTTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYLLKT 358

Query: 354 QSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNK 413
           Q+  +DG++ + N+YPLC WCL K+RQTCEIFAFLRSLK   WNLEKV L++I+K  S+K
Sbjct: 359 QTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSK 418

Query: 414 FTEVTRAIKSNKHG---------KSDEKKLKRKSFMVGLGINASSNLT-PQVE------- 456
           F+EVT    +N +G         KS+ KK KR SFM GLG   SS +T  +VE       
Sbjct: 419 FSEVT---TTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNN 475

Query: 457 -VGASTIGNAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEI 515
               S I N GQPTTNIQRAW+QLCKLRS+LHW ++GIWSVD+S+S K+GP+V   + E 
Sbjct: 476 NNTNSPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEEF 535

Query: 516 TGTTVDVAS 524
             TT+D+ +
Sbjct: 536 --TTIDMTA 542

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  517 bits (1331), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/518 (50%), Positives = 364/518 (70%), Gaps = 16/518 (3%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           M +  EE+ R+S Q++SLSTQL+ESI +                SQ  S+  Y+ LK+ +
Sbjct: 1   MGESVEESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKF 60

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
           D +++++  +N+ I+ L+  L +E  LR++AE  V  L++E+EDLTASLF EAN MVA A
Sbjct: 61  DGVESSLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATA 120

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLG 180
           R+E +  EI N KL EQL E                      E E+ T+  S  +  F+G
Sbjct: 121 RKESYTIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTHSGSRSS--FVG 178

Query: 181 SEQKSASASLSNEVGDPSNK----GVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDT 236
           ++  ++S SL+      S++     +YSP I+++RYDL LY EFLKFIAVLPYC+ LKDT
Sbjct: 179 NDNSTSSISLNKTSTSNSDELSLGPIYSPNITSVRYDLNLYTEFLKFIAVLPYCETLKDT 238

Query: 237 SSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGH 296
           SS+SKL+RRL+NDEIQP LR+D+A+G+GW+ ++++++LM++GLVV+EPLSG+NEN+Q G+
Sbjct: 239 SSDSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENFQYGY 298

Query: 297 VSS--SDQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQ 354
            S      S  PSM  K +SHLF+YP+DSPP+AVH+ CSFC E RDD++EHARM+VLKTQ
Sbjct: 299 TSPVLPSSSFNPSMGGK-DSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQ 357

Query: 355 SKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKF 414
           ++ EDGS+ VTNS+PLC +CL KVRQTCEIFAFLRSLK+G WNLEKVTL  IAKGES++F
Sbjct: 358 TRIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGESSEF 417

Query: 415 TEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTNIQR 474
           ++V+    ++K  + +EK+L+R S + G   N SS L PQV++    I   G PTTNIQR
Sbjct: 418 SQVSNG--NHKGPQKEEKRLQRMSLITGK--NQSSKLAPQVDIPVDQI---GAPTTNIQR 470

Query: 475 AWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDN 512
           AW+QLCKLR  LHW ++GIWSV+++++ KIGP VK+++
Sbjct: 471 AWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEED 508

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  515 bits (1327), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 248/519 (47%), Positives = 350/519 (67%), Gaps = 12/519 (2%)

Query: 6   EENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLKT 65
           EE+ R+S Q++SLSTQL+ES+ +                SQ  S A Y+ L+   +K + 
Sbjct: 5   EESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLEKAQQ 64

Query: 66  TVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREKH 125
            ++ R+RE   L+  L  E+  R  A+ ++  L++EVEDLTASLF EAN+MVADARREKH
Sbjct: 65  ELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADARREKH 124

Query: 126 ITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLGSEQKS 185
             E+ N+KL EQL E                      EDEN +   +     FL S+  +
Sbjct: 125 DVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSSDTAT 184

Query: 186 AS-------ASLSNEVGDPSNKG--VYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDT 236
           +S       A+    +G+ S  G  ++SP + ++RYDL LYNEFLKF+A+LP C+++K T
Sbjct: 185 SSNVSLEKTATGGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPICRSIKGT 244

Query: 237 SSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGH 296
           ++ESKL+RRL++DEIQP+LR+D+A+G+GWL ++S+++LMIDGLVV+EPLSGVNE Y++G+
Sbjct: 245 TTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVNETYRMGY 304

Query: 297 VSSSDQSNR-PSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQS 355
            S    + +      +R +HL+NYPTDSPPVA+HE C+FC E+R+DILEH R++VLKT  
Sbjct: 305 SSPQLHAQQNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHGRLYVLKTLQ 364

Query: 356 KSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFT 415
           ++EDG+   TN YPLC +CL KVRQTCEIFAFLRSLK G W+LEKVTL SIA G S+KF+
Sbjct: 365 RNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIATGGSSKFS 424

Query: 416 EVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTNIQRA 475
           EVT+   ++     ++ K KR SFM GL   +++ L P VE   +  G +GQP TNIQRA
Sbjct: 425 EVTKTPHTS--AAKEDAKSKRMSFMAGLSRPSTTKLMPTVEGAPNFAGQSGQPVTNIQRA 482

Query: 476 WVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNE 514
           W QLCKLR+ LHW ++G+WS+++S++L+IGP + ++  E
Sbjct: 483 WAQLCKLRASLHWAHIGVWSIEDSVALRIGPLMPEEKTE 521

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  513 bits (1321), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 285/649 (43%), Positives = 406/649 (62%), Gaps = 57/649 (8%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           M+D ++E+ R S Q+T+LSTQLMESI +                 Q+ +I +Y+ LK  Y
Sbjct: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
           D+L    +    +I  L+   KEE KLR SAE +V  L++EVE+LTASLF EAN+MVADA
Sbjct: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDE----NVTNK----AS 172
           RR     +I N KLVE L E                      +++     V+N+    ++
Sbjct: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLIST 180

Query: 173 SIAPDFLGSEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKN 232
           + A     S +K+ +++ +  +   SN  +Y+P +  +RYDL LYNEFLKFIAVLP+C++
Sbjct: 181 TSASSSSVSLKKTITSNSTTNIDLLSN-AIYTPKVPAVRYDLYLYNEFLKFIAVLPFCES 239

Query: 233 LKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENY 292
           +K T+SESKL+RRLINDEIQP+LR+D+A+G+GW+ K++++ LMI+GLVVIEPLSGVNENY
Sbjct: 240 IKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENY 299

Query: 293 QL---GHVSSSDQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMH 349
           +      VS+ + +N P + SK + HLF YP++SPP+AVHEPC+FCGENR+D+LEHARM+
Sbjct: 300 RFSSSAPVSNVNSNNDPKLTSKND-HLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMY 358

Query: 350 VLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKG 409
           +LKTQ+K+ED ++++TN +PLC  CL KVRQTCEIFAFLRSLK+G WNLEKVTL++IAKG
Sbjct: 359 MLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKG 418

Query: 410 ESNKFTEVTRAI----KSNKHGKSDEKKLKRKSFMVGLGINASSN-LTPQVEVGASTIGN 464
           +S KF+ VT A     KS    K D K +KR+S M G GI++ SN  T + E     +  
Sbjct: 419 DSKKFSSVTAATSSISKSKIEEKFDSKLMKRRSIMAGFGISSISNTTTTKSETSVGVVDQ 478

Query: 465 AGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDVAS 524
           +G PTTNIQRAWV L KLRSMLHW ++GIW+ D +++ K+ P++ + N    GT ++   
Sbjct: 479 SGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQ--NGTELEDQQ 536

Query: 525 VLTGNTENVSNSIKDTVSAPERNAYNQASIDSPQFDENKTKSQNLDDGVEHFSTDTNSKN 584
           +L     N++N+ +++ ++                 E+   S N DD  E F  +TN   
Sbjct: 537 ILA----NINNTSEESFTS---------------VRESVEPSDNEDD--EPFDFETNEST 575

Query: 585 GISSITVSTERAENSNDAAENDSPDGELRHQSPETQTDTHSINILEEYE 633
              ++  + E     ND  E             ET+T+ H  NIL++Y+
Sbjct: 576 IQDAVPANAE----VNDGGET------------ETETENHLGNILDDYD 608

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  499 bits (1284), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 257/520 (49%), Positives = 349/520 (67%), Gaps = 28/520 (5%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           M D  EE+NRIS QV++LSTQL+ESI R                 Q+  + +++ LK   
Sbjct: 1   MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKN 60

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
            +L         +I+ L   L+EE   R +AE EV  L QEVEDLTASLF EAN+MV+DA
Sbjct: 61  KELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDA 120

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLG 180
           RREKH  EI N++L E L+E                      + E+  N A+  +P  + 
Sbjct: 121 RREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSIN-ANIRSP--IS 177

Query: 181 SEQKSASASLSNEVGDPSNK--------GVYSPYISTIRYDLALYNEFLKFIAVLPYCKN 232
           +E  + +++  N++    ++         ++SPY++T+RYD +LYNEFLKF+AVLP   +
Sbjct: 178 TENSTTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLYNEFLKFLAVLPSSSS 237

Query: 233 LKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENY 292
           LK TS+ESKL++RL++DEIQP+L+ID+A+GIGWL +KS+LT M++G VV+EPLSG+NE Y
Sbjct: 238 LKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGINEAY 297

Query: 293 QLG-----HVSSSDQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHAR 347
           QLG     HVS ++    P        H+FN+P +SPP+AV +PC+FC E RDDI+EHAR
Sbjct: 298 QLGYETKEHVSQNEGEEMP--------HMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHAR 349

Query: 348 MHVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIA 407
           M+V+KT +K  DGS T+TNS+PLC WCL KVRQTCEIFAFLRSLK+GTW+LEKVTLN+I+
Sbjct: 350 MYVMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTIS 409

Query: 408 KGES-NKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAG 466
           KGES +KF+EVT++  +N    ++EKK  RKSF+  L   +    +P VE    T   AG
Sbjct: 410 KGESLSKFSEVTKS--TNGSTSNEEKKSNRKSFIPSLPKGSPKKSSPVVETHIDTT-KAG 466

Query: 467 QPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGP 506
           QPT+NIQRAWV LCKLRSMLHW ++GIW++++SISLK+GP
Sbjct: 467 QPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGP 506

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  471 bits (1211), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 239/555 (43%), Positives = 355/555 (63%), Gaps = 44/555 (7%)

Query: 6   EENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLKT 65
           EE+ R+S Q+ SLSTQL+ESI+R                   G++ +Y+ LK ++ +L+ 
Sbjct: 8   EESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFAELEK 67

Query: 66  TVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREKH 125
             S ++ ++  L+  L+++ + R+ A++    L+ EVE+LTASLF EAN+MVADAR+  H
Sbjct: 68  RESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADARKASH 127

Query: 126 ITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKA------SSIAPDFL 179
            TE+ N KLVEQL E                      +D+++ ++       +S   +  
Sbjct: 128 ATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSMASEQVKTLANASDNANLA 187

Query: 180 GSEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSE 239
            S  K+ S+S   ++  P    ++SP I+ +RYDL LY+EFLKF+AVLP  +++KDT+S+
Sbjct: 188 ASLSKNLSSSHGRQIEAPLGP-IFSPNITAVRYDLGLYHEFLKFLAVLPDYQDIKDTASD 246

Query: 240 SKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVS- 298
           SKL+RRL+NDEIQP+L++++A+G+GW+ K++++ LMI+GLV +EP+SG+NE +Q G+ S 
Sbjct: 247 SKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNEMHQYGYASP 306

Query: 299 ------------SSDQSNRPSMESK-----RESH-----------LFNYPTDSPPVAVHE 330
                       S+   N P+  S      + +H           LFNYP+DSPPVA+ E
Sbjct: 307 MLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPSDSPPVALRE 366

Query: 331 PCSFCGENRDDILEHARMHVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRS 390
            C+ CGE RDD++EHAR+H+LKTQS+++DG++TV N++PLC +C+ K+RQTCEIFAFLRS
Sbjct: 367 KCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQTCEIFAFLRS 426

Query: 391 LKIGTWNLEKVTLNSIAKGESNKFTEVTRA----IKSNKHGKSDEKKLKRKSFMVGLGIN 446
           LK+G W LEKV+L S++KG+S +F++V+       K N+  K + +K  RKSFM G+   
Sbjct: 427 LKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDSKKENRKTARKSFMAGMNAL 486

Query: 447 ASSNLTPQVEVGASTIGNAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGP 506
            S N T   EV    +  AG PTTNIQ AW+QLC+LRSMLHWT++GIW+VD+ I+ KIGP
Sbjct: 487 NSKNTTVTPEV---PVSQAGAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCITSKIGP 543

Query: 507 QV-KDDNNEITGTTV 520
            V  D +N   G T 
Sbjct: 544 LVINDGSNNAAGKTT 558

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  460 bits (1183), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 244/521 (46%), Positives = 326/521 (62%), Gaps = 14/521 (2%)

Query: 3   DLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDK 62
           D A+E+ RIS Q+TS+STQLMESIQ                 + +     YD LK    K
Sbjct: 14  DTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVAK 73

Query: 63  LKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARR 122
           L+ +++ R+ E+  L+  L EE   R++++  V  L  EVEDLTASLF+EAN+MVADAR+
Sbjct: 74  LEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADARK 133

Query: 123 EKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFE--DENVTNKASSIAPDFLG 180
           EKH TEILN KL+E + E                      +    + T ++S  + D   
Sbjct: 134 EKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSATGRSSMTSADTDT 193

Query: 181 SEQKSASASLSNEV-GDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSE 239
           +  K      SN+   D +   VYSP + ++RYDL+LY+EFLKF+  LP C  ++DT SE
Sbjct: 194 NSLKGIVTRSSNQSQSDTAPLVVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQIRDTESE 253

Query: 240 SKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVSS 299
           SKL+RRLINDEI PILRIDSA GIGW+AKKS++ +M++G+V+IEP SGVNENYQ GH  S
Sbjct: 254 SKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENYQHGH--S 311

Query: 300 SDQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSED 359
           S   ++ S+  K + HLF+YP DSPP+A  E C+ CGE+R DI EH R+H +K Q K +D
Sbjct: 312 SPSISQHSL-GKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKIQQKRDD 370

Query: 360 GSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKV-TLNSIAKGESNKFTEVT 418
           G++ V N YPLC WCL +VRQTCEIF+FLRSLK G W LE + T  S    +S KF    
Sbjct: 371 GTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAKSKKFDLNN 430

Query: 419 RAIKSNKHGKSDEKKLKRKSFMVGLGIN--ASSNLTPQ----VEVGASTIGNAGQPTTNI 472
             I+ NK  K+   + KR S+M GLG+N   SS+  P     +E   +     G P TNI
Sbjct: 431 APIRRNK-TKNSANRTKRMSWMAGLGLNTPTSSSSAPNDVSLMEPSTTFTDKNGLPNTNI 489

Query: 473 QRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNN 513
           +RAW+QLCKLRS+LHW ++GIWSV +++ LKIGP   D ++
Sbjct: 490 KRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPITTDPDD 530

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  456 bits (1174), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 245/536 (45%), Positives = 338/536 (63%), Gaps = 34/536 (6%)

Query: 3   DLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDK 62
           ++A+E+ R++ QVT LSTQLMESI +                +Q+ +I K   +KA    
Sbjct: 5   EIADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKATGSA 64

Query: 63  LKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARR 122
           L+   ++   +++     L +E +LR  AE E   L++EVEDLTASLF EAN MVADAR+
Sbjct: 65  LQKNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVADARK 124

Query: 123 EKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFL--- 179
           EK   E+ NTKL+EQL+E                     F+DE+  NK +S+  +     
Sbjct: 125 EKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDSNNKRNSMLSEVTIHS 184

Query: 180 GSEQKSASASLSNEVGDPSNKGV-YSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSS 238
           GS Q++ S ++ +     S   + YSP IS IRYDL LY EFLKF+AVLP+ KN+K T++
Sbjct: 185 GSSQRAGSPTIISTTNSESFANIIYSPNISDIRYDLPLYGEFLKFVAVLPFVKNIKQTTN 244

Query: 239 ESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVS 298
           +SKL+RRL+NDEIQP+LR+D+A+G+GW+ K+++LT M++GLV++EPLSGVNE Y      
Sbjct: 245 DSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPLSGVNELYTHSRNR 304

Query: 299 SSDQSNRPSMESK-------------RESHLFNYPTDSPPVAVHEPCSFCGENRDDILEH 345
            S  SN  +  ++             + SHLFN+PT+SPPVAVHEPC+FC E RDD ++H
Sbjct: 305 RSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAVHEPCAFCNEKRDDSVQH 364

Query: 346 ARMHVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNS 405
           AR+H+LKTQS+SE G ITVTN +PLC  C+ KVRQT EIFAFLRSL +GTW LEK+ + +
Sbjct: 365 ARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKLEKIAIAN 424

Query: 406 IAKGESNKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGI-NASSNLTPQVE-------- 456
           ++K +  K           K  + ++KK KRKSF+ GL +   +S L P           
Sbjct: 425 LSKSDPTKIK--GSPASPTKDKEKEKKKAKRKSFIKGLNMAQTASVLNPATSNPFFQQTQ 482

Query: 457 ---VGASTIGNA---GQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGP 506
              VG +++ +    GQPTTNIQRAW+QLCKLR MLHW++MGIWS+D+SI  K  P
Sbjct: 483 TNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDDSIEAKFAP 538

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  452 bits (1164), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 233/518 (44%), Positives = 331/518 (63%), Gaps = 17/518 (3%)

Query: 1   MDDLAEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADY 60
           M +  EE+ RIS QV+SLSTQL+ESI +                +Q+ SI+++D LK   
Sbjct: 10  MTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQL 69

Query: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120
              K  ++    E+   +  L E  ++R +AE     L++E+EDLT SLF EAN MVA+A
Sbjct: 70  SDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANA 129

Query: 121 RREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDFLG 180
           R+EKH  E+LN+KL EQLRE                      EDE+  N  +S     + 
Sbjct: 130 RKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEH--NTLNSYRQSIIM 187

Query: 181 SEQKSASASLSNE-VGDPS--------NKGVYSPYISTIRYDLALYNEFLKFIAVLPYCK 231
                ++ASL  E +G+P            ++SP   ++RYD+ LY E+L+F+AVLP CK
Sbjct: 188 EGSNGSNASLDKEALGNPGLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCK 247

Query: 232 NLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNEN 291
            +KDT  +SK +RRL+ DEIQP+LR+D+A+G+GWL +++++ LMIDGLVV+EPLSG+NE 
Sbjct: 248 GIKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINET 307

Query: 292 YQLGHVSSSDQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVL 351
           Y++G+  +S QSN   +     + +FNYP++SPPVA+ +PC+FC E+R+DILEH R++VL
Sbjct: 308 YRIGY--ASPQSNSHKVTEVDNAKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYVL 365

Query: 352 KTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGES 411
           KT  K+EDGS T    YPLC +CL KVRQTCEIFAFLRSLK G WNLE VTL S A+  S
Sbjct: 366 KTLQKNEDGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTL-SCARPGS 424

Query: 412 NKFTEVTRAIKSN--KHGKSDEKKLKRKSFMVGLGINASS-NLTPQVEVGASTIGNAGQP 468
           ++FT+V R   +N   + +++    KR SFM GL   +SS  +TP++E         G P
Sbjct: 425 DEFTKVDRNSTTNSASNKEANSTSSKRLSFMSGLSRTSSSTRMTPRIETVTDFSERKGLP 484

Query: 469 TTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGP 506
           +TN+QR+WV LCKLR+ LHW ++G+W++++SI LK+ P
Sbjct: 485 STNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAP 522

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  447 bits (1149), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 333/529 (62%), Gaps = 20/529 (3%)

Query: 6   EENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLKT 65
           EE+ R+S QV+SLSTQL+ESI +                SQ  S+  Y+ L+   ++ ++
Sbjct: 5   EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64

Query: 66  TV-SERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREK 124
            + SER++ I+ +Q  L+     + +AE E+  L++EVEDLTASLF EAN+MVADARRE 
Sbjct: 65  NLKSERSQNIK-IQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRET 123

Query: 125 HITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDEN----VTNKASSIAPDFLG 180
           H  ++ N+KL EQL+E                      E+E+     +N+AS  A D + 
Sbjct: 124 HSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQASVAAEDSVA 183

Query: 181 SEQKSA---SASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTS 237
           S  +SA   + +  N    P +  ++SP + ++RYDL LYNEFLKFIA LP C +++D++
Sbjct: 184 SSSESALEKTMNALNGTASPPSPALFSPLLKSLRYDLVLYNEFLKFIAALPQCASIRDST 243

Query: 238 SESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHV 297
           S SKL+RRLI+DEIQP+LR+D+A+GIGW  ++++++LMIDG +V+EP+SG+NE Y++GH+
Sbjct: 244 SYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVGHM 303

Query: 298 SSS----DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKT 353
           SS      Q   P  +S+   HL+NYP DSPPVA+  PCSFC E+R+DILEH R++VLKT
Sbjct: 304 SSQVEAVPQFQGPEQQSR--PHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKT 361

Query: 354 QSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNK 413
             K E+G    ++ +PLC +CL KVRQTCEIFAFLRSLK G W+LE VT++      S +
Sbjct: 362 LQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSVQ 421

Query: 414 FTEVTRA--IKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTN 471
              V+ +  ++S       ++K KR SFM GL        +  VE  +        PTTN
Sbjct: 422 TNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTPTTN 481

Query: 472 IQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDD---NNEITG 517
           IQRAW QLCKLRS LHW ++GIW++++ +  K+GP V  D   N+ I G
Sbjct: 482 IQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVG 530

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  442 bits (1136), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 337/535 (62%), Gaps = 29/535 (5%)

Query: 6   EENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLKT 65
           EE+ R+S QV+SLSTQL+ESI +                SQ       D LK+ Y+ +  
Sbjct: 5   EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQR------DALKS-YESVGK 57

Query: 66  TVSERNREIQNLQV-NLKEESKLRSS------AEAEVATLSQEVEDLTASLFAEANDMVA 118
            + E   E+++++  N K++  L+++      A+ EV+ L++EVE+LTASLF EAN+MVA
Sbjct: 58  RLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVA 117

Query: 119 DARREKHITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNKASSIAPDF 178
           DAR+E H  ++ N KL EQL+E                      E+E+ +   S+ +P  
Sbjct: 118 DARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVM 177

Query: 179 LGSEQKSASASLS--------NEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYC 230
             S+  + S++++        N      N  ++SP + ++RYDL LYNEFLKFIA LP  
Sbjct: 178 DTSDNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTS 237

Query: 231 KNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNE 290
            ++KDT+SESKL+RRL++DEIQP+LR+D+A+G+GW  K+S++TLM+DGLVV+EP+SG+NE
Sbjct: 238 ASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINE 297

Query: 291 NYQLGHVSSSDQS--NRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARM 348
            Y++ H S  + +   RP  E + E HL+NYP DSPPVA+ +PCSFC E+R+DILEH R+
Sbjct: 298 TYRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRL 357

Query: 349 HVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAK 408
           +VL+T  K+E+G+  V + +PLC +CL KVRQTCEIFAFLRSLK G W+LE VT+++ ++
Sbjct: 358 YVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQ 417

Query: 409 GESNKFTEVTRAIK----SNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGN 464
             S +F   ++       S +  KSD +K KR S M GL  +  S  +  +E    +   
Sbjct: 418 RSSTEFKSQSKLSTPERGSERKVKSD-RKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQ 476

Query: 465 AGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTT 519
              PTTNIQ AW QLCKLRS LHWT++GIWS+ +S+  K+GP    D+ E   ++
Sbjct: 477 VTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDSAEAVASS 531

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  441 bits (1133), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 217/516 (42%), Positives = 324/516 (62%), Gaps = 15/516 (2%)

Query: 6   EENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLKT 65
           EEN RIS QV+SLSTQL+ESI +                +Q+  + + +  + +  +L++
Sbjct: 14  EENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQQLRS 73

Query: 66  TVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREKH 125
            +++R+ E++     L+E  K R +AE  V  L++E+EDLT SLF EAN MV+ AR+EKH
Sbjct: 74  QLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKARKEKH 133

Query: 126 ITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDENVTNK-----ASSIAPDFLG 180
           + E  N +L EQLRE                      EDE  T         S+ P    
Sbjct: 134 VVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTRSRRQSVMDSVNPSHTS 193

Query: 181 SEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSES 240
            +    +++  N +   S+  +++P + ++RYD+ +Y E+L+F+AVLP CK+++DT  +S
Sbjct: 194 LDVDGYASAFDNML---SSGLLFTPAVQSLRYDIPMYTEYLRFLAVLPMCKSIRDTRHDS 250

Query: 241 KLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVSSS 300
           K +RRL++DEIQP+LR+DSA G+GWL +++++ LMI+GLVV+EPLSG+NE Y++G+ S  
Sbjct: 251 KFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYRMGYASPQ 310

Query: 301 DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDG 360
             S+  S E      +F YP +SPPVA+  PC+FC E R+DILEH R++VLKT  K+E G
Sbjct: 311 THSHSKSSEPA-AVKMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQKTETG 369

Query: 361 SITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFTEVTRA 420
            +   N YPLC +CL KVRQTCEIFAFLRSLK G+WNLE VTL S AK ES+ FT++  +
Sbjct: 370 ELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTL-SCAKQESDAFTQIPNS 428

Query: 421 IKSNKHGKSDEKKL----KRKSFMVGLG-INASSNLTPQVEVGASTIGNAGQPTTNIQRA 475
           ++++     DE  +    KR SFM  L  ++ +S  TP++E         G P TN+QR+
Sbjct: 429 VQASPVIHRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAVTDFNEKKGLPPTNVQRS 488

Query: 476 WVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDD 511
           WV LCKLR+ LHW+++G+W++D+++  K+ P   +D
Sbjct: 489 WVHLCKLRASLHWSHIGVWTLDDAVQTKVVPLSPED 524

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  436 bits (1122), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 225/520 (43%), Positives = 334/520 (64%), Gaps = 23/520 (4%)

Query: 5   AEENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLK 64
           ++E+ R+S Q+TSLSTQL+ESI++                 Q+ +I +Y+ L+  YD+L 
Sbjct: 5   SDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKYDQLD 64

Query: 65  TTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREK 124
              S++  ++Q L+  L+ E   ++ AE +V  L++EVE+LTASLF EAN+MVADAR+E 
Sbjct: 65  KNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADARKET 124

Query: 125 HITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFEDEN----VTNKASSIAPDFLG 180
              E  N KL EQL E                      + E+    + N   S+  D   
Sbjct: 125 DSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKGDVPL 184

Query: 181 SEQKSASASLS----------NEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYC 230
           S +   S+S S              +  N  +++P I+ IRYD  LYNEFLKF+AVLP+C
Sbjct: 185 SNENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAVLPHC 244

Query: 231 KNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNE 290
            ++K+TS+ESKL+RRLI+DEI P+LR+D++NG+GWL K++++  +++GLVVIEPLSG+NE
Sbjct: 245 NSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLSGINE 304

Query: 291 NYQ---LGHVSSSDQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHAR 347
            Y+   L  VS S  S +    +K  + +FN+P DSPP+AV +PC+FC E+R D + HAR
Sbjct: 305 TYRQSALYEVSISKSSIKSDQITK--AKMFNFPADSPPIAVRDPCAFCDESRSDCIGHAR 362

Query: 348 MHVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIA 407
           M++LKTQ++++D ++++TN YPLC  CL KVRQTC+IFAFLRSLK G W LEKVTL++I+
Sbjct: 363 MYMLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTIS 422

Query: 408 KGESNKFTEVTR-AIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAG 466
           KG+++ F +V     K N+   + EKK KRKS +  LG + SS +  +++    T+   G
Sbjct: 423 KGDTSSFLKVAENQFKQNEKATAQEKKQKRKSIISSLGKSHSSYVNAKLDC---TVEPVG 479

Query: 467 QPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGP 506
            P+TNIQRAW+QLCKLRS+LHW+++GI + ++ ++    P
Sbjct: 480 LPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAP 519

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  432 bits (1110), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 226/505 (44%), Positives = 322/505 (63%), Gaps = 22/505 (4%)

Query: 6   EENNRISAQVTSLSTQLMESIQRXXXXXXXXXXXXXXXXSQEGSIAKYDILKADYDKLKT 65
           EE+ RIS QVTSLSTQL+ESI +                +Q+     Y+ LK +   LK 
Sbjct: 5   EESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQELQSLKL 64

Query: 66  TVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARREKH 125
                  + +  +   K++ ++ + AE +VATL+QE+EDLTASLF EAN+MVADAR+E++
Sbjct: 65  -------QYETDKTKFKKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADARKEQN 117

Query: 126 ITEILNTKLVEQLREXXXXXXXXXXXXXXXXXXXXXFE-DENVTNKASSIAPDFLGSEQK 184
             EILN+KL EQL+E                     FE D N +   S        +   
Sbjct: 118 AVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSSKNVSLSDSATSSTTSI 177

Query: 185 SASASLSNEVGDPS--NKGV-YSPYISTIRYDLALYNEFLKFIAVLPYCKNLKDTSSESK 241
             S +    V D S   +GV +SP + ++RYD+ LY E+LKF+AVLP C+NL+ T+SESK
Sbjct: 178 DRSTTNLTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQCENLQQTTSESK 237

Query: 242 LMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLGHVSSSD 301
           L+RRLIN EI P+LR+D+A+G+GWL K++++ LM++GLV IEP+SG+NE Y+ G+ SS  
Sbjct: 238 LLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGINETYRTGY-SSPS 296

Query: 302 QSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDGS 361
             + P +E+K +SHLF+ P +SPPVA+ EPC+FCGENR+DILEH R+++ KT  K E+G 
Sbjct: 297 IPDSPEVENK-DSHLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFKTYQKLENGK 355

Query: 362 ITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKFTEVTRAI 421
             +TN +P+C +CL K+RQ CEIFAFLRSL+ G W+LEKV L SI +G+ N ++EVT+A 
Sbjct: 356 NELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKVNAYSEVTKAS 415

Query: 422 KSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGNAGQPTTNIQRAWVQLCK 481
           +          K+K K   +  G+  S + TP +E G       G PTTNIQR+W +L +
Sbjct: 416 RP---------KMKSKRLSIFQGLKQSQSSTPIIENGPQFADKNGLPTTNIQRSWARLSQ 466

Query: 482 LRSMLHWTYMGIWSVDESISLKIGP 506
           LR+ L W+++G+WS+DES++  I P
Sbjct: 467 LRASLQWSHIGVWSLDESVATDIAP 491

>Skud_14.212 Chr14 (391083..392564) [1482 bp, 493 aa] {ON} YNL119W
           (REAL)
          Length = 493

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 507 QVKDDNNEITGTTVDVASVLTGNT-----ENVSNSIKDTVSAPER-NAYNQASIDSPQFD 560
           QVK  NN  TG TVD+ ++ TG T     E + + +K+ +    + N Y    ID  +F 
Sbjct: 90  QVKQHNNH-TGFTVDILTIFTGETVSIVKERMESLVKEKLLKLNKPNIYKVHFIDINEFF 148

Query: 561 ENKTKSQNL--DDG 572
            N ++  NL  DDG
Sbjct: 149 SNTSRVSNLIIDDG 162

>ZYRO0C10868g Chr3 (832924..837114) [4191 bp, 1396 aa] {ON} similar
           to uniprot|P43638 Saccharomyces cerevisiae YJL042W MHP1
           Microtubule-associated protein involved in assembly and
           stabilization of microtubules; overproduction results in
           cell cycle arrest at G2 phase
          Length = 1396

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 213 DLALYNEFLKFIAVLPYCKNLK--DTSSESKLMRRLIN 248
           D++  NE LK I++L YC+NLK  D S+  K+    IN
Sbjct: 934 DVSKTNEVLKLISLLCYCENLKFLDISNNPKMFPHCIN 971

>TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.296
           YDR285W
          Length = 855

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 54  DILKADYDKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASL 109
           D LK DY KLK  +     +I  L+V++     L+  ++AE++  S+E++ LT  L
Sbjct: 243 DELKGDYGKLKKKIDAYKSDIAELKVSITSFQSLKKDSDAELSKRSKEIDYLTREL 298

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 51  AKYDILKADYDKLKTTVSERNR-------EIQNLQVNLKEESKLRSSAEAEVATLSQEVE 103
           +KYDIL+ADY+ L+  +SE +R       ++ NL + +K +S+    AE  +  L    E
Sbjct: 777 SKYDILEADYNSLEDKMSESDRLLKSNFLDVSNLNIIIKAQSEKLKDAEEGLTLLESHKE 836

>Skud_8.97 Chr8 complement(165465..167399) [1935 bp, 644 aa] {ON}
           YHR039C (REAL)
          Length = 644

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 490 YMGIWSVDESISLKIGPQVKDDNNEITGTTVDVASVLT 527
           Y  +W   ++  L+  PQ+  DN ++ G T  VAS+ T
Sbjct: 21  YFNLWLEKQNAILRFQPQIIQDNQKLIGITTLVASIFT 58

>KAFR0E00710 Chr5 (151558..152967) [1410 bp, 469 aa] {ON} Anc_8.581
           YPL101W
          Length = 469

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 6/64 (9%)

Query: 305 RPSMESKRESHLFNYPTDSP-PVAVHEPCSFCGENRDDILEHARMH-----VLKTQSKSE 358
           +PS+E K+E+ + N+P   P PV+ H   S   E+ D IL H  +      +++ QS +E
Sbjct: 74  QPSVEQKQEAAILNHPGVRPSPVSSHLVTSTGSEDLDKILTHMGLPLGNSLLIEEQSTTE 133

Query: 359 DGSI 362
             SI
Sbjct: 134 FNSI 137

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,587,206
Number of extensions: 2787555
Number of successful extensions: 13498
Number of sequences better than 10.0: 299
Number of HSP's gapped: 14019
Number of HSP's successfully gapped: 343
Length of query: 664
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 548
Effective length of database: 40,180,143
Effective search space: 22018718364
Effective search space used: 22018718364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)