Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D039501.82ON1957190387300.0
Skud_14.691.82ON1946107929320.0
YNL271C (BNI1)1.82ON1953108729320.0
Smik_14.661.82ON1952108429180.0
Suva_14.711.82ON1948108428970.0
NCAS0A005901.82ON1946107527890.0
CAGL0J08206g1.82ON1898106227350.0
NDAI0F042201.82ON2022109726090.0
KNAG0F004701.82ON2028108525620.0
Kpol_2000.661.82ON1930108025330.0
TDEL0C061901.82ON1879106425090.0
ZYRO0F16676g1.82ON1994100923810.0
TPHA0B044901.82ON1940100222450.0
TBLA0A054401.82ON217088820400.0
SAKL0C02618g1.82ON1988107919580.0
Kwal_33.133921.82ON196863518940.0
AFR669W1.82ON191857918880.0
KLTH0F02376g1.82ON197666118570.0
Ecym_10861.82ON209161718450.0
KLLA0C02321g1.82ON184257017480.0
NCAS0G001205.717ON13145017641e-81
SAKL0E15224g5.717ON13354267622e-81
CAGL0H06765g5.717ON12944297576e-81
Ecym_5679na 1ON13064217532e-80
AGL364Cna 1ON12604137362e-78
AFR301C5.717ON16554337404e-78
Kpol_416.105.717ON14914247376e-78
Ecym_40045.717ON14544177358e-78
TDEL0F055605.717ON12924247212e-76
KLLA0F10912g5.717ON12834787104e-75
Smik_9.95.717ON13744617114e-75
Kwal_55.196205.717ON13894346963e-73
Skud_9.85.717ON13744316928e-73
NDAI0F001605.717ON13494326892e-72
KNAG0L022505.717ON13674746892e-72
ZYRO0B16654g5.717ON14244206893e-72
YIL159W (BNR1)5.717ON13755186873e-72
KLTH0E00704g5.717ON13894236732e-70
TPHA0E001205.717ON16424246636e-69
Suva_9.265.717ON13754266454e-67
KAFR0D021205.717ON13244176383e-66
TBLA0E018105.717ON14514846312e-65
ZYRO0G10274g4.114ON900170830.79
Klac_YGOB_Anc_8.3988.398ON59281801.7
Ecym_34383.389ON31052755.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D03950
         (1957 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....  3367   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...  1134   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...  1134   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...  1128   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...  1120   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  1078   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...  1058   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}          1009   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     991   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   980   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   971   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   921   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   869   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   790   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   758   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   734   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   731   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   719   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   715   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   677   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      298   1e-81
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   298   2e-81
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   296   6e-81
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   294   2e-80
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   288   2e-78
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   289   4e-78
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   288   6e-78
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   287   8e-78
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   282   2e-76
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   278   4e-75
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   278   4e-75
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   272   3e-73
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   271   8e-73
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     270   2e-72
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   270   2e-72
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   270   3e-72
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   269   3e-72
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   263   2e-70
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   259   6e-69
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   253   4e-67
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   250   3e-66
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   247   2e-65
ZYRO0G10274g Chr7 complement(823030..825732) [2703 bp, 900 aa] {...    37   0.79 
Klac_YGOB_Anc_8.398 Chr4 complement(1565442..1567220) [1779 bp, ...    35   1.7  
Ecym_3438 Chr3 (822940..823872) [933 bp, 310 aa] {ON} similar to...    33   5.3  

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score = 3367 bits (8730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1679/1903 (88%), Positives = 1679/1903 (88%)

Query: 55   PLQKHDTNLXXXXXXXXXXNASAITTTNKPLNKKSTLNTQNLSQYMDHXXXXXXXXXXXX 114
            PLQKHDTNL          NASAITTTNKPLNKKSTLNTQNLSQYMDH            
Sbjct: 55   PLQKHDTNLPPSSSSSPSSNASAITTTNKPLNKKSTLNTQNLSQYMDHARSSSTNSASAS 114

Query: 115  XXXXXXXXXXXXXXXXXLRRLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPR 174
                             LRRLSRQHTGQ            YINFSKFITPDGKTNLEMPR
Sbjct: 115  KYSSSRRSSTQVSTSESLRRLSRQHTGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPR 174

Query: 175  DPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGP 234
            DPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGP
Sbjct: 175  DPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGP 234

Query: 235  KNSSLVNVEQLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHE 294
            KNSSLVNVEQLVYSP                    PMASVASNEYYPMTSPQTKKPTSHE
Sbjct: 235  KNSSLVNVEQLVYSPTTTTTNNNNNNNNSNYNNTSPMASVASNEYYPMTSPQTKKPTSHE 294

Query: 295  LYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLE 354
            LYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLE
Sbjct: 295  LYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLE 354

Query: 355  NQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTD 414
            NQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTD
Sbjct: 355  NQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTD 414

Query: 415  TIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLP 474
            TIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLP
Sbjct: 415  TIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLP 474

Query: 475  QYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMV 534
            QYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMV
Sbjct: 475  QYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMV 534

Query: 535  FVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLM 594
            FVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLM
Sbjct: 535  FVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLM 594

Query: 595  LESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLS 654
            LESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLS
Sbjct: 595  LESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLS 654

Query: 655  KQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQ 714
            KQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQ
Sbjct: 655  KQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQ 714

Query: 715  AEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXX 774
            AEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQS                
Sbjct: 715  AEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEH 774

Query: 775  XXXXXXMLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTID 834
                  MLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTID
Sbjct: 775  EVELRKMLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTID 834

Query: 835  AKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXX 894
            AKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVT         
Sbjct: 835  AKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKH 894

Query: 895  XXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQR 954
                INQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQR
Sbjct: 895  KIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQR 954

Query: 955  LKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQL 1014
            LKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQL
Sbjct: 955  LKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQL 1014

Query: 1015 LNLQKTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLETLSEKYGTGQ 1074
            LNLQKTQELR                    IFVASSSSKPAGSGTRSFLETLSEKYGTGQ
Sbjct: 1015 LNLQKTQELREESSSSYSSSESDEENDDDEIFVASSSSKPAGSGTRSFLETLSEKYGTGQ 1074

Query: 1075 KNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVAPALSVXXXXXXXXXXXX 1134
            KNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVAPALSV            
Sbjct: 1075 KNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVAPALSVNEEQEEGEENNR 1134

Query: 1135 XDKIVTGSSKVPSEVVKTTLENADKNAGKIDSVSSADADIVKDKSTGAXXXXXXXXXXXX 1194
             DKIVTGSSKVPSEVVKTTLENADKNAGKIDSVSSADADIVKDKSTGA            
Sbjct: 1135 EDKIVTGSSKVPSEVVKTTLENADKNAGKIDSVSSADADIVKDKSTGALPTPPPPPPPLP 1194

Query: 1195 VQIFATNNDVGTNSDVLDNTSVAXXXXXXXXXXXSALFESGSAPLSRGTSXXXXXXXXXX 1254
            VQIFATNNDVGTNSDVLDNTSVA           SALFESGSAPLSRGTS          
Sbjct: 1195 VQIFATNNDVGTNSDVLDNTSVALPPPPPPPPLPSALFESGSAPLSRGTSPTPTPPPPPP 1254

Query: 1255 XXXXXXXFSAETSANSTSSVPPPALPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLH 1314
                   FSAETSANSTSSVPPPALPLMGGK              FERYPRSQKKMKQLH
Sbjct: 1255 PPPPPPPFSAETSANSTSSVPPPALPLMGGKSVSSSPLLPQSPSLFERYPRSQKKMKQLH 1314

Query: 1315 WEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLS 1374
            WEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLS
Sbjct: 1315 WEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLS 1374

Query: 1375 RDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYS 1434
            RDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYS
Sbjct: 1375 RDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYS 1434

Query: 1435 PYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXX 1494
            PYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITT     
Sbjct: 1435 PYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTYEKEY 1494

Query: 1495 XXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD 1554
                   RKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD
Sbjct: 1495 NELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD 1554

Query: 1555 STNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERS 1614
            STNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERS
Sbjct: 1555 STNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERS 1614

Query: 1615 IEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSD 1674
            IEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSD
Sbjct: 1615 IEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSD 1674

Query: 1675 KFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRKAERKEAKXXXXX 1734
            KFARNSFFKKFADFINEYRKAQEQNIKV     AYERHKRMVEEQQRKAERKEAK     
Sbjct: 1675 KFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQQRKAERKEAKNQNNI 1734

Query: 1735 XXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHD 1794
                     RTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHD
Sbjct: 1735 DENEDDDQERTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHD 1794

Query: 1795 LETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLL 1854
            LETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLL
Sbjct: 1795 LETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLL 1854

Query: 1855 MGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDLPSGSNKLKFYDTNEKDISNEPTEKSE 1914
            MGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDLPSGSNKLKFYDTNEKDISNEPTEKSE
Sbjct: 1855 MGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDLPSGSNKLKFYDTNEKDISNEPTEKSE 1914

Query: 1915 QDEYRTEQSSQIVDEQTSDAKVDSTDEHVIENGIKEENIDDDN 1957
            QDEYRTEQSSQIVDEQTSDAKVDSTDEHVIENGIKEENIDDDN
Sbjct: 1915 QDEYRTEQSSQIVDEQTSDAKVDSTDEHVIENGIKEENIDDDN 1957

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1079 (55%), Positives = 740/1079 (68%), Gaps = 54/1079 (5%)

Query: 83   KPLNKKSTLNTQNLSQYMDHXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXLRRLSRQH 139
            +PLNKKSTLNTQNLSQYM                                    +L+RQH
Sbjct: 82   RPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQH 141

Query: 140  TGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVE 199
            TGQ              N SKF TPDGK +LEMP DP E+E LFE+IMYKRNI Q+LS +
Sbjct: 142  TGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSGD 201

Query: 200  KQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNG-----------------PKNSSLVNV 242
            KQ  LM Y   KKWLIVKQD+QNE K++RA                       NSSL + 
Sbjct: 202  KQEALMGYSTEKKWLIVKQDLQNELKKMRANTTSSSAASRTSVASDHLPILTANSSLSSP 261

Query: 243  EQLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQL-TES 301
            + ++ +                        +  S     +T    K+P+ + +Y+  +E+
Sbjct: 262  KSILMTSASSPTSTVYSNNLNHSTTLSSAGTSTSKSKKIVTGSLKKQPSLNNIYRGGSEN 321

Query: 302  NASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAM 361
            N S STL  D+TNRPP  YV++I+ADKL+ DEM+DLWVTLRTEQLDWVD+F+E+QGHIAM
Sbjct: 322  NISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAM 381

Query: 362  ANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLF 421
            AN+LM  +YKT P+D+L+ +LLEKENSFFKCF+VLSMLSQG+YEFS H+LMTDT+A GLF
Sbjct: 382  ANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLF 441

Query: 422  STRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLT 481
            ST+L T+KMA EIFVCMLEK+NKSRFEA+L +LD+ FRIG N HM QN KK+PQYF HLT
Sbjct: 442  STKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLT 501

Query: 482  PDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCN 541
             +SHLK++QAWLF++E T+DGRGKMGSLVGAS D KN GGENAILEYC WTMVF+N LC+
Sbjct: 502  LESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCS 561

Query: 542  ASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKN 601
             S  I QRMLLRTKLEN G LRIMNKIKLL+Y+KVID+I+ Y+NNKLDDFN+ LE+ N+ 
Sbjct: 562  CSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEA 621

Query: 602  SNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMD 661
             NV+LQDP+SLL NLW  CKGTENEKLL+SL+QHLFLSSS+LIEE  + +KL+KQLKLMD
Sbjct: 622  FNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMD 681

Query: 662  SLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLH 721
            SLVTNVS +S ADEES +NMAIQRLYD+MQTDEVARRAILESR LTKKLEE+QAE+D L 
Sbjct: 682  SLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLS 741

Query: 722  EKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXM 781
            EKLSKAE+GLVGQLE++L+ERD ILAKNQRV QQL+S                      M
Sbjct: 742  EKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKM 801

Query: 782  LTILNTR----SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKK 837
            LTILN+R    S  N+G + ID        LN  +  NIQKVLQDGL RAK D+  D+KK
Sbjct: 802  LTILNSRPEESSDINEGTRNID------PSLNFSEKANIQKVLQDGLSRAKKDYKDDSKK 855

Query: 838  FGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXX 897
            FGMT+QPNKRLKMLRMQME+IENEARQLEMTNF EFE+++LEPP+++             
Sbjct: 856  FGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDK 915

Query: 898  XINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKE 957
                  +  Q++ +NKLNDLR ALA+IQ ESNNISKFN+EERVNELFNEKK  AL+RLKE
Sbjct: 916  NF---LARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKE 972

Query: 958  LETKYKDFGINFEMKDFLEN-KPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLN 1016
            LETKYK FGI+F ++  +E+ K      E   +  Y SLDPK Y+KKLD+I+R+T++LL+
Sbjct: 973  LETKYKGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRITDELLD 1032

Query: 1017 LQKT--QELRXXXXXXXXXXXXXXXXXXXXIFVASS---------SSKPAGSGTRSFLET 1065
            LQ    QE +                    ++  +S         S   AGSG  SFL+ 
Sbjct: 1033 LQTQTKQETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSAGSGPGSFLDA 1092

Query: 1066 LSEKYGTGQKNVAMTATPNSRIV-------TQSEKQFLDRMRRSST-AAPFLQELTEKV 1116
            LS+KYGTGQ   A     +S  V       ++ EK F++R++RS+  +AP+L+ELT+KV
Sbjct: 1093 LSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKV 1151

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/609 (65%), Positives = 477/609 (78%), Gaps = 15/609 (2%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPR  KK+KQLHWEK+++TDNSIW +GKAE+FADDL+EKGV ++LEKAFAARE+KSL
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            A+KRK+DL KITFLSRDISQQFGINLHMYSSLSV DLV K+L CDRDFL TPSV+EFLSK
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             EI EVSVNLARNY+PY+TDWEG+++++DAKPPEKDPNDLQRADQ+YLQLM+NL+ YW S
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRAL ++T+            RKVDKAVG+LQ S+NLRNVFNVILAVGN+MNDTSKQAQ
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD+TNSMTFLNYVEKIIR+NYP+FN FL+ELEPVL+VVK+SIEQL N
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DCK+F QS+ NVERS+EIGNLSDSSKFHPLD+VL K LP LP+ R+KGDLL DEV LT+M
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LMQ YGED+ DKFA+ SFFKKFADFINEY+KAQ QN+        YE+HK++VEEQ
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1720 QRKAERKEAKXXXXXXXX--XXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALA 1777
            Q+KA+ KE +                  DRR  MDKLLEQLKN GP++ DPSSARKRAL 
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV 1820

Query: 1778 RKKMLTDKEGTVNMMHDLETESDSIIYSPDN---------KAIGSTPFGANGASSHKQNS 1828
            RKK L+DK+    +++DL+ E  SI+YSP+           A   TP    G  +  ++ 
Sbjct: 1821 RKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATRGLMNTPEDL 1880

Query: 1829 NELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDL 1888
               S +    D   +EEIS+RA+ LL  LRG+    K+NS LDEH EKLRAR+ R +++ 
Sbjct: 1881 PSPSKAPALED---QEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARKERASSET 1937

Query: 1889 PSGSNKLKF 1897
             +G NKL F
Sbjct: 1938 NTG-NKLSF 1945

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1087 (55%), Positives = 752/1087 (69%), Gaps = 58/1087 (5%)

Query: 77   AITTTNKPLNKKSTLNTQNLSQYMDHXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXLR 133
            + +T  +PLNKKSTLNTQNLSQYM+                                   
Sbjct: 77   STSTEARPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQSKYSYSKRNSSQASN 136

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            +L+RQHTGQ              N SKF TPDGK  LEMP DP E+E LFE+IMYKRNI 
Sbjct: 137  KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYKRNIF 196

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRA--------------TKNGP---KN 236
            Q+LS +KQ  LM Y + KKWLIVKQD+QNE K++RA              + + P    N
Sbjct: 197  QSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRTSMASDHHPILTAN 256

Query: 237  SSLVNVEQLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELY 296
            SSL + + ++ +                      + +  S     ++    K+P+ + +Y
Sbjct: 257  SSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKGKKLVSGSLKKQPSLNNIY 316

Query: 297  QL-TESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLEN 355
            +   E+N S STL  D+TNRPP  YV++I+ADKL+ DEM+DLWVTLRTEQLDWVD+F+++
Sbjct: 317  RGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDH 376

Query: 356  QGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDT 415
            QGHIAMAN+LM  IYKT P+++L+ +LLEKENSFFKCF+VLSMLSQG+YEFS H+LMTDT
Sbjct: 377  QGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDT 436

Query: 416  IARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQ 475
            +A GLFST+L TRKMA EIFVCMLEK+NKSRFEA+L SLD+ FRIG N HM QN KK+PQ
Sbjct: 437  VAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMPQ 496

Query: 476  YFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVF 535
            YF HLT +SHLK++QAWLF++E T+DGRGKMGSLVGAS + KN GGENAILEYC WTMVF
Sbjct: 497  YFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVF 556

Query: 536  VNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLML 595
            +N LC+ S  I QRMLLRTKLEN G LRIMNKIKLL+Y+KVID+IE Y+NNKLDDFN+ L
Sbjct: 557  INHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKL 616

Query: 596  ESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSK 655
            E+ NK  NV+L DP+SLL NLW  CKGTENEKLL+SL+QHLFLSSS+LIEE  + +KL+K
Sbjct: 617  EANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTK 676

Query: 656  QLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQA 715
            QLKLMDSLVTNVS +ST+DEE+ MNMAIQRLYD+MQTDEVARRAILESR LTKKLEE+QA
Sbjct: 677  QLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQA 736

Query: 716  EKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXX 775
            E+D L EKLSKAE+GLVGQLE++L+ERD+ILAKNQRV QQL++                 
Sbjct: 737  ERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQE 796

Query: 776  XXXXXMLTILNTRS----STNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDF 831
                 MLTILN+R     + N+G + ++      S LN  +  NIQKVLQDGL RAK D+
Sbjct: 797  VELRKMLTILNSRPEESFNKNEGTRGMN------SSLNSSEKANIQKVLQDGLSRAKKDY 850

Query: 832  TIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXX 891
              D+KKFGMT+QPNKRLKMLRMQME+IENEARQLEMTNF EFE+ +LEPP+ +       
Sbjct: 851  KDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKK 910

Query: 892  XXXXXXX--INQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKL 949
                     +  QE++     +NKLNDLR ALAEIQ ESN+ISKFN+EERVNELFNEKK 
Sbjct: 911  MKNKDRKPLVKPQEAD-----VNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKS 965

Query: 950  KALQRLKELETKYKDFGINFEMKDFLEN-KPNDGTKEGSTEEEYESLDPKIYEKKLDDID 1008
             AL+RLKELETKYK FGI+F + + +++ K N G  E   +  Y SLDPK Y+KKLD+I+
Sbjct: 966  LALKRLKELETKYKGFGIDFNVDEIMDSPKKNTGDVETEEDANYASLDPKTYQKKLDEIN 1025

Query: 1009 RLTEQLLNLQKT--QELRXXXXXXXXXXXXXXXXXXXXIFVASSSSK---------PAGS 1057
            R+T+QLL++Q     E++                    I+  +S ++          +GS
Sbjct: 1026 RITDQLLDIQTQTEHEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHSELSSGS 1085

Query: 1058 GTRSFLETLSEKYGTGQKNVAMTATPNSR-------IVTQSEKQFLDRMRRSS-TAAPFL 1109
            G  SFL+ LS+KYGTGQ   A  A   +        + ++ EK F++R+R+S+ ++AP+L
Sbjct: 1086 GPGSFLDALSQKYGTGQNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYL 1145

Query: 1110 QELTEKV 1116
            +ELT+KV
Sbjct: 1146 EELTQKV 1152

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/609 (66%), Positives = 477/609 (78%), Gaps = 15/609 (2%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPR  KK+KQLHWEK++ TDNSIW TGKAE+FADDL+EKGV ++LEKAFAARE+KSL
Sbjct: 1348 FEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1407

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            ASKRK+DL KITFLSRDISQQFGINLHMYSSLSV DLV KIL CDRDFL TPSV+EFLSK
Sbjct: 1408 ASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSK 1467

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             EI EVSVNLARNY+PY+TDWEG++++EDAKPPEKDPNDLQRADQIYLQLMVNL+ YW S
Sbjct: 1468 SEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1527

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRAL ++T+            RKVDKAV +LQES+NLRNVFNVILAVGN+MNDTSKQAQ
Sbjct: 1528 RMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1587

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD+TNSMTFLNYVEKI+R+NYPSFN FL ELEPVL+VVK+SIEQL N
Sbjct: 1588 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVN 1647

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DCK+F QS+ NVERS+EIGNLSDSSKFHPLD+VL K LP LP+ RKKGDLL DEV LT+M
Sbjct: 1648 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIM 1707

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LM  YGED+ DKFA+ SFFKKFADFINEY+KAQ QN+        Y +HK++VEEQ
Sbjct: 1708 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQ 1767

Query: 1720 QRKAERKEAKXXXXXXXXXX--XXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALA 1777
            Q++A+ KE +                  DRR  MDKLLEQLKN GP+++DPSSARKRAL 
Sbjct: 1768 QKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALV 1827

Query: 1778 RKKMLTDKEGTVNMMHDLETESDSIIYSPDN---------KAIGSTPFGANGASSHKQNS 1828
            RKK L++K+    +++DL+TE  SI+YSP+           A   TP    G  +  ++ 
Sbjct: 1828 RKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLATRGVMNTSEDL 1887

Query: 1829 NELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDL 1888
               S +    D   +EEIS+RA+ LL  LRG+ +P K+NS+LDEH EKLRAR+ R+  + 
Sbjct: 1888 PSPSKTSALED---QEEISDRARMLLKELRGSDTPVKQNSILDEHLEKLRARKERSIGEA 1944

Query: 1889 PSGSNKLKF 1897
             +G N+L F
Sbjct: 1945 STG-NRLSF 1952

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1084 (55%), Positives = 750/1084 (69%), Gaps = 56/1084 (5%)

Query: 77   AITTTNKPLNKKSTLNTQNLSQYMDHXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXLR 133
            +I+T  +PLNKKSTLNTQNLSQYM+                                   
Sbjct: 78   SISTEARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQSKYSYSKRNSSQASN 137

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            +L+RQHTGQ              N SKF TPDGK +LEMP DP E+E LFE+IMYKRNI 
Sbjct: 138  KLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIF 197

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRA--------------TKNGP---KN 236
            Q+LS +KQ  LM+Y   KKWLIVKQD+QNE K++RA              + + P    N
Sbjct: 198  QSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTSIASDHHPILTAN 257

Query: 237  SSLVNVEQLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELY 296
            SSL + + ++ +                      + +  S     M     K+P+ + +Y
Sbjct: 258  SSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMGGSLKKQPSLNNIY 317

Query: 297  QL-TESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLEN 355
            +  +E+N S STL  D+TNRPP  YV++I+ADKL+ DEM+DLWVTLRTEQLDWVD+F+++
Sbjct: 318  RGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDH 377

Query: 356  QGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDT 415
            QGHIAMAN+LM  IYKT P+D L+ +LLEKENSFFKCF+VLSMLSQG+YEFS H+LMTDT
Sbjct: 378  QGHIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDT 437

Query: 416  IARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQ 475
            +A GLFSTRL TRKMA EIFVCMLEK+NKSRFEA+L +LD+ FRIG N HM QN KK+PQ
Sbjct: 438  VAEGLFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQ 497

Query: 476  YFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVF 535
            YF HLT +SHLK++QAWLF++E T+DGRGKMGSLVGAS + KN GGENAILEYC WTMVF
Sbjct: 498  YFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVF 557

Query: 536  VNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLML 595
            +N LC+ S  I QRMLLRTKLEN G LRIMNKIKLL+Y+KV+D+IE Y+NNKLDDFN+ L
Sbjct: 558  INHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRL 617

Query: 596  ESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSK 655
            E+ NK  NV+LQDP+SLL NLW  CKGTENEKLL+SL+QHLFLSSS+LIEE  +P+KL+K
Sbjct: 618  EANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTK 677

Query: 656  QLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQA 715
            QLK+MDSLVT+VS +ST+DEES MNMAIQRLYD+MQTDEVARRAILESR LTKKLEE+QA
Sbjct: 678  QLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQA 737

Query: 716  EKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXX 775
            E+D L EKLSKAE+GLVGQLE++L+ RD+ILAKNQRV QQL++                 
Sbjct: 738  ERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQE 797

Query: 776  XXXXXMLTILNTR----SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDF 831
                 MLTILN+R    SS N+G +  +      S LN  +  NIQKVLQDGL RAK D+
Sbjct: 798  VELRKMLTILNSRPEENSSINEGIRGKN------SSLNSSEKANIQKVLQDGLSRAKKDY 851

Query: 832  TIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXX 891
              D+KKFGMT+QPNKRLKMLRMQME+IENEARQLEMTNF EFE+  LEPP+++       
Sbjct: 852  KDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKK 911

Query: 892  XXXXXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKA 951
                     +  S  Q+  +NKLNDLR ALAEIQ ESN+ISKFN+EERVNELFNEKK  A
Sbjct: 912  IKHKDK---KLISRPQEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLA 968

Query: 952  LQRLKELETKYKDFGINFEMKDFLE----NKPNDGTKEGSTEEEYESLDPKIYEKKLDDI 1007
            L+RLKELETKYK FGI+F +++ +E    N  N+  ++G+    Y SLDP+ Y+ KLD+I
Sbjct: 969  LKRLKELETKYKGFGIDFNVEEIMESPKKNSANERKEDGAN---YSSLDPRTYQNKLDEI 1025

Query: 1008 DRLTEQLLNLQKT--QELRXXXXXXXXXXXXXXXXXXXXIFVAS-----SSSKPAGSGTR 1060
            +R+T+QLL+LQ    Q+                       F A      +S     SG+ 
Sbjct: 1026 NRITDQLLDLQAQTKQDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGSG 1085

Query: 1061 SFLETLSEKYGTGQKNVAMTATPNSRIV-------TQSEKQFLDRMRRS-STAAPFLQEL 1112
            SFL+ LS+KYGTGQ N       +S  V       ++ EK F++++R+S +++AP+L+EL
Sbjct: 1086 SFLDALSQKYGTGQNNTVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAPYLEEL 1145

Query: 1113 TEKV 1116
            T+KV
Sbjct: 1146 TQKV 1149

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/609 (66%), Positives = 481/609 (78%), Gaps = 15/609 (2%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPR  KK+KQLHWEK+++TDNSIW TGKAE+FADDL+EKGV ++LEKAFAARE+KSL
Sbjct: 1347 FEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1406

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            A+KRK+DL KITFLSRDISQQFGINLHMYSSLSV DLV KIL CDRDFL TPSV+EFLSK
Sbjct: 1407 ATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSK 1466

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            PEI EVSVNLARNY+PY+TDWEG+K+++DAKPPEKDPNDLQRADQIYLQLMVNL+ YW S
Sbjct: 1467 PEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1526

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRAL ++T+            RKVDKAVG+LQES+NLRNVFNVILAVGN+MNDTSKQAQ
Sbjct: 1527 RMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1586

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD+ NSMTFLNYVEKIIR+NYPSFN FL+ELEPVL+VVK+SIEQL N
Sbjct: 1587 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1646

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DC++F QS+ NVERS+EIGNLSDSSKFHPLD++L K LP LP+ RKKGDLL DEV LT+M
Sbjct: 1647 DCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIM 1706

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LM  YGED+ DKFA+ SFFKKFADFINEY+KAQ QN+        YE+HK++VEEQ
Sbjct: 1707 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQ 1766

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRT--DRRGTMDKLLEQLKNVGPSRADPSSARKRALA 1777
            Q++A+ +E +                  DRR  MDKLLEQLKN GP ++DPSSARKRAL 
Sbjct: 1767 QKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSDPSSARKRALV 1826

Query: 1778 RKKMLTDKEGTVNMMHDLETESDSIIYS-----PDNKAI----GSTPFGANGASSHKQNS 1828
            RK+ L+DK+ +  +++DL+ E  SI+YS     PD  A+      TP    G  +  ++ 
Sbjct: 1827 RKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESPTPLTTRGTLNIPEDL 1886

Query: 1829 NELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDL 1888
               S +    D   +EEIS+RAK LL  LRG+ +P K+NS+LDEH EKLRAR+ RT  + 
Sbjct: 1887 PSPSKASTLED---QEEISDRAKMLLKELRGSDTPVKQNSILDEHLEKLRARKERTIGEG 1943

Query: 1889 PSGSNKLKF 1897
             +G NKL F
Sbjct: 1944 SAG-NKLSF 1951

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1084 (55%), Positives = 742/1084 (68%), Gaps = 54/1084 (4%)

Query: 77   AITTTNKPLNKKSTLNTQNLSQYMDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLR--- 133
            + +T  +PLNKK+TLNTQNLSQYM+                               +   
Sbjct: 77   STSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASN 136

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            +L+RQHTGQ              N SKF TPDGK +LEMP DP E+E LFE+IMYKRNI 
Sbjct: 137  KLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIF 196

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXX 253
            Q+LS +KQ ELM+Y   KKWLIVKQD+QNE K+IRA       +S  ++    +      
Sbjct: 197  QSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIASDQHPILTAN 256

Query: 254  XXXXXXXXXXXXXXXXPMASVAS---NEYYPMTSPQTKKPTSH----------------- 293
                            P ++V S   N    ++S  T  P  H                 
Sbjct: 257  STLSSPKSALMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAGGLKKQPSLN 316

Query: 294  ELYQLT-ESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSF 352
             +Y+   E N S STL  D+TNRPP  YV++I+ADKL+ DEM+DLWVTLRTEQLDWVD+F
Sbjct: 317  SIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAF 376

Query: 353  LENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLM 412
            +++QGHIAMAN+LM  IYKT P++HL+ +LLEKENSFFKCF+VLSMLSQG+YEFS H+LM
Sbjct: 377  IDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLM 436

Query: 413  TDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKK 472
            TDT+A GLFST+L TRKMA EIFVCMLEK+NK+RFEA+L +LD+ FRIG N HM QN KK
Sbjct: 437  TDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKK 496

Query: 473  LPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWT 532
            +PQYF HLT +SHLK++QAWLF++E T+DGRGKMGSLVGAS + KN GGENAILEYC WT
Sbjct: 497  MPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWT 556

Query: 533  MVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFN 592
            MVF+N LC+ S  + QRMLLRTKLEN G LRIMNKIKLL+Y+KVID+IE Y+NNKLDDFN
Sbjct: 557  MVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFN 616

Query: 593  LMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTK 652
            + LE+ NK  NV+L+DP+SLL NLW+ CKGT+NEKLL+SL+QHLFLSSS+LIEE  +P+K
Sbjct: 617  VKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSK 676

Query: 653  LSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEE 712
            LSKQLKLMDSLVTNVS +STADEES MNMAIQRLYD+MQTDEVARRAILESRTLTKKLEE
Sbjct: 677  LSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEE 736

Query: 713  LQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXX 772
            +QAE+D L EKL KAE+GLVGQLEN+L+ RD+ILAKNQRV QQL+S              
Sbjct: 737  IQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKH 796

Query: 773  XXXXXXXXMLTILNTR----SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAK 828
                    MLTILN+R    S  + G K I+        LN  +  NIQKVLQDGL RAK
Sbjct: 797  QQEVELRKMLTILNSRPEESSDLSKGTKDIN------PSLNSSEKANIQKVLQDGLSRAK 850

Query: 829  NDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXX 888
             D+  D+KKFGMT+QPNKRLKMLRMQME+IENEARQLEMTNF EFE+++L          
Sbjct: 851  KDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERL---EPPIEIK 907

Query: 889  XXXXXXXXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKK 948
                      I +     Q + +NKLNDLR ALAEIQ ESN+ISKFN+EERVNELFNEKK
Sbjct: 908  KPKIKHKKHKIKKSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKK 967

Query: 949  LKALQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDID 1008
              AL+RLKELETKYK FGI+F +++F+E  P   + +   +  Y SLDPK Y+ KLD+I+
Sbjct: 968  SLALKRLKELETKYKGFGIDFNVEEFIET-PKKFSVDEENDAAYPSLDPKAYQSKLDEIN 1026

Query: 1009 RLTEQLLNLQKT--QELRXXXXXXXXXXXXXXXXXXXXIFVASSSSK---------PAGS 1057
            R+T++LL+LQ    QE                      I+  +S S+          AGS
Sbjct: 1027 RITDELLDLQTQVKQETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGS 1086

Query: 1058 GTRSFLETLSEKYGTGQKNVAMTATPNSR----IVTQSEKQFLDRMRRS-STAAPFLQEL 1112
            G  SFL+ LS+KYGTGQ   A     ++R    + +  EK F++R+R+S +++AP+L+EL
Sbjct: 1087 GPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEEL 1146

Query: 1113 TEKV 1116
            T+KV
Sbjct: 1147 TQKV 1150

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/607 (66%), Positives = 481/607 (79%), Gaps = 13/607 (2%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPR  KK+KQLHWEKI++TDNSIW +GKAE+FADDL+EKGV ++LEKAFAARE+KSL
Sbjct: 1345 FEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1404

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            A+KRK+DL K+TFLSRDISQQFGINLHMYSSLSV DLV KILKCDRDFL TPSV+EFLSK
Sbjct: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            PEITEVSVNLARNY+PY+TDWEG++ +EDAKPPEKDPNDLQRADQIYLQLMVNL+ YW S
Sbjct: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRAL ++T+            RKVD+AVG+LQES+NLRNVFNVILAVGN+MNDTSKQAQ
Sbjct: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD+ NSMTFLNYVEKIIR+NYPSFN FL+ELEPVL+VVK+SIEQL N
Sbjct: 1585 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DCK+F QS+ NVERS+EIGNLSDSSKFHPLD+VL K LP LP+ R+KGDLL DEV LT+M
Sbjct: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LMQ YGED+ DKFA+ SFFKKFADF+NEY++AQ QN+        YE+HK+MVEEQ
Sbjct: 1705 EFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARK 1779
            Q++A+ KE                  DRR  MDKLLEQLKN GP+++DPSSARKRAL RK
Sbjct: 1765 QKRAQDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALVRK 1824

Query: 1780 KMLTDKEGTVNMMHDLETESDSIIYSPDN---------KAIGSTPFGANGASSHKQNSNE 1830
            K ++DK+ +  +++DL  E  SI+YSP+           A   TP    G  +  ++   
Sbjct: 1825 KYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDLPS 1884

Query: 1831 LSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDLPS 1890
             S +    D   +EEI++RA+ LL  LRG+ +P K+NS+LDEH EKLRAR+ R N +  +
Sbjct: 1885 PSKASALED---QEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERANGETNT 1941

Query: 1891 GSNKLKF 1897
            G NKL F
Sbjct: 1942 G-NKLSF 1947

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 1078 bits (2789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1075 (52%), Positives = 733/1075 (68%), Gaps = 55/1075 (5%)

Query: 79   TTTNKPLNKKSTLNTQNLSQYMDHXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XLRRL 135
            T + KPLNKK++LNTQNLSQY++                                 L ++
Sbjct: 67   TNSLKPLNKKTSLNTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLNQI 126

Query: 136  SRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQN 195
            +RQHT Q            + N SKFI PDGK NLEMPRDP E+E LFE+IM KRNILQ+
Sbjct: 127  ARQHTNQSSASILSQGS--FTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQS 184

Query: 196  LSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKN---------------GPKNSSLV 240
            L  +KQ ELM+YD+ KKWLIVKQD+QNE K++R   N                P+NSS +
Sbjct: 185  LPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRSSMSPENSSTI 244

Query: 241  NVEQLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQLTE 300
            N+                           P+ +++     P+++P    P + ++Y+L+ 
Sbjct: 245  NLNSPATMQMSPHHHIGSNSNSSINSHHTPI-TISKRPTGPISNP---IPNA-DMYKLSM 299

Query: 301  SNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIA 360
             N S+S++S DKTNRPP  YV++IIAD ++ +EM+DLWVTLRTEQ+DWVD+F+E+QGHIA
Sbjct: 300  RNTSSSSMS-DKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIA 358

Query: 361  MANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGL 420
            MANILMK +YKT+     + +LLEKEN+FFKCF+VLSMLSQG+ EF++H++M+ T+ARGL
Sbjct: 359  MANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGL 418

Query: 421  FSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHL 480
            FS  L TR+MA EIFVCMLEK+N  RF+ ILN+LDQ F+IG N HM QN+K  P YF HL
Sbjct: 419  FSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHL 478

Query: 481  TPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLC 540
            T DS LKV QAWLF++E+T+DGRGKMGSLVGAS D KNSGGENAILEYC W+M+F+N LC
Sbjct: 479  TLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLC 538

Query: 541  NASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNK 600
            + S+ I QRMLLRTKLEN G LRIMNK+K L+Y+KVI++I+ YENNKLDD N +LES NK
Sbjct: 539  SCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNK 598

Query: 601  NSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLM 660
            N+N+NLQDP S+L NLW +CKGTENEKLLISL+QHLFLSSS+ IEE  DP KLS+QLKL+
Sbjct: 599  NANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLL 658

Query: 661  DSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLL 720
            DSLVTNVS SST D+E++MNMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE+QAE+DLL
Sbjct: 659  DSLVTNVSVSST-DQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLL 717

Query: 721  HEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXX 780
             +KL  AE+GLVGQL+++L +RD+IL+KNQRV +QLQ                       
Sbjct: 718  SQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRK 777

Query: 781  MLTILNTRSSTNDGAKTIDKDK-DNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFG 839
            MLTILN R    +G  T  K K  N S L+  K ++IQ+ LQDGL R K D+++DA+ FG
Sbjct: 778  MLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFG 837

Query: 840  MTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXXI 899
            MT+QPNKRLK+LRMQMEDIENEAR+LEMTNFTE+E++KLE P ++               
Sbjct: 838  MTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKK---------- 887

Query: 900  NQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELE 959
                  +    INKLNDLR+ LAEIQ ESN+ISKFN++ERVNELFN+K++ AL+RL++LE
Sbjct: 888  -VATKKEIDPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLE 946

Query: 960  TKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQ- 1018
            TKYKDFGI+F + + +++   D         +Y SLDPK Y++KLD+++RLT++LL ++ 
Sbjct: 947  TKYKDFGIDFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKN 1006

Query: 1019 ---------KTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAG--SGTRSFLETLS 1067
                      ++                       I    + S  +G  +G  SFLE L+
Sbjct: 1007 KVNASDNNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQSNFSGTSAGPGSFLEALT 1066

Query: 1068 EKYGTGQKNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVAPALSV 1122
            +KY TGQK    +A+P  +     +  F++R+++++ A PFL ELT+KVA A  V
Sbjct: 1067 QKYATGQK----SASPRDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPV 1117

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/659 (66%), Positives = 509/659 (77%), Gaps = 29/659 (4%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE YPR QKK+KQLHWEK++ TDNSIW T KAE+FADDL+EKGV ++LEKAFAARE+KSL
Sbjct: 1288 FENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSL 1347

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            ASK+K+DLDKI+FLSRDISQQFGINLHMY++L V+D+V KILKCDRDFLHTPSVIEFLSK
Sbjct: 1348 ASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSK 1407

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            PEI EVSVNLARNY+PY+TDWEG+KS+EDAK PEKDPN+LQRADQ+YLQL++NLQ YW S
Sbjct: 1408 PEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGS 1467

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRAL +ITT            RKVDKAV SLQESENL+NVFNVILAVGNYMNDTSKQAQ
Sbjct: 1468 RMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQ 1527

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKL+TLQRLTFIKDSTNSMTFLNYVEKI+R NYPSFN FL ELEPVL+VVKISIEQL +
Sbjct: 1528 GFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVS 1587

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DCKEF QS+ NVERS+E GNLSDSSKFHP DRVLAKVLP LPD RKKG+LL DEV LT+M
Sbjct: 1588 DCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIM 1647

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF  LMQ+YGED+ DKFA+NSFFKKFADFI EY+KAQ QNIK       YERHK+MVE+Q
Sbjct: 1648 EFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQ 1707

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARK 1779
            Q+K + +E                  DRR  MDKLL+QLKN GPS+ DPSSARKRAL RK
Sbjct: 1708 QKKLQEQENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLKNAGPSKTDPSSARKRALVRK 1767

Query: 1780 KMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGANG---------ASSHKQNSNE 1830
            K++T+   +  ++ D+ETE DSIIYSP+ K     P   +          +SS  Q S  
Sbjct: 1768 KLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDESEMDVSSSPIQRS-- 1822

Query: 1831 LSPSKG---FRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNND 1887
            LSPS+      DD  ++E+++RAK LLM LRG+ +PSKRNS+LDEHKEKLRARRR+TN+D
Sbjct: 1823 LSPSRNSTLLSDD--QDEVTDRAKALLMELRGSNTPSKRNSLLDEHKEKLRARRRKTNSD 1880

Query: 1888 LPSGSNKLKFYDTN--EKD---ISNEP----TEKSEQDEYRTEQSSQIVDEQTSDAKVD 1937
            L SG+ +L+F      EK+   I+ EP    TE  E     +E   ++  E   D K D
Sbjct: 1881 LHSGT-RLQFVGETVPEKEVEPITGEPDGTSTELEETSNLSSENQQKVDVESIEDEKAD 1938

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1062 (54%), Positives = 726/1062 (68%), Gaps = 57/1062 (5%)

Query: 83   KPLNKKSTLNTQNLSQYMD-------------HXXXXXXXXXXXXXXXXXXXXXXXXXXX 129
            +PLNKKSTLN+QNLSQY++             H                           
Sbjct: 75   RPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSS 134

Query: 130  XXLRRLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYK 189
                 L+R +T                N S+F+TPDGK NL MP DP E+E+LFE+IMYK
Sbjct: 135  MGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYK 194

Query: 190  RNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSP 249
            RNILQ+L  EKQ ELM+Y + KKWLIVKQD+QNEFKRI+A+  G   + + ++  L   P
Sbjct: 195  RNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGM-SMPDLGSDP 253

Query: 250  XXXXXXXXXXXXXXXXXXXXPMASVASNEY-------YPMTSPQTKKPTSHELYQLTESN 302
                                 + S A + Y        P++ P     TS ELY + E N
Sbjct: 254  SNSVSPPGPISSSGSSIFSSDVTSTAPSTYSRSGKKNIPISKPIA--ATSTELYHIAERN 311

Query: 303  ASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMA 362
             S+ST+ SDK NRPP  YV+KI+ DKLS DEM+DLWVTLRTEQLDWVD+FLENQGHIAMA
Sbjct: 312  TSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMA 371

Query: 363  NILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFS 422
            NILMK IYKTTPKD +S  LL+KEN+FFKCF+VL++LSQG++EF+ H LMTDTIA+GLFS
Sbjct: 372  NILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFS 431

Query: 423  TRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTP 482
             RL TRKMA EIFV +LEK+NK RFE++L+SLD+NF IG N HM ++ KKLPQYF HLT 
Sbjct: 432  GRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTS 491

Query: 483  DSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNA 542
            +S+LKV+QAWLF++E T+DGRGKMGSLVGAS D KN+GGENAILEYC WTMVF+N LC++
Sbjct: 492  NSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSS 551

Query: 543  STIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNS 602
            S  I QR LLR KLEN G LRIMNKIKLL+YEKVID+IE YENNKLDDFN +LES  KN 
Sbjct: 552  SENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNI 611

Query: 603  NVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDS 662
            NV+LQDPVSL+ NL  +CKGTENEK L+SL+QH+FL +S+L++E  DP K++KQLKLMDS
Sbjct: 612  NVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDS 671

Query: 663  LVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHE 722
            LVTNVS +ST +E S +NMAIQRLYDSMQTDEVARRAILESRTLTKKLEE++AE+D+L E
Sbjct: 672  LVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVE 730

Query: 723  KLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXML 782
            KLSKAE+GLVGQLE ++ ERD+ILAKNQRV +QL+S                      ML
Sbjct: 731  KLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKML 790

Query: 783  TILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTV 842
            TILN+R      AKT ++ K  I  +   + E++Q+ LQ GL +AK DF  D+KKFGMT+
Sbjct: 791  TILNSRP-----AKTKEQ-KKKIGSIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTI 844

Query: 843  QPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXXINQQ 902
            QPN+RLK+LRMQME IENEAR+LEMTNF E+E+K L+PP  V              +N++
Sbjct: 845  QPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANV-----QKKSKPISELNKE 899

Query: 903  ESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKY 962
            +      RI KLN+LR+ L  IQ ESN++SKFN++ERVNELFN+KK  ALQRLKELETKY
Sbjct: 900  Q------RIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKY 953

Query: 963  KDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLN----LQ 1018
            K FGI+F+++DF  ++  D + EG     Y SLDPK+Y+ KLD+I +++E+LL     L+
Sbjct: 954  KGFGIDFKVEDFT-HESTDSSNEG-----YSSLDPKVYQDKLDEITKISEELLQQKNELE 1007

Query: 1019 KTQELRXXXXXXXXXXXXXXXXXXXXIF----VASSSSKPAGSGTRSFLETLSEKYGTGQ 1074
             TQ                       +     +  +SS  +   + SFL+TL++KYGTGQ
Sbjct: 1008 TTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVSDLASGSFLDTLTQKYGTGQ 1067

Query: 1075 KNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKV 1116
                   +P      ++EK F+DRM+R+S    +++EL++K+
Sbjct: 1068 --AEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/653 (62%), Positives = 486/653 (74%), Gaps = 20/653 (3%)

Query: 1267 SANSTSSVPPPALPLM---GGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETTDN 1323
            S  S SS+PP A P+M     K              FE YPR QKK+KQLHWEK+E+TDN
Sbjct: 1220 STTSLSSIPP-APPMMTKDSKKKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDN 1278

Query: 1324 SIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGI 1383
            SIW + KAE+FADDL+EKGV S LEKAFAARE+KSLA+++K+DL KI+FLS DISQQFGI
Sbjct: 1279 SIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGI 1338

Query: 1384 NLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGL 1443
            NLHMYS+L+V   V K+LKC+RDF++TPSVIEFLSK EI EVS NLARNY+PY+TDWEG+
Sbjct: 1339 NLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGI 1398

Query: 1444 KSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXXXXXXRK 1503
            K IEDAK PEKDPN+LQRADQIYLQLMVNLQ YWASRMRA+++IT+             +
Sbjct: 1399 KKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHR 1458

Query: 1504 VDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLN 1563
            VDKAVGSLQ S+NL+N+FNVILAVGN+MND++KQA+GFKLSTLQRLTFIKD+ NSMTFLN
Sbjct: 1459 VDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLN 1518

Query: 1564 YVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDS 1623
            YVEKI+R NYP FN+FL ELEPVLEVVK+SIEQL NDC +F Q + NVERSIEIGNLSDS
Sbjct: 1519 YVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDS 1578

Query: 1624 SKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFK 1683
            SKFHPLD+VL KVLP L + RKKG+LL DE+ LT+MEF+ +MQ YGED  DKFA+ SFF+
Sbjct: 1579 SKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQ 1638

Query: 1684 KFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRKAERKEAK--XXXXXXXXXXXX 1741
            KFADFI EY+KAQ QNIKV     AYERHK+MVEEQQRKA+   +K              
Sbjct: 1639 KFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEE 1698

Query: 1742 XXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLETESDS 1801
                DRR  MDKLLEQLKN G  + DP+SARKRAL RKK+ + +E   + + +++   DS
Sbjct: 1699 EESEDRRAVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDS 1758

Query: 1802 IIYSPDNK--------AIGSTP-FGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKT 1852
            +IYSPD K            TP    +G     +NSN  SP K   +D   EEI +RAKT
Sbjct: 1759 LIYSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSNGESPLKKINED---EEIGDRAKT 1815

Query: 1853 LLMGLRGTASPSKRNSMLDEHKEKLRARRRRTN-NDLPSGSNKLKFYDTNEKD 1904
            LLM LRG+ +   RN+ LDEHKE+LRARR+RT+ N +PS SN+LKF D    D
Sbjct: 1816 LLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIPS-SNRLKFVDEKSPD 1867

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1097 (52%), Positives = 707/1097 (64%), Gaps = 79/1097 (7%)

Query: 83   KPLNKKSTLNTQNLSQYM------DHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRRLS 136
            KPL K +TLNTQNLSQY+      DH                              + L 
Sbjct: 79   KPLIKNTTLNTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQTNPSVTGYK-LD 137

Query: 137  RQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNL 196
            RQ+T Q            Y N SKF+T DGK NLEMP DP EIE L++EIM KRNILQ+L
Sbjct: 138  RQYTNQSSAVSVLSQGS-YSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSL 196

Query: 197  SVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXXXXX 256
               KQ ELM+YD+ KKWLIVKQD+QNE+K+ ++   G K S  +  +    +        
Sbjct: 197  PGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS--KGAKASHSIGPDNNNNNNNNYNNHL 254

Query: 257  XXXXXXXXXXXXXPMASV----------------ASNEYYPMTSPQTKKPTSH------- 293
                         P +++                 +N Y    +  +K+  S+       
Sbjct: 255  ILGSPSKSNNMISPKSNLNNFESPSSSLSASTQTTTNNYKQYNNKPSKRSASNISQPKST 314

Query: 294  -ELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSF 352
             E+Y  + SN+S +TL+ DKTNR P  YV+KII+D L+ +EM+DLWVTLRTEQLDWVD+F
Sbjct: 315  TEVYSNSHSNSSNTTLT-DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAF 373

Query: 353  LENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLM 412
            +E+QGHIAMAN+LMK IYKTTP + L+S+LLEKENSFFKCF+VLSMLSQG+ EF+KH+LM
Sbjct: 374  IEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELM 433

Query: 413  TDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKK 472
              TIARGLFST L TRKMA EIFVCML K+N  RF+ ILN LDQ F+IG N HM  NLKK
Sbjct: 434  AQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKK 493

Query: 473  LPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWT 532
              +YF  LT DS+LKV +AWLF++E+++DGRGKMGS VGAS D KNSGGENA LEYC W+
Sbjct: 494  FGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWS 553

Query: 533  MVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFN 592
            M+F+N LC  S  I QRMLLR KLE  G +RIMN+IK L+YEKVI++I+ YEN+KLDD N
Sbjct: 554  MIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDIN 613

Query: 593  LMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTK 652
             +LE  NKN+N+NL DP SL+ NLW +CKGTENEKLLISL+QHLFLSSS+LIE+  D T+
Sbjct: 614  KLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQ 673

Query: 653  LSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEE 712
            LSKQLKLMDSLVTNVS +ST D+ESTMNMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE
Sbjct: 674  LSKQLKLMDSLVTNVSVAST-DQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEE 732

Query: 713  LQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXX 772
             QAE DLL +KL  AE+GLVGQL+++L +RD++ AKNQR+T+QLQ+              
Sbjct: 733  SQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKH 792

Query: 773  XXXXXXXXMLTILNTRSSTNDGAKTIDKDKDNI-SKLNLQKHENIQKVLQDGLIRAKNDF 831
                    MLTILN RS   +  K   K    I       K +NIQKVLQ+GL R K DF
Sbjct: 793  EQEVELRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDF 852

Query: 832  TIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXX 891
            T+D+K FGMTVQPNKRLK LRMQMEDIENEAR+LEMTNF EFE+KKLEP  ++       
Sbjct: 853  TMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKK 912

Query: 892  XXXXXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKA 951
                     + E  ++  +I KLN+LR+ LA IQ ESN+ISKFN+EERVNELFNEK+  A
Sbjct: 913  QN-------KNEKKEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTA 965

Query: 952  LQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLT 1011
            LQRLKELETKYKDFGINF + D  E K       G    EY SLDP  Y+ KLD+++R+T
Sbjct: 966  LQRLKELETKYKDFGINFNIDDISE-KTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRIT 1024

Query: 1012 EQLLNLQKT---QELRXXXXXXXXXXXX------------------------XXXXXXXX 1044
            EQLL+ Q     + L+                                            
Sbjct: 1025 EQLLDAQAKLNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSE 1084

Query: 1045 IFVASSSSKPAGSGTRSFLETLSEKYGTGQKNVAMTATPNSRIVTQSEKQFLDRMRRSST 1104
            I   S+SS  AGS    FLE LS+KY  GQ N +  +    R V  S+  F++R+R+++ 
Sbjct: 1085 ISAQSTSS-AAGS----FLEALSQKYAMGQNNPS--SPQRDRPVKASQYDFINRVRKNNI 1137

Query: 1105 AAPFLQELTEKVAPALS 1121
               FL+EL+ KV P  S
Sbjct: 1138 TPQFLEELSGKVVPPSS 1154

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/635 (65%), Positives = 484/635 (76%), Gaps = 15/635 (2%)

Query: 1279 LPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDL 1338
            LP  G K              FE YPR  KK+KQLHWEK+E TDNSIW   KAE+FADDL
Sbjct: 1325 LPTNGPKKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDL 1384

Query: 1339 FEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVT 1398
            +EKGV S LE AFAARE+KSLASK+K DL KITFLS D+SQQFGINLHMY+SL V DL+T
Sbjct: 1385 YEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLIT 1444

Query: 1399 KILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPND 1458
            KILKCDRDFL TPSVIEFLS+PEI +VSVNLARNY+PY  DWEG+K++EDAKPPEK+PN+
Sbjct: 1445 KILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNE 1504

Query: 1459 LQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLR 1518
            LQRADQIYLQLMVNLQ YW SRMRALK+ITT            RKVD+AV SLQESENL+
Sbjct: 1505 LQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLK 1564

Query: 1519 NVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNS 1578
            NVF VILAVGNYMNDTSKQAQGFKL+TLQRLTFIKDSTN+MTFLNYVEKI+R NYP+FN 
Sbjct: 1565 NVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNK 1624

Query: 1579 FLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLP 1638
            FL ELEPVL+VVKISIEQL +DCKEF QS+ NVERSIEIGNLSDSSKFHP DRVLAKVLP
Sbjct: 1625 FLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLP 1684

Query: 1639 TLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQ 1698
            +LPD RKKG+LL DEV LT+MEF  LMQ+YGED+ DKFA+NSFFKKFADFI EY+KAQ Q
Sbjct: 1685 SLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQ 1744

Query: 1699 NIKVXXXXXAYERHKRMVEEQQRKAERKE-AKXXXXXXXXXXXXXXRTDRRGTMDKLLEQ 1757
            N+++      YERHK+MVEEQQRKA+  E ++                D R  MD LLEQ
Sbjct: 1745 NLRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQ 1804

Query: 1758 LKNVGPS-RADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPD-NKAIGSTP 1815
            LKNV P+ + DPSSARKRAL RKK++   E T N++ D++TE DSIIYSPD  K + +T 
Sbjct: 1805 LKNVTPTNKTDPSSARKRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTV 1862

Query: 1816 FGANG--------ASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRN 1867
              AN         +S  + NS+ +        D  EEEI  RA+ LL+ L G+ SP+KR+
Sbjct: 1863 DMANTTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRH 1922

Query: 1868 SMLDEHKEKLRARRRRTNNDLPSGSNKLKFYDTNE 1902
            S+L+EHKE+LRARRRRT N+  SG  KL+F   +E
Sbjct: 1923 SLLNEHKERLRARRRRTTNEFVSG--KLQFVGEDE 1955

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1085 (50%), Positives = 714/1085 (65%), Gaps = 66/1085 (6%)

Query: 83   KPLNKKSTLNTQNLSQYMDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLR--------- 133
            KPL+KK+T+N+QNLS Y                                           
Sbjct: 152  KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSYTSPSRRSS 211

Query: 134  ---RLSRQHTGQXXXXXXXXXXXXYINFSKFITP-DGKTNLEMPRDPKEIENLFEEIMYK 189
               +L++ HT Q               +++FI+P DGK  LEMP DP E+E L+E+IMYK
Sbjct: 212  SDAKLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIMYK 271

Query: 190  RNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIR----ATKNGPKNSSLVNVEQL 245
            RNILQNL  +KQ ELMNYDV+KKWLIVKQD+QNE K+++    + +   +++  +N++  
Sbjct: 272  RNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKTSSHQQTVQSAPFMNLQDT 331

Query: 246  VYSPXX-----XXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPT------SHE 294
              S                            AS+ S+    +  P  +K         H 
Sbjct: 332  SSSASLPGQGFHDQQSVVSETSSRVPTTNDAASILSSATPSLRHPSRRKQQYTLTNKQHT 391

Query: 295  LYQL---TESNASTS-TLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVD 350
            +Y      E +AS+S TL+SDKTNR P  YV+KIIAD+LS DE+ DLWVTLRTEQLDWVD
Sbjct: 392  VYPANGTAERHASSSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVD 451

Query: 351  SFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHK 410
            +FL+NQGHIAMAN+LMK +YKT+P   LS  LL+KE S+FKCFKVLSML+QG+ EF+ H+
Sbjct: 452  AFLDNQGHIAMANVLMKSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHR 511

Query: 411  LMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNL 470
            L+TDTIARGLFS+RL TRKMA EIFVCMLE +N++RF+A++ SLDQNF+IGSN HM  NL
Sbjct: 512  LITDTIARGLFSSRLPTRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNL 571

Query: 471  KKLPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCL 530
            +K+P YFIHL   S LKV+QAWLF+I+ T+DGRGKMGSLVGAS + K   GEN++LEYC 
Sbjct: 572  QKMPDYFIHLNLQSTLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQ 631

Query: 531  WTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDD 590
            WT+VFVN  C +S  + QRMLLRTKLEN+GFLRIMNK+KLL+YEK+ D+IE YE  KLDD
Sbjct: 632  WTLVFVNKFCQSSNNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDD 691

Query: 591  FNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDP 650
            FN +LES+NK++N+++Q+P+SLL NLW +C+GT++E LL+SL+QHLFLSS+RLI+   DP
Sbjct: 692  FNSLLESQNKHANIDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDP 751

Query: 651  TKLSKQLKLMDSLVTNVSS--SSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTK 708
            T+L+KQLKL+DSLVTNV S  S+ ADEE+TM+M IQRL+DSMQTDEVARRAI+ESRTLTK
Sbjct: 752  TQLAKQLKLIDSLVTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTK 811

Query: 709  KLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXX 768
            K+EELQAEKD L +KLSKAE GLVG+L+ D+ ERD ILAKNQRV +QL++          
Sbjct: 812  KMEELQAEKDRLGDKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTL 871

Query: 769  XXXXXXXXXXXXMLTILNTRSSTN---DGAKTIDKDKDNISKLNL--QKHENIQKVLQDG 823
                        MLTI+N+++S N   + + ++ K  D  +K +L  ++   IQKVLQDG
Sbjct: 872  MEKHEHEVELRKMLTIINSKASPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDG 931

Query: 824  LIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVE 883
            L R K DFT DAKKFGMTVQPNKRL++LRM++EDIENEARQLEMTNF + E+     PV 
Sbjct: 932  LTRTKKDFTNDAKKFGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNAT--PVI 989

Query: 884  VTXXXXXXXXXXXXXINQ----QESN--DQKSRINKLNDLREALAEIQTESNNISKFNLE 937
            +T               Q    Q +N  ++  +I  LN LR AL  IQ+ESN+ISKFN+E
Sbjct: 990  LTKGTKKKKSKKKLKTAQPDKKQRANQRNENQKIEALNKLRMALTAIQSESNDISKFNVE 1049

Query: 938  ERVNELFNEKKLKALQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDP 997
            E VNELF E+K KALQRL++LE+K+     NF + D + +     T   +T++ Y SLDP
Sbjct: 1050 EHVNELFTERKFKALQRLRDLESKFNGLNTNFNIDDIIASTEKALT---ATDDGY-SLDP 1105

Query: 998  KIYEKKLDDIDRLTEQLLNLQ---KTQE---LRXXXXXXXXXXXXXXXXXXXXIFVASSS 1051
            +  + KLD+I+RLT  L  L    K QE   L+                       +  S
Sbjct: 1106 RRADNKLDEIERLTNDLSKLHDSMKEQEQATLQSDNSSESSDSESVESDNEGSTVQSDVS 1165

Query: 1052 SKPAGSGTRSFLETLSEKYGTGQKNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQE 1111
                GSG  SFL +LS+KY TGQK       PNS  VT ++K F+ R++RSS A  +LQE
Sbjct: 1166 EPTVGSG--SFLASLSQKYETGQKQ------PNSP-VTVNQKAFMTRLKRSSGAPLYLQE 1216

Query: 1112 LTEKV 1116
            L++K+
Sbjct: 1217 LSKKI 1221

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/667 (61%), Positives = 501/667 (75%), Gaps = 48/667 (7%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPR QKK+KQLHWEK+++T+NSIW+  KAE+FADDL+EKGV SNLEKAFAAREVKSL
Sbjct: 1373 FEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSL 1432

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            +SK+ DD  KITFL+RD+SQQFGINLHM+ +LSVE+LVTKILKCDR+ L++PSVIEFLSK
Sbjct: 1433 SSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSK 1491

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             E+ EVSVNLARNYSPY+TDWEG+K IEDAK PEKDPN+LQRADQ+Y+ LMVNLQPYW+S
Sbjct: 1492 QEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSS 1551

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRALK+ITT            RKVDKAVGSLQ+SENL+NV NVILAVGNYMNDTSKQAQ
Sbjct: 1552 RMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQ 1611

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKL+TLQRLTFIKD+TNSMTFLNYVEKI+R NYP+FN FL EL+PVL+VVKISI+QL +
Sbjct: 1612 GFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVS 1671

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DC+EF  SV NVERSIEIGNLSDSSKFHP DRVL KVLP LP+ RKK DLL DEV LT++
Sbjct: 1672 DCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTML 1731

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LMQ YGED++DKFA+NSFFKKFADFI EY+KAQ QN+        YERHK++VEEQ
Sbjct: 1732 EFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQ 1791

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRT--------DRRGTMDKLLEQLKNVGPSRADPSSA 1771
            QR+ E  EA+               T        DRR  MDKLLEQLKN G  +ADPSSA
Sbjct: 1792 QRQGE--EARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSA 1849

Query: 1772 RKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDNK------AIGSTPFGAN---GAS 1822
            RKRALAR+K+L DK+    ++HD++T+ DS++YSPD K       IG +P   +   G++
Sbjct: 1850 RKRALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIGGSPTPGDKLLGST 1909

Query: 1823 SHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGT-ASPSKRNSMLDEHKEKLRARR 1881
              K+ S   SP+ G +DD   E++++RAK LLM LRG  +SP K+N+ LDE  ++ R R 
Sbjct: 1910 PTKELS---SPTAG-QDD---EDVTDRAKALLMELRGGQSSPMKKNAFLDE--QRERIRS 1960

Query: 1882 RRTNNDLPS-----GSNKLKFYDTNEKDISNEPTEKSEQDEYRTEQSSQIVDEQTSDAK- 1935
            RR  N+L       G NKL F++            ++E  E   +  +     QT+DA  
Sbjct: 1961 RRRRNELAGTEPLRGGNKLSFFEA-----------ETETSETAHDADNDTTKGQTADASD 2009

Query: 1936 -VDSTDE 1941
             +DS D+
Sbjct: 2010 NLDSNDQ 2016

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1080 (49%), Positives = 697/1080 (64%), Gaps = 51/1080 (4%)

Query: 79   TTTNKPLNKKSTLNTQNLSQYMDHXX------------XXXXXXXXXXXXXXXXXXXXXX 126
            +T  +PLNKKSTLNTQNLSQY+                                      
Sbjct: 59   STELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRS 118

Query: 127  XXXXXLRRLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEI 186
                   +LSRQ T Q            Y N  K+I  DGK NLEMPRDP E+E LFE++
Sbjct: 119  STATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFEDL 178

Query: 187  MYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRI--RATKNGPKNSSLVNVE- 243
            MYKRNI Q L  +KQ+ELM+YDV KKW +VKQD+QNE K++  +++   P   S  +   
Sbjct: 179  MYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEGSYSSASN 238

Query: 244  ------------------QLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSP 285
                              Q   SP                            +  P+ S 
Sbjct: 239  SNGNLNSYSSSLRSSATSQDSNSPQTAIFTSNSGTMQNNTINLNNGNIPVGGKSRPVGSS 298

Query: 286  QTKKPTSHELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQ 345
             T   T+  +YQ +E+N S S++++D+ NRPP  YV+KIIAD+L+ +EM DLWVTLRTEQ
Sbjct: 299  STASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQ 358

Query: 346  LDWVDSFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYE 405
            LDWVD+FLE+QGHIAMAN+LM  IYK  P   L+ +L EKE+SFFKCF+VLSMLSQG+YE
Sbjct: 359  LDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYE 418

Query: 406  FSKHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFH 465
            F+KHKLM+DTIA GLFS+RL TRKMA E+ VCM+EKRN  RFE +L SLD+ FR   N +
Sbjct: 419  FAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLN 478

Query: 466  MFQNLKKLPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAI 525
            M    K LP  +   TP++  K++QAWL +++ T++GRGKMGSLVGAS D + S GENAI
Sbjct: 479  MVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAI 537

Query: 526  LEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYEN 585
            LEYCLWTMVF+N LC+ S+++ QR+LLRTKLEN G LRIM K+K L+YEK+ ++IE Y+N
Sbjct: 538  LEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDN 597

Query: 586  NKLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIE 645
            NKLDDFN +LE+++KNS VN+Q+P SL+ NLW+SCKG++NEKLL+SLIQHL+LSSS+L+ 
Sbjct: 598  NKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMG 657

Query: 646  EVDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRT 705
            E +DPTKLSKQLKL+DSL+TNV + S  DEES MN+AIQRLYDSMQTDEVARRAILESRT
Sbjct: 658  EKEDPTKLSKQLKLIDSLLTNV-NGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRT 716

Query: 706  LTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXX 765
            LTKKLEE  AE+D L  KLS AENGLVGQLE+DL +RD IL KNQRV +QL+S       
Sbjct: 717  LTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQLESELEDLKK 776

Query: 766  XXXXXXXXXXXXXXXMLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLI 825
                           MLTILN+R    +G +  D D   I+ L+  K  +IQK L+  L 
Sbjct: 777  KHLLEKHEHEVELRKMLTILNSR----NGTQNPDVDDVTIT-LDPNKKLDIQKALELELN 831

Query: 826  RAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVT 885
            + K D + D+K+FG+TVQPNKRLKMLRMQMEDIENEARQLEMTNF + +R  L+ PV V 
Sbjct: 832  KTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVK 891

Query: 886  XXXXXXXXXXXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFN 945
                             + N+ K++  KL  LR+ALA IQ+E+N+ISKFN+E RVNE+F 
Sbjct: 892  KEKKLRKKKKINTEEFDKENEMKTK--KLMQLRKALAAIQSETNDISKFNVEGRVNEMFQ 949

Query: 946  EKKLKALQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLD 1005
            +KKLKALQRLK+LE KYKDF I F   D L++      +E   E+++ +LDP   +KK++
Sbjct: 950  DKKLKALQRLKQLEAKYKDFEIPF---DELQDL---DDRELDDEQQHSTLDPTYLQKKIN 1003

Query: 1006 DIDRLTEQLLNLQKTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLET 1065
            ++D ++++L  +    +                      +   S++     S   SFLE+
Sbjct: 1004 ELDEISDELYLMNYDSDANNGNTSDSSSSSEADGDGTDSMRSVSNAPSKGISEAGSFLES 1063

Query: 1066 LSEKYGTGQKNVA---MTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVAPALSV 1122
            LS+KYGTGQ  ++      +PN RI +Q EK F++R++R + AAPFL+ELT+KV    S+
Sbjct: 1064 LSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQKVNDTSSI 1123

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/634 (61%), Positives = 476/634 (75%), Gaps = 33/634 (5%)

Query: 1301 ERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLA 1360
            +R PR QKK+KQLHW+K+++TD+SIW+ G AERFADDL+EKGV  NLEKAFAARE+KS+ 
Sbjct: 1269 DRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIG 1328

Query: 1361 SKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKP 1420
            +++K+DL KI+FLS DISQQFGINLHMY SL+V +L+ K+LKCDR+ ++TPSVIEFL+K 
Sbjct: 1329 TRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388

Query: 1421 EITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQI-YLQL------MVNL 1473
            EI EVSVNLARNY+PYTTDWEG+KS++  K         QR  Q+ Y +L      MVNL
Sbjct: 1389 EIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELIKFIYNMVNL 1440

Query: 1474 QPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMND 1533
            Q YWASRMRALK+IT+            RKVDKAVG++Q SENL+NVFNVILAVGNYMND
Sbjct: 1441 QSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMND 1500

Query: 1534 TSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKIS 1593
            TSKQAQGFKLSTLQRLTFIKD+TNSMTFLNYVEKI+R NYPSFN F+ +LEPVL+VVK+S
Sbjct: 1501 TSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLS 1560

Query: 1594 IEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDE 1653
            +EQL +DC EF QS+ NVERS+EIGNLSDSSKFHP D+VL KVLP LP+  KK  LL DE
Sbjct: 1561 VEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDE 1620

Query: 1654 VNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHK 1713
            V LT+MEF+ LM+ YGED  DKFA+NSFFKKFADFI EY+KAQ QN+K      AYE+HK
Sbjct: 1621 VKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHK 1680

Query: 1714 RMVEEQQRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARK 1773
            RM+EEQQ K + +E +              ++DRR  MDKLLE+LKN GP +ADPSSARK
Sbjct: 1681 RMIEEQQHKQDLEEER---SREVEGEPGEEQSDRRAMMDKLLEKLKNAGPGKADPSSARK 1737

Query: 1774 RALARKKMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNEL-- 1831
            RAL RKK+LTDKE T +++ D++T  DSI+YSP N      P   + AS      ++L  
Sbjct: 1738 RALVRKKLLTDKEVTAHILQDIDTGDDSIVYSP-NTPTQEGPNDIHLASPTPSGKSDLVL 1796

Query: 1832 ---SPSK-GFRDDLSEEE-ISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRAR--RRRT 1884
               SP+K    D ++E+E IS+RAK LL+ LRG+ +  KRNS L+E KEKL+AR  RRRT
Sbjct: 1797 ASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNSQLEEQKEKLKARRSRRRT 1855

Query: 1885 NNDLPSGSNKLKFYDTNEKDISNEPTEKSEQDEY 1918
              +  S SNKL F  T+E+  S  P+E S+  EY
Sbjct: 1856 QTESIS-SNKLFF--TDEESHSTSPSE-SKGTEY 1885

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1064 (49%), Positives = 686/1064 (64%), Gaps = 49/1064 (4%)

Query: 83   KPLNKKSTLNTQNLSQYMDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRRLS------ 136
            +PLNKKST+NTQNLS YM+                                 LS      
Sbjct: 70   RPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQSSTKYTYSRRSSSHLSTPGVNS 129

Query: 137  ---RQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
               R+ T Q            + N + F+TPDGK  L+MP    E+ENLFE++MYKRNIL
Sbjct: 130  TLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMP-SSHEVENLFEDMMYKRNIL 188

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQL-------- 245
            QNLS +KQ+ELM+YDV KKWLIVKQD+QN+FK++ A K  P   + ++            
Sbjct: 189  QNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA-KGVPAAHAAISSSNSDSLPSSLK 247

Query: 246  VYSPXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQLTESNAST 305
            V SP                       ++  N+    +S         +L QL++ N+ST
Sbjct: 248  VSSPRSSMTYESIQQ------------AIKFNKTNNGSSSGPASNNKSKLQQLSDKNSST 295

Query: 306  STLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANIL 365
            STL+++K NRPP  YV++IIADKL+ +EM DLWVTLRTEQLDWVD FLE+QGHIAMAN+L
Sbjct: 296  STLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVL 355

Query: 366  MKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRL 425
               IYKT P+  LS  LLEKE++FF+CF+VLS+L+QG+YE S+H +M +T+A GLFS RL
Sbjct: 356  TTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRL 415

Query: 426  GTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSH 485
             TRKMA EIFVCMLEK+NK RFEA+LN+LD+ F+IG N HM   +K  PQ+F H T DS 
Sbjct: 416  ATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQ 475

Query: 486  LKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTI 545
             K++Q+WLF++E +++GRGKMGSLVGAS D K SGGENAILEY  WTMVF+N  CN + +
Sbjct: 476  FKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDV 535

Query: 546  IQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVN 605
            I QR+LLRT+LEN+G LRIMN+ KLL+Y+KV++ +E+YEN KLDD N +LE+    S+++
Sbjct: 536  INQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDID 595

Query: 606  LQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVT 665
            + D  SLL  L+  CKGTE+EKLL SL++HLFLS+SRL+E+  DPTKLSKQL+LMDSLVT
Sbjct: 596  MNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVT 655

Query: 666  NVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLS 725
            NVS S+  DE S++NMAIQRLYDSMQTDEVARRAILESRTLTKKLEE QAE+D L +KLS
Sbjct: 656  NVSVSAV-DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLS 714

Query: 726  KAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXMLTIL 785
            K  NGLVGQLE ++ +RD IL KNQRVT QLQ                       MLTIL
Sbjct: 715  KTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTIL 774

Query: 786  NTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPN 845
            N+R   +   K     K     L+  K   IQ+ LQDGL++ K D ++D+K+FG+TVQPN
Sbjct: 775  NSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPN 834

Query: 846  KRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXXINQQESN 905
            KRLKMLR+QMEDIE EAR+LEMTNF +  +  L+ PV+V                + E  
Sbjct: 835  KRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRK--------ENELR 886

Query: 906  DQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKYKDF 965
             ++ + NKL++LR+ALA+IQ ESN +SKFN+EERVNELF +KKL AL RL +LE  YK++
Sbjct: 887  AKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEY 946

Query: 966  GINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQKTQELRX 1025
            GI+      ++++P +  +     E   +LDP+ Y+ KLD+IDR++++L+ ++   EL+ 
Sbjct: 947  GIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMK--SELKN 1004

Query: 1026 XXXXXXXXXXXXXXXXXXXIFVASS--SSKPAGSGTRSFLETLSEKYGTGQKNVAMTATP 1083
                               I    S  +     SGT SFLE+LS+KYGTG+    M    
Sbjct: 1005 DKALRRHESPSKQDTDDDEIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTND 1064

Query: 1084 ---NSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKV--APALSV 1122
               +S     S + F++RM++ S    +L+EL  KV  AP L V
Sbjct: 1065 ILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGV 1108

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/623 (63%), Positives = 484/623 (77%), Gaps = 29/623 (4%)

Query: 1272 SSVPPPALPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETTDNSIWTTGKA 1331
            ++VP P LP                   F  YPR++KK+KQLHWEK++ TDNSIW++GKA
Sbjct: 1237 TAVPSPLLP--------------QSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKA 1282

Query: 1332 ERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSL 1391
            E+FA DL+EKGV  +LEKAFAARE+KSLA+K+++DLDKITFLSRD+SQQFGINLHMYS L
Sbjct: 1283 EKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQL 1342

Query: 1392 SVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKP 1451
            SVE+LVTKILKC+RDF+ TPSV+EFLSKPEI EVS NLARNYSPY+TDW+G+  +EDAK 
Sbjct: 1343 SVEELVTKILKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKS 1402

Query: 1452 PEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSL 1511
            PEKDP +LQRADQ+YLQL+ NLQPYW SRMRAL++IT+            RKVDKAV  +
Sbjct: 1403 PEKDPAELQRADQLYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVI 1462

Query: 1512 QESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRM 1571
            Q+S NLRNVFNVILAVGNYMND++KQAQGFKLSTLQRLTFIKD+ NSMTFLNYVEKI+R 
Sbjct: 1463 QKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRD 1522

Query: 1572 NYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDR 1631
            NYPSFN FL++L+PVL+VVKISIEQL +DCKEF QS+TNVERSI+IGNL+DSSKFHPLD+
Sbjct: 1523 NYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDK 1582

Query: 1632 VLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINE 1691
            VL KVLP LP+  K+ +LL++EV L++MEF+ LMQ YGED++DKFA+NSFFKKFADFINE
Sbjct: 1583 VLVKVLPVLPEASKRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINE 1642

Query: 1692 YRKAQEQNIKVXXXXXAYERHKRMVEEQQRKAERKEAKXXXXXXXXXXXXXXRTDRRGTM 1751
            Y++AQ QN+K       Y+ HK+MVEEQQ++AE KE                  DRR  M
Sbjct: 1643 YKRAQAQNLKAEEEERLYQTHKKMVEEQQKRAEEKE---RSENATEEDASEENEDRRAMM 1699

Query: 1752 DKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDNKAI 1811
            DKLLEQLKN GP +ADP SARKRA+ RKKML D E   +++  ++ E DS+IYSP+ +  
Sbjct: 1700 DKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPEKQEG 1759

Query: 1812 GSTPFGANGASSHKQNSNELSPSKGFRDDLS-EEEISERAKTLLMGLRGTASPSKRNSML 1870
             + P G +            SPSKG  ++   EEEI++RAK LLMGLRG  SPSKRN++L
Sbjct: 1760 ITNPTGDSSQ----------SPSKGAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVL 1809

Query: 1871 DEHKEKLRARRRRTNNDL-PSGS 1892
            + HKEKLRARRR+TN D+ P GS
Sbjct: 1810 NGHKEKLRARRRKTNTDMSPEGS 1832

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1009 (48%), Positives = 660/1009 (65%), Gaps = 69/1009 (6%)

Query: 134  RLSRQ-----HTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMY 188
            +LSRQ     H                 N  +F+ PDGK  L+MP+D  E+E+LFE+IMY
Sbjct: 140  QLSRQQTNHSHANSQSSAASVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMY 199

Query: 189  KRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYS 248
            KRNI+Q L  EKQ+EL NYD+ KKWLIV+QD+ ++ K++ A  +     +  N   L  +
Sbjct: 200  KRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSDLKKMMAKSSSSATQASANTTDLSLT 259

Query: 249  PXXXXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQ------TKKPTSHELYQLTESN 302
                                    +++S++Y   TS +      + K  +  LY    +N
Sbjct: 260  -----------------------NTISSHDYSDATSIRHMKTNASSKSLNSNLYSNANAN 296

Query: 303  ASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMA 362
            +S +T++++K NRPP  YV+KIIAD L+ DE+ DLWVTLRTEQLDWVD+FLE+QGHIAMA
Sbjct: 297  SSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMA 356

Query: 363  NILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFS 422
            N+LMK +YKTT +  L+ K LE+E S+FKCF+VL ML+QG+YEF+KH +M +T+A  LFS
Sbjct: 357  NVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFS 416

Query: 423  TRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTP 482
             RL TRKMA EIFVCMLEK+NKSRF+ IL +LD+ F IG N HM Q +K  PQ FIHL  
Sbjct: 417  IRLPTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKR 476

Query: 483  DSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNA 542
            DS  K++QAWL  +E  + GRGKMGSLVGAS +++ +GGEN+ILEY  WTMVF+N LC  
Sbjct: 477  DSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMG 536

Query: 543  STIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNS 602
            + ++ QR+LLRT+LEN+G LRIMN+ KLL+Y+K+  +IE YEN KLDD N +LES+ +N+
Sbjct: 537  TDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNT 596

Query: 603  NVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDS 662
             VN+QDP+ +L  +W  CKGTENEK  ISLI+HLFLSSS++ ++  DP+KL+KQLKLMDS
Sbjct: 597  QVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDS 656

Query: 663  LVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHE 722
            LV NVS S+  DEES++N+AIQRLYD+MQTDEVARRAILESR LTK+LEE+QAE+D L +
Sbjct: 657  LVANVSVSA-VDEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQ 715

Query: 723  KLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXML 782
            KL+   +G+VG+LE +L +RD ILAKNQRV + LQ+                      ML
Sbjct: 716  KLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKML 775

Query: 783  TILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTV 842
            TILN R    + AK+    K +++ L+  +  +IQK LQDGL R + D ++D+K+FG+TV
Sbjct: 776  TILNARPDDENLAKSTKVTK-SVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITV 834

Query: 843  QPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXXINQQ 902
            QPNKRL+MLRM+ME IE EAR+LEMTNF E E K+LE PV                    
Sbjct: 835  QPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGT------------------ 876

Query: 903  ESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKY 962
                +K+ + KL++LR+ L++IQ E+N ++KFN+EERV ELFN+K+LKAL+RLKELET Y
Sbjct: 877  -GTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRLKELETTY 935

Query: 963  KDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQL------LN 1016
            K FGI+F     LE+K   G      ++E +  D +  ++K+D++DR+  +L      + 
Sbjct: 936  KGFGIDFNANALLESK---GGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVE 992

Query: 1017 LQKTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLETLSEKYGTGQKN 1076
            +Q  Q+                         +  S K  GSG  SFLE LS+KYG GQ N
Sbjct: 993  IQNQQQHTDSSSTESSSEDDDGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQ-N 1051

Query: 1077 VAMTATPNSRIVTQSEKQ---FLDRMRRSSTAAPFLQELTEKVAPALSV 1122
              ++ +P   +  +S      F +RM++S+ A P+  ELT KVA A S+
Sbjct: 1052 TTISNSPFPGVDRKSSNHRTSFANRMKKSN-ATPYFDELTRKVAKAPSL 1099

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/613 (64%), Positives = 472/613 (76%), Gaps = 17/613 (2%)

Query: 1303 YPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASK 1362
            YP+  KK+KQLHWEK++ T++SIW++G AE+FA DL+EKGV + LEKAFAARE+K+LA+K
Sbjct: 1259 YPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATK 1318

Query: 1363 RKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEI 1422
            +K+DL KITFLS D SQQFGINLHMYS +SV DLV KILKCDRDF+ TPSVIEFLSK EI
Sbjct: 1319 KKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEI 1378

Query: 1423 TEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMR 1482
            TEVSVNLARN+SPY+TDW+G+KS+EDAKPPEKDPNDLQRADQIYLQL+ NLQ YW SRMR
Sbjct: 1379 TEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMR 1438

Query: 1483 ALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFK 1542
            A+K+IT+            RKVDKAVG++ +SENL N+FNVILAVGN+MNDT+K+AQGFK
Sbjct: 1439 AIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFK 1498

Query: 1543 LSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCK 1602
            LSTLQRLTFIKD+ NSMTFLNYVEKIIR NYPSFN FL+ELEPVL V KISI+QL NDC 
Sbjct: 1499 LSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCN 1558

Query: 1603 EFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFD 1662
            E+ Q+VTNVERSIEIGNLSDSSKFHPLDRVL KVLP LP+ RKK DLL+DEV L++MEF+
Sbjct: 1559 EYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFE 1618

Query: 1663 GLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRK 1722
             LMQ YGEDT DKFA+NSFFKKFADF+ EY+KAQ QN+KV      YERHK+MVEEQQR+
Sbjct: 1619 NLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRR 1678

Query: 1723 AER-KEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARKKM 1781
             +   + +                DRR  MDKLL+QLKN GP+ +DPSSARKRAL R+K+
Sbjct: 1679 EQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSDPSSARKRALMRRKL 1738

Query: 1782 LTDKEGTVNMMHDLETESDSIIYSP----DNKAIGSTPFGANGASSHKQNSNEL----SP 1833
              DK+   +++ DL++  DSI+YSP    D  A            S+K N   L    SP
Sbjct: 1739 QADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPTVHKGSNKNNKPVLSDLESP 1798

Query: 1834 SKGFRD-----DLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRT--NN 1886
             K  R+     +  EEEIS++AK LLM L G  +P++R  +L+ HKE+LRARRRRT  + 
Sbjct: 1799 IKASRNADRNNENEEEEISDKAKNLLMELSGNGAPTRREELLNGHKERLRARRRRTQGHG 1858

Query: 1887 DLPSGSNKLKFYD 1899
            +L S SNKL F D
Sbjct: 1859 ELIS-SNKLAFLD 1870

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1002 (47%), Positives = 641/1002 (63%), Gaps = 47/1002 (4%)

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            RLSRQ T              Y N SK++  +G+ NL+MP D  EIE+LFEE+MYKRNIL
Sbjct: 149  RLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNIL 208

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXX 253
            Q LS +KQR++MNYD +KKW+IVKQD+QNE KRI+   N   NS       ++ S     
Sbjct: 209  QALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLKNNNINNSDTT----IIPSSMPSS 264

Query: 254  XXXXXXXXXXXXXXXXPMASVASNEYY------PMTSPQTKKPTSHELYQLTESNASTST 307
                             + + ASN          M+S      T+        S   + +
Sbjct: 265  NISERSSVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSIS 324

Query: 308  LSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMK 367
             SSDKTN  P  YV KI++D LS +E+ DLWVTLRTEQLDWVD+FLE+QGHIA+AN L++
Sbjct: 325  ESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIR 384

Query: 368  QIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGT 427
             IYKT P  +LS +L+EKE  FFKCF+VL+ML QG+YEF+KHKLM DT+A GLFSTR+ T
Sbjct: 385  CIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVST 444

Query: 428  RKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHLK 487
            RKMA+EI V ++ K+N  RFE+++ SLD+ FR+  N +M + + +    F   +PD+  K
Sbjct: 445  RKMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFK 504

Query: 488  VLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQ 547
            + QA++ S+E+T++GRGKMGS VGAS D K SGGENAILEYCLW ++F+N LCN S  + 
Sbjct: 505  IFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELN 564

Query: 548  QRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQ 607
            QR++LRTK EN G LR+M K+KL++YEK+  ++E+YE++KLDDFN +LE K+ ++ +N+Q
Sbjct: 565  QRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQ 624

Query: 608  DPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNV 667
            DP SL+ +LW+ CKGTENEKLL+SL+QHLFLSSS+L+++  +P KLSKQLKLMDSL+TN+
Sbjct: 625  DPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNI 684

Query: 668  SSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKA 727
            ++S   DE++ MN+AIQRLYDSMQTD+VARRAILE+RTL+KKLEE+ AEK+ L EKLSKA
Sbjct: 685  TASE-VDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKA 743

Query: 728  ENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXMLTILNT 787
            ENGLVGQLE +L +RD IL K+QRVT+QLQ+                      +LTI+NT
Sbjct: 744  ENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNT 803

Query: 788  RSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKR 847
             +   D   +++   D        K  NIQK L+  L R K D   D KKFG++VQPNKR
Sbjct: 804  NT---DADASLNNSSD--------KKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKR 852

Query: 848  LKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXXI-------- 899
            L+MLR+QMEDIE EAR+LEMTNF+E ++  LE P  +                       
Sbjct: 853  LRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEE 912

Query: 900  -NQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKEL 958
             N++ +N  K +  KL +LR  LA IQ E+N++SKFN+++RVNELF EKK +AL RL+ L
Sbjct: 913  NNRKRANAIKKQ--KLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQML 970

Query: 959  ETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQ 1018
            E KYK F I+F+  DF + + +       +   YESLDP    KK+ DIDR+ ++L    
Sbjct: 971  EKKYKSFEIDFDPNDFKQAQLD-------SNASYESLDPNFVTKKITDIDRIADELDAFS 1023

Query: 1019 KTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLETLSEKYGTGQKNVA 1078
                                        V +   +       SFLE+LSEKYGT Q    
Sbjct: 1024 GDGTSSYSSSSLSDSEKNYYESNA----VPTIGPQKGLIDGSSFLESLSEKYGTAQNTEG 1079

Query: 1079 MTATPNS---RIVTQSEKQFLDRMRRSSTAAPFLQELTEKVA 1117
             + +P S   RI +  EK F++R +R  ++  FL+EL++KV 
Sbjct: 1080 TSLSPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKVG 1121

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/612 (60%), Positives = 457/612 (74%), Gaps = 34/612 (5%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            + +YPR QKK+KQLHW+K++ ++ SIW++  AE+FADDL+EKGV  NLEKAFAARE+KSL
Sbjct: 1260 YSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSL 1319

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            A+K+K+DLDKI+FLSRDISQQFGINLHM+ SL+V++LV KILKC+RD ++TPSVIEFLSK
Sbjct: 1320 ANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSK 1379

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            PEIT+VS+NLARNY+PY TDWEG+K +EDAK PEK  + LQRADQIY+QLMVNLQ YW S
Sbjct: 1380 PEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPS 1439

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRA+K+IT+            R++D AV ++Q+S+NL N+FNVILAVGNYMND+SKQAQ
Sbjct: 1440 RMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQ 1499

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKL+TLQRLTFIKDSTNSMTFLNYVEKIIR NYP FN F++ELEPVL+VVKIS+EQL N
Sbjct: 1500 GFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVN 1559

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DC EF QS+ NVERS+EIGNLSDSSKFHPLD+V+ KVLP LP+  KK DLL DEV LT M
Sbjct: 1560 DCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFM 1619

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LMQ +GED+ DKFA+NSFFKKFADFINEY+KA+ QN+K       YERHK+MVEEQ
Sbjct: 1620 EFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQ 1679

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARK 1779
            QRKA+ +E                + D RG MDKLL QLKN GP+R+DPSSARKRA+ RK
Sbjct: 1680 QRKAKEQEKNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARKRAVMRK 1739

Query: 1780 KMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGAN-------------------- 1819
            K+L++K+ T  ++ DL     SIIYSP    +  T  G +                    
Sbjct: 1740 KLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTPKSKDNLETDNN 1799

Query: 1820 ---------GASSHKQNSN-----ELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSK 1865
                          +QN++     +++       D  +E I++RAK LLM LRG+ +PSK
Sbjct: 1800 SDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITDRAKALLMELRGSQTPSK 1859

Query: 1866 RNSMLDEHKEKL 1877
            +NS LD+ +EKL
Sbjct: 1860 KNSHLDDQREKL 1871

 Score = 33.1 bits (74), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (94%)

Query: 83  KPLNKKSTLNTQNLSQYMD 101
           KPLNK+++LN QNLSQY++
Sbjct: 69  KPLNKRTSLNNQNLSQYIN 87

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/888 (49%), Positives = 592/888 (66%), Gaps = 76/888 (8%)

Query: 282  MTSPQTKKPTSHELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTL 341
            ++ P+TK   S+ +      N   S LS D+TNR PN Y+++I+ D+LS DEM DLWVTL
Sbjct: 393  ISKPKTKLKNSNNI------NNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTL 446

Query: 342  RTEQLDWVDSFLENQGHIAMANILMKQIYK-TTPKDHLSSKLLEKENSFFKCFKVLSMLS 400
            RTEQL WV++FLE+QGHIAMAN LMK IY+  T ++ LS+ L++KE +FFKCF+VLSMLS
Sbjct: 447  RTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLS 506

Query: 401  QGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRI 460
            QG+ EF KHKLMTDT+ +GLFSTRL TRK+A EIFV ML+K N      +L + D+ F I
Sbjct: 507  QGLTEFIKHKLMTDTLVQGLFSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSI 566

Query: 461  GSNFHMFQNLKKLPQ--YFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKN 518
              N +M   LK +P   ++++ T  + +KVL +WL+++E+T+DGRGKMGSLVGAS D K 
Sbjct: 567  NENLNMVYLLKNVPDKYHYLNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKI 626

Query: 519  SGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVID 578
            +GGENAILEYC WTMV +N LCNASTII QR+LLRTKLEN G +RIMNK+K L+YEK+ +
Sbjct: 627  TGGENAILEYCQWTMVLINRLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITE 686

Query: 579  EIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFL 638
            ++E YEN KLDD N +LE   K S+V+L +P+SLL++L + CK TE E+ L S+IQHL+L
Sbjct: 687  QLEDYENKKLDDLNTLLEQDTK-SSVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYL 745

Query: 639  SSSRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARR 698
            SSS+L ++ DDPTKLSKQLKLMDSL+T+ ++ ST D ES MNMAIQ LYDSM TD+VARR
Sbjct: 746  SSSKLFDDKDDPTKLSKQLKLMDSLMTD-ATLSTVDNESKMNMAIQHLYDSMVTDDVARR 804

Query: 699  AILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQS 758
            AILESR LTKKLEE+QAE+D L  +LS+AENGLVG+LEN+L +RD ILAKNQRVTQQL++
Sbjct: 805  AILESRNLTKKLEEVQAERDFLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRT 864

Query: 759  XXXXXXXXXXXXXXXXXXXXXXMLTILNTRSST--NDGAKTIDKDKDN---ISKLNLQKH 813
                                  MLTILN+R  T  ++   +I + K N   I KL L K 
Sbjct: 865  ELDELKKKHLMEKHDHEVELRKMLTILNSRPETELDNTMSSISRTKRNKHEIEKLELLKR 924

Query: 814  EN-IQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTE 872
            +  I+K LQDGL + K D ++D+K+FG+TVQPNKRL+ LR+QMEDIENEARQLEMTNFT+
Sbjct: 925  KKVIEKALQDGLQKTKKDLSLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTD 984

Query: 873  FER---------------KKLEPPVEVTXXXXXXXXXXXXXINQQESNDQKSRINKLNDL 917
              R                 L+P + +               N+  S +   +  KL +L
Sbjct: 985  PVRTPKKGQEKRDSHNKHPSLKPGIPIAKK------------NKDRSEEMAKKQQKLAEL 1032

Query: 918  REALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKYKDFGINFEMKDFLEN 977
            R+ALA+IQ E+N+IS+FN+EE VNELFN KK++A++RLKELET Y++FG++F M++FLE 
Sbjct: 1033 RKALADIQQETNDISRFNVEEHVNELFNAKKIQAMERLKELETMYQNFGVDFNMEEFLE- 1091

Query: 978  KPNDGTKEGSTEE-EYESLDPKIYEKKLDDIDRLTEQLLNLQKTQELRXXXXXXXXXXXX 1036
            K N  TKE   +   YE+LDP ++  K+D++D+ + +L  L  T +L             
Sbjct: 1092 KNNTSTKELDPDSPAYETLDPNLFIDKMDELDKFSMKLDQL--TSDLNNTMSAKQNSLST 1149

Query: 1037 XXXXXXXXIFV-------------------------ASSSSKPAGSGTRSFLETLSEKYG 1071
                                                ++ S +   SG  SFLE+LS+KYG
Sbjct: 1150 TNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSSTFSHQSTTSGGSSFLESLSQKYG 1209

Query: 1072 TGQKNVAMTATPNSRIVTQ--SEKQFLDRMRRSSTAAPFLQELTEKVA 1117
            TGQ N +   + N+  V+    E++F+ RM++      +++EL +KV+
Sbjct: 1210 TGQ-NASGPMSSNTPNVSHYNPERKFMSRMKKQHATPNYIRELNQKVS 1256

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/642 (60%), Positives = 479/642 (74%), Gaps = 47/642 (7%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPRSQKK+KQLHWEK++ TDNSIW  GKAE FADDLFEKGV   LE AFAARE+KSL
Sbjct: 1436 FEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSL 1495

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            ASK+K+D  KIT+LSRDISQQFGINLHM+S+L+V+ L+ KI++CDR  L+TPSVI+FLSK
Sbjct: 1496 ASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSK 1555

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             EI EVSVNLAR+Y+PY+TDWEG+K ++DAKPPEKDPN+LQRADQIYLQLMVNLQ YW S
Sbjct: 1556 QEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQLMVNLQSYWGS 1615

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RM ALK++T+            R+VD AVGS+Q+SENL+NVFNVILAVGN+MND SKQAQ
Sbjct: 1616 RMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQ 1675

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKL+TLQRLTFIKDSTN+MTFLNYVE IIR NYP FN FL EL+PVL+VVK+SIEQL  
Sbjct: 1676 GFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVR 1735

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DCKEF Q + NV RS+EIG LSDSSKFHP D+VL KVLP LP+  KK DLL+DEV L++M
Sbjct: 1736 DCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIM 1795

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LMQV+GED+ DKFA+NSFFKKFADFINEY++AQEQN+KV      YE HK+ +EEQ
Sbjct: 1796 EFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQ 1855

Query: 1720 QRKAE--RKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALA 1777
            Q++ E  +K++                 DRR  MDKLLEQLKNVGP + DP+SARKRA+ 
Sbjct: 1856 QKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKTDPTSARKRAMV 1915

Query: 1778 RKKMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNEL--SPSK 1835
            RKK+  +KE    ++ + ET  DSI+YSP +  I  TP         K+ SNE   SP+ 
Sbjct: 1916 RKKLQNEKETASQILKEFETGEDSIVYSPTDSKI--TP---------KKVSNEYLQSPTP 1964

Query: 1836 GFRDDLS----------------------------EEEISERAKTLLMGLRGTASPSKRN 1867
            G +  L+                            ++EI +RAK+LL  LRG+ +P+++N
Sbjct: 1965 GEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPTRKN 2024

Query: 1868 SMLDEHKEKLRARRRRTNNDLPSGSNKLKFYDTNEKDISNEP 1909
            S+L+E KEKLRARRR T +DL   SNKLKF  +++K +  EP
Sbjct: 2025 SVLEERKEKLRARRRNT-SDL--TSNKLKFV-SSDKTVDGEP 2062

 Score =  119 bits (297), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 157 NFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIV 216
           N  KF+TPDGK NLEMP +P E+E L+E+IMYKRNILQNL  +KQRELM+YDV KKWLIV
Sbjct: 194 NLMKFMTPDGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIV 253

Query: 217 KQDIQNEFKRIRATKNGPKNS 237
           KQD+Q+E K++R+ KN  +NS
Sbjct: 254 KQDLQSELKKMRS-KNPLQNS 273

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1079 (41%), Positives = 628/1079 (58%), Gaps = 69/1079 (6%)

Query: 81   TNKPLNKKSTLNTQNLSQYMD-------HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLR 133
            + KPL+K++TLNTQNLS Y+D                                       
Sbjct: 67   SGKPLSKQTTLNTQNLSSYVDMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGG 126

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            RLSRQ T Q              N +KF+  DGK  L+ P +P+EIE+LF E+M+KRN  
Sbjct: 127  RLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFF 186

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXX 253
            Q+L    Q+ELMNYD+ KKWL+VKQD+Q+E K++   KN     +         S     
Sbjct: 187  QSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANKKNTHVAPAGAAGLAATISAATQG 246

Query: 254  XXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQLTESNASTSTLSSDKT 313
                                  S  +   +SP          Y+    N+ST+TLS D  
Sbjct: 247  TSGAGGVGGVD------GTQAGSKGHNSTSSPIL---GGGGFYESGNQNSSTATLSQDPL 297

Query: 314  NRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTT 373
            +  P+ YV KII+DK+S  +++DLWV+LRTEQLDWV  FL+ QG +A+AN+L++  +K +
Sbjct: 298  HLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKES 357

Query: 374  PKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIE 433
            P   L+ + L+KE +FFKC K L  L +G  E  + KL+   I  GL S R+ TR++A E
Sbjct: 358  PDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASE 417

Query: 434  IFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKK-------LPQ-YFIHLTPDSH 485
            + V + +         ++  LDQ   + SN H+   L         L Q + + LT D  
Sbjct: 418  MLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHA 477

Query: 486  LKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTI 545
             K  + WLF +E T+DGRGKMGSLVGAS D K++GGENAILEY   T++ VN LCN    
Sbjct: 478  SKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPAD 537

Query: 546  IQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVN 605
            + QR LLR++ ++ G  RIM K++LLNY+K+ +++  +E+   DD+N ++ SK+ N NV+
Sbjct: 538  VNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVD 597

Query: 606  LQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVT 665
            +++P+SLL NLW+S KGT  EK L+SL+QHLF++SS++ +E DDPT+ SKQLKL+DSLV+
Sbjct: 598  MENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVS 657

Query: 666  NVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLS 725
            NV+ SS  D ES+ N AIQRLYDSMQTDEVARRAI+E+R LT+K EE++AE+D L EKLS
Sbjct: 658  NVTMSSI-DTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLS 716

Query: 726  KAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXMLTIL 785
            KAE GLVGQL+N+L++RD+IL KNQRVT+QLQ+                      +LTIL
Sbjct: 717  KAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTIL 776

Query: 786  NTRSSTNDGAKTIDKDKDNISK------LNLQKHENIQKVLQDGLIRAKNDFTIDAKK-- 837
            N+R     G+  + +++   +       L+  +   IQK LQD L + K D T ++K+  
Sbjct: 777  NSRPQ---GSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLG 833

Query: 838  --FGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXX- 894
               G T++PN+RLK+LR +MEDIENEAR+LEMTNF + +R+ +E    V           
Sbjct: 834  TTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVL 893

Query: 895  -XXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQ 953
                   +Q   DQ   + KL +LR+ LA +Q ESN++SKFN+EER+NELFN+KKL AL 
Sbjct: 894  DRAPKAKKQVKEDQ---VRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALD 950

Query: 954  RLKELETKYKDFGINF----EMKDFLENKP--NDGTKEGSTEEEYESLDPKIYEKKLDDI 1007
            RLKELETKYK FGI+F    E+   L + P  N   K+G   + + SLDPK   +K++++
Sbjct: 951  RLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDG---QAHPSLDPKHLSRKIEEM 1007

Query: 1008 DRLTEQLLNLQKTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLETLS 1067
             ++ ++L   +K  E                      I   ++S       T SFLETLS
Sbjct: 1008 SKIVDELTAFKKEIENGPPSSSSSSSDEELEQDDRASIHSGNAS-------TGSFLETLS 1060

Query: 1068 EKYGTGQKNVAMTATPNSRIVTQS--------EKQFLDRMRRSSTAAPFLQELTEKVAP 1118
            +KYGTGQ N   TA+  + +  +S         + F++R+++S  AAPFL ELT+KVAP
Sbjct: 1061 QKYGTGQ-NAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSD-AAPFLSELTQKVAP 1117

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/617 (61%), Positives = 464/617 (75%), Gaps = 24/617 (3%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FERYPR +KK+KQLHWEKIE T NSIW   KAE++ADDL+E+GV + LEKAFAARE+K L
Sbjct: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            A++RK+DL+K+TFLSRD+SQQFGINLHMY++LSV+++V KIL+CD+DFL + SVI+FL K
Sbjct: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            PEI EVS NLARN++PY+T+WEG+ S+++AK PEKDP +LQRADQ+YL++MVNLQ YWAS
Sbjct: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRALK+ITT            R +DKAV S+Q S+NLR+VF VILAVGNYMND+SKQA 
Sbjct: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FNSFLQELEPVL+VVKIS+EQLA 
Sbjct: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DC+EF Q++ NVERSIE+GNLSDSSKFHP DRVL KVLP LP+ RK+ DLL+DEV LTLM
Sbjct: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EFDGLMQ++GED SDKFA+NSFFKKFADFI EY+KAQ  NIK+     AYER K+MVEEQ
Sbjct: 1667 EFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQ 1726

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRTDR--RGTMDKLLEQLKNVGPSRADPSSARKRALA 1777
             ++A R EA+                 R  R  MDKLLE+LKN GP ++DPSSARKRALA
Sbjct: 1727 HKRA-RLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSARKRALA 1785

Query: 1778 RKKMLTDKEGTVNMMHDLETE-----SDSIIYSPD------NKAIGSTPF------GANG 1820
            RKK+L  K  + N++ + E +     + S++YSP+      N A   +P       G+  
Sbjct: 1786 RKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQGSVA 1845

Query: 1821 ASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRAR 1880
             S         SPSK  +     E++++RA+ LL  LRG  S  KR  +L++H+EK+RAR
Sbjct: 1846 GSGATATPLLESPSK--QASAGPEDVADRARNLLKELRGPES-EKRKPLLEDHREKMRAR 1902

Query: 1881 RRRTNNDLPSGSNKLKF 1897
            RRR N    S  NKL F
Sbjct: 1903 RRRVNEG-ASSENKLVF 1918

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/635 (57%), Positives = 456/635 (71%), Gaps = 29/635 (4%)

Query: 1270 STSSVPPPALPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETTDNSIWTTG 1329
            S ++ P P LP                   FERYPR  KK+KQLHWEKI+  ++SIW   
Sbjct: 1299 SRTTTPSPMLP--------------QSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNA 1344

Query: 1330 KAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYS 1389
            KAE+FADDL+EKG+ S LEKAFAARE+KSL S++K D DK+TFLSRD+SQQFGINLHMYS
Sbjct: 1345 KAEQFADDLYEKGILSRLEKAFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYS 1404

Query: 1390 SLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDA 1449
            SLSVE++VTKILKCD+DFL TPSVIEFLSK EI EVS NLARN++PYTTDWEG+ +++DA
Sbjct: 1405 SLSVEEVVTKILKCDKDFLTTPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDA 1464

Query: 1450 KPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVG 1509
            KPPEKDP++LQRAD++YL+L VNLQ YW+SRMRALK+IT+            R +DKA  
Sbjct: 1465 KPPEKDPSELQRADRLYLELFVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATC 1524

Query: 1510 SLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKII 1569
            ++Q+SENLRNV +VILAVGN+MND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+
Sbjct: 1525 AIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIV 1584

Query: 1570 RMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPL 1629
            R  YP FN FL+ELEPV+  VKISIEQ++ DCKEF QSV NVERS++IGNLSDSSKFHPL
Sbjct: 1585 RETYPEFNVFLKELEPVVAAVKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPL 1644

Query: 1630 DRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFI 1689
            DR L KVLP LP+ RKKGDLL DE+ LTL+EFD LM+++GED  DKF+RNSFFKKFADF+
Sbjct: 1645 DRTLLKVLPVLPEARKKGDLLMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFL 1704

Query: 1690 NEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRKAERKEAKXXXXXXXXXXXXXXRTDRRG 1749
             EY+KAQ  N+K+     AYER K+MVEEQQR+A     +                D R 
Sbjct: 1705 QEYKKAQTYNMKLEEEEKAYERRKKMVEEQQRRARESNEQENSVDGNADDNTAASGD-RD 1763

Query: 1750 TMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLET---ESDSIIYSP 1806
             MD+LLE+LKN GP ++DPSSARKRA+AR+K+L        ++ + E    E  S++YSP
Sbjct: 1764 VMDRLLEKLKNAGPGKSDPSSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSP 1823

Query: 1807 D----NKAIGSTPFGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTAS 1862
            +    + ++  +P         +  ++E+  S+         ++++RA+ LL+ LRG  S
Sbjct: 1824 EQVTLSNSVDHSPTPDVRKREGQSTASEVQTSES-------SDLTDRARNLLIELRGPES 1876

Query: 1863 PSKRNSMLDEHKEKLRARRRRTNNDLPSGSNKLKF 1897
            PS+R S  D+   KLRARR+   +      N L F
Sbjct: 1877 PSRRASSKDQRISKLRARRKNDGSGNSGSDNHLNF 1911

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1070 (36%), Positives = 585/1070 (54%), Gaps = 79/1070 (7%)

Query: 81   TNKPLNKKSTLNTQNLSQYMDHXXXXXXXXX-------XXXXXXXXXXXXXXXXXXXXLR 133
            ++KPL+K+STLN  NLS Y D                                       
Sbjct: 69   SHKPLSKQSTLNIANLSAYTDVASTHNRSSSAASNSSPTKYSYSRRASQWSSNGGTAPST 128

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            +LSRQ T Q            + N SKF+ PDG   LE PRDP+EIE LFEE++YKRN+ 
Sbjct: 129  KLSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVY 188

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXX 253
            Q+L    Q+EL NYD+ KKWL+V+QD+Q+E K+    K+  K+ +  +    + +P    
Sbjct: 189  QSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMNNKSVSKSPAAASTGISLIAPESPS 248

Query: 254  XXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQLTESNASTSTLSSDKT 313
                               S A N   P TS Q         Y      +ST+TLS D +
Sbjct: 249  TGHFASNSSINESLAGSSRSRAQN---PGTSDQ--------FYGSNNGTSSTTTLSQDPS 297

Query: 314  NRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTT 373
            +  P+ YV KII + +S   + DLWV+LRTEQLDWV  FLE QG +A+AN+++K  Y+ +
Sbjct: 298  HLSPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRES 357

Query: 374  PKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEF---SKHKLMTDTIARGLFSTRLGTRKM 430
            P + L  ++L+KE ++FKC K    L +G  E    +  K++   I  GL S R+ TR++
Sbjct: 358  PDNLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRI 417

Query: 431  AIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNL------KKL-----PQYFIH 479
            A E+ V + +      F  ++N+LDQ  R   N H+   L      K++           
Sbjct: 418  ASELLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLAD 477

Query: 480  LTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNML 539
               D  ++  + W+  +E T+DGRGKMGSLVGAS D + SGGENAI+EY   T++ VN L
Sbjct: 478  NNGDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHL 537

Query: 540  CNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKN 599
            C     ++QR +LR +L+N+G  RI+NK+K LNYEKV +++  +E++  DDF+ +     
Sbjct: 538  CQTPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGP 597

Query: 600  KNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRL-IEEVDDPTKLSKQLK 658
                +N+QDPVS+  NLW  CKGTE E+ L+SL+Q+L +S+  L     +DP + +KQLK
Sbjct: 598  NGELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLK 657

Query: 659  LMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKD 718
            L+D+LV+NVS +S  D +S+ N AIQRLYD+MQTDE+ARRAILE+R   K+ EE++AE++
Sbjct: 658  LIDALVSNVSMASV-DLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERN 716

Query: 719  LLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXX 778
             L EKLS AE GLVGQL+ +L +RD IL K+QRVT QLQ                     
Sbjct: 717  NLKEKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVEL 776

Query: 779  XXMLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKF 838
               LT LN++     G   + +D      L  ++   IQ+ LQ  L +   + T+++ + 
Sbjct: 777  RKTLTALNSKG----GDIQLTEDGGQPKPLKPERMLAIQRALQIKLEKTSKEITVESSRL 832

Query: 839  GMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXX 898
            G++++PNKRL++LR +ME+IEN+AR+LEMTNF+E+ R+  +  +E+              
Sbjct: 833  GVSLEPNKRLRLLRSRMEEIENQARELEMTNFSEY-REDADKEIEMAHEGTHMYPSDVDV 891

Query: 899  INQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKEL 958
               Q+SN       KL  LR  LA +Q ESN+ISKFN+E R +E+F+++K++AL RLK+L
Sbjct: 892  GTTQDSN------LKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKL 945

Query: 959  ETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLD----DIDRLTEQL 1014
            E  Y  FGIN++  +     P+   ++G    +  +LDPK     +D    + DR    +
Sbjct: 946  ENDYSGFGINYDPAE----SPSLKQEQGQDVNKSRTLDPKGPNNSVDESQLETDRANASI 1001

Query: 1015 LNLQKTQELRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLETLSEKYGTGQ 1074
             +   ++ L                     + +  S+++  G    SFLE LS+KYG GQ
Sbjct: 1002 DSSPASESLE-----------------EEDVHLTKSTTEEIGG---SFLERLSQKYGKGQ 1041

Query: 1075 KNV----AMTATPNSRIVTQ-SEKQFLDRMRRSSTAAPFLQELTEKVAPA 1119
             N+    ++    NS   +    K F++R+++S    P+L+EL+ K   A
Sbjct: 1042 ANLSNRNSVVGRENSYPGSGYHRKSFMNRVKKSDN-VPYLEELSGKFGTA 1090

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/579 (62%), Positives = 435/579 (75%), Gaps = 31/579 (5%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FERYPR +KK+KQLHWEKI+  DNSIW   +AE+FADDL+EKGV S LEKAFAARE+KS 
Sbjct: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
              ++KD+ +KITFLSRDISQQFGINLHMYSSL V  +V+KILKCD+DFL T S IEFLSK
Sbjct: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            PEI EVS N+AR+++PYTTDWEG+ S+EDAK PEKDP++LQR+DQ++L L+VNLQ YW+S
Sbjct: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMR LK+ITT            R +DKAVG++Q+SENLRNVF+VILAVGNYMNDTSKQAQ
Sbjct: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFNSFLQELEPVL+VVKISIEQLAN
Sbjct: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DC EF  +VTNVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ RKK +LL DEV L+LM
Sbjct: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LM+++GED  DKFA+NSFFKKFADFI EY++AQE N K+     AYER K M++EQ
Sbjct: 1727 EFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARK 1779
            QR+A+  + +                D R  MDKLLE+LKN GPS+ DPSSARKRALARK
Sbjct: 1787 QRRAKLVQ-EGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARK 1845

Query: 1780 KMLTDKEGTVNM----MHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSK 1835
            K++  +EG++ +    + DL++ +  +   PD      TP  A  AS             
Sbjct: 1846 KLMGGREGSIILEGLDVDDLQSAAPDV--QPD------TPLRAASASP------------ 1885

Query: 1836 GFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHK 1874
                    +  ++RA+ LL+ LR    P  R SMLDEHK
Sbjct: 1886 ------PPDPAADRARHLLLELRNGEHPESRKSMLDEHK 1918

 Score =  559 bits (1440), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 361/913 (39%), Positives = 526/913 (57%), Gaps = 94/913 (10%)

Query: 135  LSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQ 194
            L+RQ T Q             ++ +  I  DG   LE P DP+EIE L++E++ KRNI Q
Sbjct: 152  LTRQMTNQSNYSASSYTSLSLLHKATDI--DGTLTLEKPEDPQEIEELYQELLQKRNIPQ 209

Query: 195  NLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXXX 254
            ++SV   RELM+Y + KKWL+VKQD+Q E+K+++ +   P +S+   VE +  S      
Sbjct: 210  SVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNSM--PPSST---VESIASSALAKSP 264

Query: 255  XXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQLTESNASTSTLSSDKTN 314
                              S++ N   PM         ++E   L+               
Sbjct: 265  GGSISSGSITR-------SISQNSAKPMA-------VAYEPAHLS--------------- 295

Query: 315  RPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTTP 374
              P+ YV KII+D+++  E+ DLW++LRTE +DWV  F++ QG +A+AN L+K + + + 
Sbjct: 296  --PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESL 353

Query: 375  KDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIEI 434
                    LEKEN+++KC +VL+ L +G+ E  K KL+  ++  GL S+RL TR++A E 
Sbjct: 354  DILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATET 413

Query: 435  FVCMLE----KRNKSRFEAI---LNSLDQNFRIGSNFHMFQNL------KKLPQYFIHLT 481
             + ML     K   +  +AI   L +LDQ  +  +N H+   L      K LP       
Sbjct: 414  LLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTG----R 469

Query: 482  PDSHL--KVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNML 539
             D H+  K L+ WL+ IE T+DGRG+MGSLVGAS D K  GGEN +LEY L++M+ +N+L
Sbjct: 470  ADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLL 527

Query: 540  CNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKN 599
            C+    +QQR LLR++L++ G  RI+ K++LL Y  + +E+  +E+  LDD+NL++ S  
Sbjct: 528  CSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTT 587

Query: 600  KNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKL 659
             +S V+++DP +L  + W   +GTE E  L+SL+QHL    SR   E  DP +  KQLKL
Sbjct: 588  VDSAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHL-FLWSRAFAEYRDPAESIKQLKL 646

Query: 660  MDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDL 719
            +D+LVTNV+ SS  D ES  N AIQRLYD+MQTDEVARRAILESR LTKK EE++AE+D 
Sbjct: 647  LDALVTNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDN 705

Query: 720  LHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXX 779
            L  KLS+A+NGLVGQL++++ + ++IL K+ RVT QL+                      
Sbjct: 706  LASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELR 765

Query: 780  XMLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFG 839
             MLTILN++    +G  + + +    S L  +K   IQK LQD L + + D T D+K+  
Sbjct: 766  KMLTILNSKPHGENGG-SPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLN 824

Query: 840  MTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKK--------LEPPVEVTXXXXXX 891
                PN+RLKMLR +M+ IE EAR LEMTNF +F+++         L PP          
Sbjct: 825  TVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLSPP---------- 874

Query: 892  XXXXXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKA 951
                   I +    +Q   + +L  LR+ LA IQ ESN +SKFN+EERVNELF EKK KA
Sbjct: 875  ------KIQRSLRGEQ---VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKA 925

Query: 952  LQRLKELETKYKDFGINF-EMKDFLENKPNDGTK--EGST--EEEYESLDPKIYEKKLDD 1006
            L RL++LE KYK FGI+F E  + +  +  +G+   +G T   E    LDP   + K+++
Sbjct: 926  LDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEE 985

Query: 1007 IDRLTEQLLNLQK 1019
            + ++ ++L  L+K
Sbjct: 986  MTKILDRLNKLKK 998

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 44/79 (55%), Gaps = 18/79 (22%)

Query: 1061 SFLETLSEKYGTGQK----------------NVAMTATPNSRIVTQSEKQFLDRMRR--S 1102
            SFLETLS+KYGTG +                NV    + NS       K F++RM+R  +
Sbjct: 1087 SFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTIT 1146

Query: 1103 STAAPFLQELTEKVAPALS 1121
             T++ FL+ELT+KV+PA S
Sbjct: 1147 PTSSNFLEELTQKVSPARS 1165

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/661 (56%), Positives = 470/661 (71%), Gaps = 34/661 (5%)

Query: 1262 FSAETSANSTSSVPPPALPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETT 1321
            F A  S N  S+ P P LP                   F+RYPR  KK+KQLHWEKI+  
Sbjct: 1309 FGASVSRN-KSATPSPMLP--------------QSPSLFDRYPRPSKKLKQLHWEKIDDA 1353

Query: 1322 DNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQF 1381
            ++SIW   KAE+FADDL+EKGV S LEKAFAARE+KSLAS++K D DK++FLSRD+SQQF
Sbjct: 1354 EDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSLASRKKKDSDKLSFLSRDVSQQF 1413

Query: 1382 GINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWE 1441
            GINLHMYSSLSVE++V+KIL+CDRDFL TPSVI+FLSK EI EVS NLARN++PYT DWE
Sbjct: 1414 GINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWE 1473

Query: 1442 GLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXXXXXX 1501
            G+ S+E+AKPPEKDP +LQRAD++YL+L VNLQ YW+SRMRALK+ITT            
Sbjct: 1474 GVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKL 1533

Query: 1502 RKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTF 1561
              +DKA  S+Q+SENLRNV +VILAVGN+MND+SKQAQGF+L+TLQRLTFIKD  NSMTF
Sbjct: 1534 SMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTF 1593

Query: 1562 LNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLS 1621
            LNYVEKIIR  YP FN FL+ELEPV+  VKISIEQ+A DC+EF QSV NVERS++IGNLS
Sbjct: 1594 LNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLS 1653

Query: 1622 DSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSF 1681
            D +KFHP DRVL KVLPTLP+ RKKGDLL DE+ LTL+EFD LM+++GED  DKFARNSF
Sbjct: 1654 DPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSF 1713

Query: 1682 FKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRKAERKEAKXXXXXXXXXXXX 1741
            FKKFADF+ EY+KAQ  N+K+     AYER K++VE+Q ++    E+K            
Sbjct: 1714 FKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSV 1773

Query: 1742 XXRTDR-RGTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLETE-S 1799
                +  R  MD+LLE+LKN GP+++DPSSARKRA+ARK++L        ++ + + E S
Sbjct: 1774 RNEVNEDRDVMDRLLEKLKNAGPAKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDS 1833

Query: 1800 D--SIIYSPDNKAIGSTPFGANGASSHK------QNSNELSPSKGFRDDLSEEEISERAK 1851
            D  S++YSPDN    S+    N A +        ++SN  SP+     D    ++++RA+
Sbjct: 1834 DGKSLVYSPDN---NSSEVQLNEADTSPTPERRVRDSNATSPAS---HDTGSSDLTDRAR 1887

Query: 1852 TLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDLPSGS-NKLKFYDTNEKDISNEPT 1910
             LL+ LRG  SP  + S   +   KLRARR+  N+   SGS N+L F    + + S+E  
Sbjct: 1888 NLLIELRGPESPGVKMSAQHQRLSKLRARRK--NDSSSSGSENRLNFVGAGQAENSDEQN 1945

Query: 1911 E 1911
            E
Sbjct: 1946 E 1946

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1076 (37%), Positives = 604/1076 (56%), Gaps = 75/1076 (6%)

Query: 81   TNKPLNKKSTLNTQNLSQYMDHXXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXLR 133
            ++KPL+K+STLN  +LS Y D                                       
Sbjct: 70   SHKPLSKQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGS 129

Query: 134  RLSRQHTGQXXXXXXXXXXXXYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193
            +LSRQ T Q            + N SKF+ PDG   LE PRDPKEIE LFEE++YKRN+ 
Sbjct: 130  KLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVY 189

Query: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVY--SPXX 251
            Q+L    QREL NYD+ KKWL+V+QD+Q+E K+   +KN  K+S++V         SP  
Sbjct: 190  QSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSPSA 249

Query: 252  XXXXXXXXXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQLTESNASTSTLSSD 311
                              P  S +S              TS + Y      +ST+TLS D
Sbjct: 250  SNFTSSTSPNGSFTGLSRPKISTSSVN------------TSEQFYSSNLGTSSTTTLSQD 297

Query: 312  KTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYK 371
             ++  P+ YV KII + +S   + DLWV+LRTEQLDWV  FLE QG +A+AN+++K  Y+
Sbjct: 298  PSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYR 357

Query: 372  TTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEF---SKHKLMTDTIARGLFSTRLGTR 428
             +P + L  ++L+KE ++FKC K    L +G  E    +  +++   I  GL S R+ TR
Sbjct: 358  ESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATR 417

Query: 429  KMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHM-----FQNLKKLPQYFIHLTP- 482
            ++A E+ + + +      F  ++++LDQ  R   N H+      Q+  K P+    + P 
Sbjct: 418  RVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPT 477

Query: 483  -----DSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVN 537
                 D  ++  + W+  +E T+DGRGKMGSLVGAS D + SGGENAI+EY   T++ +N
Sbjct: 478  PDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLIN 537

Query: 538  MLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLES 597
             LC     ++QR +LR +L+N+G  RI+NK+KLLNYEKV +++  ++++  DDF+ +   
Sbjct: 538  HLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQ 597

Query: 598  KNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRL-IEEVDDPTKLSKQ 656
            ++    V+++DPVS+  NLW  CKGT+ E+ L SL+Q+L +S+  L  +  DDPT+ +KQ
Sbjct: 598  ESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQ 657

Query: 657  LKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAE 716
            LKL+D+LV+NVS +S  D +S+ N AIQRLYD+MQTDE+ARRAILE+R   K+ EE++A+
Sbjct: 658  LKLIDALVSNVSMASV-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAD 716

Query: 717  KDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXX 776
            +D L EKLS AE GLVGQL++++ +RD IL K+QRV  QLQ                   
Sbjct: 717  RDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEV 776

Query: 777  XXXXMLTILNTRSSTNDGAKTI--DKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTID 834
                 LT +N   S  +G+  +  +K  +N   L  ++   IQK LQ  L +   +  ++
Sbjct: 777  ELRKTLTAMN---SNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVE 833

Query: 835  AKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXX 894
            +K+ G++++PNKRLK+LR +MEDIEN+AR+LEMTNF+++++  ++ P EV+         
Sbjct: 834  SKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEP-EVS------NED 886

Query: 895  XXXXINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQR 954
                +++ E   Q+    KL +LR+ LA +Q ESN+ISKFN+E R +E+F+ +K  AL R
Sbjct: 887  DHKAVSESEEKAQQISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDR 946

Query: 955  LKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQL 1014
            LK+LET YK FGINF+    L        K  S++++  +LDPK   + L+ ++ ++  L
Sbjct: 947  LKKLETDYKGFGINFDPDSPLGQAL--AGKSVSSDDKARTLDPK---EALNIVEEVSNIL 1001

Query: 1015 LNL------QKTQE--LRXXXXXXXXXXXXXXXXXXXXIFVASSSSKPAGSGTRSFLETL 1066
              L      +K+ E  LR                      +A+ S+ P    T SFLE+L
Sbjct: 1002 SGLDSSKAAEKSNETPLRTATSSDSSEDEMDDKNGDK---IAADSTLP----TSSFLESL 1054

Query: 1067 SEKYGTGQKNVA-----MTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVA 1117
            S+KYG  Q +++          N        K F++R++R+  A P+L EL+ K+ 
Sbjct: 1055 SQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTG-AVPYLGELSGKIG 1109

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/617 (59%), Positives = 456/617 (73%), Gaps = 34/617 (5%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FE+YPR +K++KQLHWEKI+  DNSIW   +AE+FADDL+E+GV + LEKAFAARE+KSL
Sbjct: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
             S++KD+ +K+TFLSRDISQQFGINLHMYSSL+V+ +VTKILKCD+DFL+T S IEFLSK
Sbjct: 1460 ISRKKDE-NKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             EI EVS+N+AR ++PYTTDWEG+ S+E+AK PEKDPN+LQRADQ+YL L+VNLQ YW S
Sbjct: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRALK+ITT            R +DKAVG++Q+SENLRNVF+VILAVGNYMND+SKQAQ
Sbjct: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FLQELEPVL+VVKISIEQLAN
Sbjct: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DC EF  +VTNVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ RK+ +LL DEV L+LM
Sbjct: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LM+++GED+ DKFA+NSFF+KFADFI EY++AQE N K+     AYER K M+EEQ
Sbjct: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818

Query: 1720 QRKAERK----EAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRA 1775
            Q++A +      +                 D R  MD+LLE+LKN GPS+ADPSSARKRA
Sbjct: 1819 QKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878

Query: 1776 LARKKMLTDKEGTVNMMHDLETE------SDSIIYSPD-NKAIGSTPFGANGASS----- 1823
            LARKK++  K+    ++  L+ E      SD +    D N AI  +P    GA++     
Sbjct: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938

Query: 1824 ---HKQNSNELSPSKGF-------------RDDLSEEEISERAKTLLMGLRGTASPSK-R 1866
               H   S  +S  KG              +  L E+ ++ RA+ LL  LR +   ++ R
Sbjct: 1939 NPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHRARNLLQELRSSDDHTEDR 1998

Query: 1867 NSMLDEHKEKLRARRRR 1883
             S+LDEHKEK+R RR +
Sbjct: 1999 KSLLDEHKEKVRQRRNK 2015

 Score =  595 bits (1535), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 359/893 (40%), Positives = 531/893 (59%), Gaps = 97/893 (10%)

Query: 158  FSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVK 217
              K    DG  +LE P+ P+EIE L++E++ KRNIL ++SV   RELM YD+ KKWL+VK
Sbjct: 168  LQKITDSDGNLSLEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVK 227

Query: 218  QDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXXXXXXXXXXXXXXXXXXPMASVASN 277
            QD+Q E KR++   N P+++                                 +A   SN
Sbjct: 228  QDLQAELKRMK--NNVPQST---------------------------------VADPLSN 252

Query: 278  EYYPMTSPQTKKPTSH-ELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRD 336
              + + SP+    +S+     +++++A    +S D ++  P+ YV KII+D+++  E+ D
Sbjct: 253  SVH-LKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELND 311

Query: 337  LWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVL 396
            LWV+LRTE +DWV  F++ QG +A+AN L+K   + + +  L S LLEKE +++KC +VL
Sbjct: 312  LWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCLRVL 371

Query: 397  SMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLE----KRNKSRFEAI-- 450
            + L +G+      KL+   +  GL S RL TR++A E  + ML     K   + F+AI  
Sbjct: 372  TNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFP 431

Query: 451  -LNSLDQNFRIGSNFHMFQNL------KKLPQYFIHLTPDSHL--KVLQAWLFSIENTID 501
             L++LDQ  +  S+ H+   L      + LP        D H+  K ++ WL+ +E T+D
Sbjct: 432  VLHALDQESKYSSSIHLRGRLHETNKRRSLPTG----RADLHVIAKKIEQWLYVLEYTLD 487

Query: 502  GRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGF 561
            GRG+MGSLVGAS D KN  GEN +LEY L++M+ +N+LC++   + QR LLR++L++ G 
Sbjct: 488  GRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGL 545

Query: 562  LRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCK 621
             R++ K++LL Y  + +E+  +E+  LDD+N ++ S   +S+V+++DP SL NN W   K
Sbjct: 546  SRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHK 605

Query: 622  GTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNM 681
            GTE+E  L+SL+QHLFL SS+   E  DP + SKQLKL+D+LV+NV+ SS  D ES  N 
Sbjct: 606  GTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSI-DTESGFNG 664

Query: 682  AIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNE 741
            AIQRLYD+MQTDEVARRAILESR LTKK EE++AE+D L  KL++A++GLVGQL+ ++ +
Sbjct: 665  AIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQ 724

Query: 742  RDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXMLTILNTR--SSTNDGAKTID 799
              +IL K+ RVT QL++                      MLTILN++   ++ND      
Sbjct: 725  LQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSPDG 784

Query: 800  KDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIE 859
             +    S L  +K   IQK LQD L + + D T D+++FG    PN+RLKMLR +M+DIE
Sbjct: 785  INNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIE 844

Query: 860  NEARQLEMTNFTEFERK-------KLEPPVEVTXXXXXXXXXXXXXINQQESNDQKSRIN 912
             EA  LEMTNF EF+++       +L+ P ++                  E N +  ++ 
Sbjct: 845  KEALMLEMTNFAEFKKETKVEDLPRLQSPPKI------------------ERNVRSEKVK 886

Query: 913  KLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKYKDFGINFEMK 972
            +L  LR+ LA IQ ESN ISKFN+EERVNELF EKK KAL RL++LE KY+ FGI+F M+
Sbjct: 887  ELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNME 946

Query: 973  -DFLENKPNDGTKEGSTEEEYES----------LDPKIYEKKLDDIDRLTEQL 1014
             + L     +G  + S  E   S          LDP   + K++++ ++ E+L
Sbjct: 947  SELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEEL 999

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 18/76 (23%)

Query: 1061 SFLETLSEKYGTGQKNVAMTATPNSRIVTQS---------------EKQFLDRMRRSST- 1104
            SFLE+LS+KYGTG  N+        R+ + S                K F++RM+++ST 
Sbjct: 1110 SFLESLSQKYGTGT-NLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKNSTP 1168

Query: 1105 -AAPFLQELTEKVAPA 1119
             ++ F+ E+++K+ P 
Sbjct: 1169 KSSSFVDEVSQKMTPV 1184

 Score = 33.1 bits (74), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%)

Query: 80  TTNKPLNKKSTLNTQNLSQYMD 101
           +T KPL+K STLNT +LSQY D
Sbjct: 75  STAKPLSKHSTLNTSSLSQYAD 96

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/570 (58%), Positives = 426/570 (74%), Gaps = 19/570 (3%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359
            FERYPR +KK+KQLHWEKI+   +SIW   +AE+ ADDLFE+GV S LEKAFAARE KSL
Sbjct: 1226 FERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSL 1285

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
              K K+  +KITFLSRD+SQQFGINLHM+S+L V+D+V K++KCDR+FL TPSVIEFLSK
Sbjct: 1286 KGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSK 1345

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
            P I EV+ NLAR ++PY+TDWEG+ S++DAKPPEKDPN+LQRADQ+Y++ M+NLQPYW S
Sbjct: 1346 PTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEFMINLQPYWGS 1405

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            RMRA+ +ITT            RK+D+AV  +++SE+LR+VF+VILAVGNYMND+SKQAQ
Sbjct: 1406 RMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQ 1465

Query: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
            GFKLSTLQRLTFIKD  NSMTFLNYVEKIIR NYP ++ F++ELEP+  V KISIEQL  
Sbjct: 1466 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVT 1525

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            DCKEF QSV NVERSIEIGNLSD SKFHPLDRVL KV+P LP+ RKK DLL+DE+ L+L+
Sbjct: 1526 DCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLL 1585

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            EF+ LM+ +GED +DKF++NSFF+KFADFI E++KA+  N+K+     AYER K+M+E+Q
Sbjct: 1586 EFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQ 1645

Query: 1720 QRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARK 1779
            QRK +  ++K               +D R  ++KLL++LKN  PS+ DPSS RKRALARK
Sbjct: 1646 QRKQQEADSKATAKNLSTSQEP---SDDRDDIEKLLDKLKNAAPSKGDPSSTRKRALARK 1702

Query: 1780 KMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSKGFRD 1839
            K+L  K G  ++  ++  +S    +   N+ +  +P     AS  +  S  LS SK    
Sbjct: 1703 KLLDGKSG-ASIFDNITADSTIEAFVEQNRTLTESPTAKKSASLPETES--LSSSK---- 1755

Query: 1840 DLSEEEISERAKTLLMGLRGT-----ASPS 1864
                ++ ++RA+ LL+ LRG      ASPS
Sbjct: 1756 ----QDPADRARNLLLELRGPDERKDASPS 1781

 Score =  593 bits (1529), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 391/1079 (36%), Positives = 592/1079 (54%), Gaps = 130/1079 (12%)

Query: 82   NKPLNKKSTLNTQNLSQY-MDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRRLSRQHT 140
            +KPLNK S+LNT NLS Y MD                                +L+R  T
Sbjct: 76   SKPLNKISSLNTHNLSHYTMDPEANSRSQSASLLTSPTKYSYSRRSS------QLTRSST 129

Query: 141  GQXXXXXXXXXXXXYIN--FSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSV 198
             +                  ++F+T DG   L+ P +P+EI  LF +++ KRN+  ++S 
Sbjct: 130  NKSIISSSAVSVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSS 189

Query: 199  EKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPXXXXXXXXX 258
            + Q++++NY + KKWL+VKQD+Q+EFKR+++TK  P+                       
Sbjct: 190  QDQKDMLNYPIEKKWLMVKQDLQSEFKRLKSTK--PR----------------------- 224

Query: 259  XXXXXXXXXXXPMASVASNEYYPMTSPQTKKPTSHELYQ-LTESNASTSTLSSDKTNRPP 317
                            ++N+   M   +T     +  Y+ +  +N S  +L S  ++ PP
Sbjct: 225  ---------------FSANDTQNMLKRKTSTSKLNTQYEGMLHTNESQGSLLS-PSHFPP 268

Query: 318  NRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTTPKDH 377
              YV +II+ K+   E+ DLWV+LRTE LDWV SFLE QG +A+AN+++  +++ T  + 
Sbjct: 269  EYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDNQ 328

Query: 378  ---LSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIEI 434
                  + LE+E + FKC +VL  + + + E     L+T+ +  GL ST++ TR++A E 
Sbjct: 329  NAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLATET 388

Query: 435  FVCMLEKRN--KSR------FEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSH- 485
             + ++ K    KSR      F  ++ SL+    +  N HM               P  + 
Sbjct: 389  LIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESNPQLYQ 448

Query: 486  -LKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNAST 544
              K+LQ WL+ +E T+DGRGKMGSLVGAS + +N+ GEN+I EY + ++V ++ LC  + 
Sbjct: 449  VCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNNE 508

Query: 545  IIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNV 604
             +++R ++RT+L++ G  RI+ K++LL+Y  +   +  +E+  +DD+N +++S+    NV
Sbjct: 509  DVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTENV 568

Query: 605  NLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLV 664
            ++ DPVS+L  L  S KGTE E  L+S++Q+LFLSS++  +E DDP K  +QLKL+DSL+
Sbjct: 569  DMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDSLI 628

Query: 665  TNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKL 724
            +NV + +T D ES  N+AIQRLYDSMQTDE+ARRAILESR LTKKLEE++AE+D L++K+
Sbjct: 629  SNV-AITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDKI 687

Query: 725  SKAENGLVGQLENDLNERDQILAKNQRVTQQLQSXXXXXXXXXXXXXXXXXXXXXXMLTI 784
            SKAENGLVGQL+ +L ERD IL K QRVT+QLQS                      MLTI
Sbjct: 688  SKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLTI 747

Query: 785  LNTRSSTN-DGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQ 843
            +N+++S + +   T+  D      LN ++   IQ VLQ  L + + D   ++++ G  V 
Sbjct: 748  VNSKTSDDLESGSTVQNDP---KPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAVG 804

Query: 844  PNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTXXXXXXXXXXXXXINQQE 903
               RLK+LR +MEDIEN+AR+LEMTNF + + K+                      NQ+ 
Sbjct: 805  SKSRLKLLRSKMEDIENQARELEMTNFADVKPKQ----------------------NQKF 842

Query: 904  SNDQKS-RINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKY 962
                K  +  KL +LR+ LA IQ ESN+I+KFN+E RVNELF +KKL AL RLK+LE KY
Sbjct: 843  KEQVKGQQATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKY 902

Query: 963  KDFGINF----EMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQ 1018
              F I+F    E+K+ L    N G           SLDP I ++K+++++ + ++L  L+
Sbjct: 903  NGFHIDFADDPELKELLTQSSNGGP----------SLDPTIVQRKVEEMNSIIDELNALK 952

Query: 1019 KTQELRXXXXXXXXXXXXXXXXXXXXIFV-----ASSSSKPAGSGTRSFLETLSEKYGTG 1073
            +  + R                            AS  S    +G+ SFLE+LS+KY TG
Sbjct: 953  EEMKNRPKTGSSSSSSSSLSSASSSSEDGSSQSQASHGSDIVSNGS-SFLESLSQKYSTG 1011

Query: 1074 QKNVAMTATPNSRIVTQS--------EKQFLDRMRRSS---TAA-----PFLQELTEKV 1116
            Q+    T+T   R+  ++         K FL+R++ ++   TA      PFL EL  KV
Sbjct: 1012 QQTA--TSTNGGRVGRETRYPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKV 1068

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  298 bits (764), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 286/501 (57%), Gaps = 30/501 (5%)

Query: 1308 KKMKQLHWEKIETTDNSIWTTGKA-ERFADDLFEKGVFSNLEKAFAAREVKSLASKRK-- 1364
            KK+KQ+HWEKIE  +N+ W   +  E    +L   G+F  +E  F  + V  +  K+K  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1365 -DDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEIT 1423
                + I+FLSRD++QQFGINLH++  LS ++LV+K+L+CD D L   SV+EF  K E+T
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1424 EVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRA 1483
             ++ +L R+ +PY+TD+   +S+     P K+P++LQRAD+I+L+L  NL+ YW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1484 LKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKL 1543
            L ++ T            +K+D A+  +  SE  +N+  +I+ +GN+MN  ++   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1544 STLQRLTFIK-DSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCK 1602
            S L +L FIK ++ N+++FL+Y+E++IR++Y     F+ +L  V E+ KIS++Q+A  C+
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1603 EFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFD 1662
            EF   +  +  +I  G LSD  K HP D++L KV   +   R KG+LL D   L+  +F+
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1663 GLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRK 1722
             +M+ YGED +D  +++ FF+ F +F   ++K  ++N++       Y + K+++E   RK
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIMEASTRK 1230

Query: 1723 AERKEAKXXXXXXXXXXXXXXRTDRRGT-MDKLLEQLKNVGPSRADPSSARKRALARKKM 1781
                ++                 D   T +D LL QL+ V   + +P   RK      K+
Sbjct: 1231 DSDVDS------------GTDNIDGENTAVDSLLAQLRGVD-KKPEPLRTRKSV----KV 1273

Query: 1782 LTDKEGTVNMMHDLETESDSI 1802
            +T K G    + D E E+ ++
Sbjct: 1274 VTIKSGESLPVPDEEKENKTV 1294

 Score = 38.9 bits (89), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 24/170 (14%)

Query: 594 MLESKNKNSNVNLQDPV-SLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTK 652
           +LE  ++ S V++  P  S+L  L      T+ E  + SL+  +  S ++        ++
Sbjct: 404 ILEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNK-----KTYSE 458

Query: 653 LSKQLKLMDSLVT----NVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTK 708
            SK L+ M+S +     N + +     E+    ++  L DS+Q+DE+A+RA+LE      
Sbjct: 459 SSKLLQFMESFLQYSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRAMLE------ 512

Query: 709 KLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQS 758
            L+E Q++ ++L  +L+K  N      E  +++ D IL + ++VT  L+S
Sbjct: 513 -LDEKQSQMNILSNQLTKLRN------EKTMDKSD-ILDQLKQVTDLLES 554

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  298 bits (762), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 150/426 (35%), Positives = 265/426 (62%), Gaps = 13/426 (3%)

Query: 1309 KMKQLHWEKIETTDNSIWTTGKAERFADD-LFEKGVFSNLEKAFAAREV---KSLASKRK 1364
            K++Q+HW+ IE    + W+  +  +     L E GVF  +E+ F  ++    K   +K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1365 DDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITE 1424
             +L K++FLSRD++QQFGINLHM+S+ +V +LV K+L C+ + +   SV+EF +K ++T 
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1425 VSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRAL 1484
            +S ++ +N+ PY+T+      +   + P KD ++L+RAD+I+L+L  NL+ YW +RMR L
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1485 KIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLS 1544
             I+ T            +K+D A  +++ S+ L+ +  +I+ +GNYMN+  +QA+G KLS
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1545 TLQRLTFIKDSTNS-MTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKE 1603
            +L +L F+K STN+ M+FL+Y+E+I+R  Y      + +L  +  + K++++Q+  DC+E
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1604 FFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDG 1663
            F + + N+ERS + G+LS +  FHP D +++K    +P  ++K  LL D+  LT+ + + 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1664 LMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRKA 1723
            LM   GE+  D  A+N+FF+ F DF++ ++KA  +NI+       YE+ K+++E ++R  
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKERSC 1270

Query: 1724 ERKEAK 1729
               E++
Sbjct: 1271 GNMESQ 1276

 Score = 60.8 bits (146), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 128/271 (47%), Gaps = 22/271 (8%)

Query: 492 WLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRML 551
           W  SIE  I       S++   T +     +  + +YCL T+  +N +   +T  +++ L
Sbjct: 287 WFSSIETAISSPK---SMLTQDTSVILPKPQQQLTDYCLSTLFLINSIIQVTTSYREKEL 343

Query: 552 LRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVS 611
           L  K +  G  R+  K K      + DEI  Y+  ++++  +   S    + +++    S
Sbjct: 344 LIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYK--EVEEEVITRSSPELPTFLDISYG-S 400

Query: 612 LLNNLWQSCKGTENEKLLISLIQHLF-LSSSRLIEEVDDPTKLSKQLKLMDSLVTNVS-- 668
           +L  L    + T  E  L  L++ +  +S +R   E        K  KL  S++  +   
Sbjct: 401 ILKTLILETRSTPLEHPLYQLLEGVLQISVTRTSSES------IKLFKLFHSILCYLKDH 454

Query: 669 ---SSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLS 725
              S S    ES +  ++ ++ DS+Q+DE+ARRA+ E  +L + +++L AE + L E+  
Sbjct: 455 TFDSDSGEGPESALKTSLNQMMDSLQSDEIARRAMKELNSLQETVDQLTAEVESLKEERK 514

Query: 726 KAENGLVGQLE---NDLNERDQILAK-NQRV 752
             +  ++ QLE     L ++D+ L + N+R+
Sbjct: 515 VTKGEVIMQLEEARESLRDKDETLKQLNERI 545

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  296 bits (757), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/429 (35%), Positives = 265/429 (61%), Gaps = 15/429 (3%)

Query: 1304 PRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAF----AAREVKSL 1359
            P+S  ++KQ+HWEK++    ++W         D L ++GVFS +EK F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            A + ++   KI+FL+RDI+QQFGINLHMYS LSVE+ VTK+LKC+ D +   SV+ F +K
Sbjct: 875  A-ENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             ++T++   L R ++PY+T++      +D+  PEKDP +L+RAD IYL+L  NL+ YW++
Sbjct: 934  EDLTQIPSGLERKFAPYSTNY----LTDDS--PEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            R   L ++TT             K+D+A+  L +S  ++ +  +I  +GNYMN  S    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1540 GFKLSTLQRLTFIKDST-NSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLA 1598
            G KL++L +L+F+K S+  +++FL++VE+++R ++P   +F +++  V ++ K+++E + 
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1599 NDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTL 1658
             +C+EF + V +V  S+  G LSD +K HP D +  K+   +   + K +LL ++  LT 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1659 MEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEE 1718
               + LM+ YGE+  DK ++N+FF  F +F   ++K  ++NI+       YE+ K ++E+
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1719 QQRKAERKE 1727
            + +K E +E
Sbjct: 1226 RNKKIEEQE 1234

 Score = 39.7 bits (91), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 96/203 (47%), Gaps = 26/203 (12%)

Query: 525 ILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLEN-SGFLRIMNKIKLLNYEKVIDEIESY 583
           ++EYC   M  VN +       +++  +    EN   F  ++  I+ L+ E    +I+ Y
Sbjct: 266 LVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKY 325

Query: 584 ENNKLDDFNLMLESKNKNSNV-NLQDPVS---LLNNLWQSCKGTENEKLLISLIQHLF-- 637
            + KL       E   +NS V ++ + VS   +L +L    K T  E  L +L   +F  
Sbjct: 326 RDVKL-------EIMTRNSCVPSILEDVSYSQVLTDLVIQTKNTALESGLGNLFTLVFQV 378

Query: 638 LSSSRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTADE-----ESTMNMAIQRLYDSMQT 692
           + + +L E +       K LKL+  LV  ++   T ++     +     AI  L D++Q+
Sbjct: 379 IHTKKLNECI-------KFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQS 431

Query: 693 DEVARRAILESRTLTKKLEELQA 715
           +++ RRA++E +TL K + EL +
Sbjct: 432 EDLTRRAMVEIKTLEKNITELNS 454

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  294 bits (753), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 159/421 (37%), Positives = 255/421 (60%), Gaps = 26/421 (6%)

Query: 1309 KMKQLHWEKIETTDNSIWTTGKAERFA--DDLFEKGVFSNLEKAF----AAREV-KSLAS 1361
            K+KQ+HW+KI+    ++W+  K ER +   +L   GVF  +E+ F    AA +V  ++ +
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDK-ERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFT 873

Query: 1362 KRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPE 1421
             +     K+T LS D++QQFGINL+++S+ SVE+LV K+L CD + +   SVIEF SK +
Sbjct: 874  AQNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDD 933

Query: 1422 ITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRM 1481
            I  +  ++ R ++PY T++           PEKD   L RAD+IYL+L  NL+ YWA R 
Sbjct: 934  INHIPQSIQRMFAPYETNYL------TGDKPEKDSRSLDRADRIYLELFYNLRSYWAPRA 987

Query: 1482 RALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGF 1541
            + L  + T            +++D    +++ S+ L+ +  +I+ VGNYMN+  KQA G 
Sbjct: 988  KYLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGI 1045

Query: 1542 KLSTLQRLTFIKDST-NSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAND 1600
            +LS+L +L F K S  N+++F++ +E I+R+NYP  + F+ +LE +L+V  I ++ +  +
Sbjct: 1046 QLSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQE 1105

Query: 1601 CKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLME 1660
             +EF++ ++ +ERS+ +G LSDSSKFHP D+ L      +    KK DLL  +  LT+ E
Sbjct: 1106 AQEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGE 1165

Query: 1661 FDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQ 1720
            FD LM  +GED ++ F++N+FF+KF DF   ++KA ++NI         ER  R V E +
Sbjct: 1166 FDKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENI---------EREVRRVCESR 1216

Query: 1721 R 1721
            R
Sbjct: 1217 R 1217

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  288 bits (736), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 151/413 (36%), Positives = 249/413 (60%), Gaps = 30/413 (7%)

Query: 1304 PRSQK-KMKQLHWEKIETTDNSIW--------TTGKAERFADDLFEKGVFSNLEKAFAA- 1353
            P SQ+ K+KQ+HW+KI+    ++W        T+ K E F       GVF  +E  F   
Sbjct: 765  PTSQRVKLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVV 817

Query: 1354 ----REVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLH 1409
                +   S +  +     KI  LS D++Q FGINLH++S  S E+L+  +L C  + L 
Sbjct: 818  PATPKTASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQ 877

Query: 1410 TPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQL 1469
               VIEF SK +I  +  +  R ++PY T++         K P+KDP  L+RAD+IYL+L
Sbjct: 878  NQRVIEFFSKDDINHIPQSTQRMFAPYETNYL------TGKTPDKDPAVLERADRIYLEL 931

Query: 1470 MVNLQPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGN 1529
              NL+ YWA+R + L ++ T            +++D A  +++ S+ L+ +F +I+ +GN
Sbjct: 932  FYNLRSYWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGN 991

Query: 1530 YMNDTSKQAQGFKLSTLQRLTFIKDST-NSMTFLNYVEKIIRMNYPSFNSFLQELEPVLE 1588
            YMN+  KQA G +LS++ +L F K S  N+++F++ +E+IIR  YP  ++F ++LE V +
Sbjct: 992  YMNN--KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQD 1049

Query: 1589 VVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGD 1648
            +  I ++ +  + +EF + ++N+ERS+ +G LSDSS+FHP D+ L+K   ++   RKK +
Sbjct: 1050 MANIIVQHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAE 1109

Query: 1649 LLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIK 1701
            LL D+  LT+ +F+ L+  +GEDT D  +RN+FF+KF DF+  ++KA ++NI+
Sbjct: 1110 LLIDQSTLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIE 1162

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  289 bits (740), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 152/433 (35%), Positives = 256/433 (59%), Gaps = 21/433 (4%)

Query: 1304 PRSQKKMKQLHWEKIETTDNSIWTTGKAERFA--DDLFEKGVFSNLEKAFAAREVK---- 1357
            P ++ K+KQ+HW+KIE    ++W   + +R +   +L   G+F  +E+ F  +       
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWC-DEQQRVSKSSELESLGIFKEIEELFEIKPASTNLA 1218

Query: 1358 -SLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEF 1416
             + AS  K    +I+ LSR+++Q+FGINLH++S  +VE+LV K+L CD + +    V+EF
Sbjct: 1219 NATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGVLEF 1278

Query: 1417 LSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPY 1476
              K E   V  ++ R + PY T++         + PEKDP +L+RAD+IYL+L  NL+ Y
Sbjct: 1279 FCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERADRIYLELFYNLRSY 1332

Query: 1477 WASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSK 1536
            WA+R   L +I+T            +++D A  ++Q S  L+ +F +I+ +GNYMN   K
Sbjct: 1333 WAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ--K 1390

Query: 1537 QAQGFKLSTLQRLTF---IKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKIS 1593
              QG +LS+L +L F   IKD  N+++F++ +E+I+R  YPS + F++ +  +  V  I 
Sbjct: 1391 PVQGIQLSSLNKLAFTKTIKD--NNLSFIHVLERIVRTRYPSVHDFVEGINSITGVANII 1448

Query: 1594 IEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDE 1653
            ++ +  +  EF   + N++RS+  G LSD SKFHP DR L +    L   +KK  LL D+
Sbjct: 1449 VQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLLRDQ 1508

Query: 1654 VNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHK 1713
             +LT+ +F+ LM  +GE+ ++  ++N+FF+KF DFI  +RKA ++N +       YE+ +
Sbjct: 1509 CSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDRTYEKRR 1568

Query: 1714 RMVEEQQRKAERK 1726
            R++E+     +R+
Sbjct: 1569 RLLEQTAALQDRR 1581

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 104/242 (42%), Gaps = 22/242 (9%)

Query: 492 WLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRML 551
           WL ++E TI    +        +  +    +  +++YC+ TM  +N L       Q +  
Sbjct: 283 WLAAVETTITDEAQW-----RRSPFRAQSPQQFMIDYCVSTMFLINALIQGMPSYQAKGK 337

Query: 552 LRTKLENSGFLRIMNKI----KLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQ 607
               L ++G  RI ++I    +  + E ++DEI  Y+  + +     +     +  V+  
Sbjct: 338 TIRLLRDAGIHRIFHRIVSSGEKFDSEILLDEISKYQTRETEINAKFVPETPPSRYVSFA 397

Query: 608 DPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNV 667
             +  + +L Q   GT  E  +      L L S R I       + +K L+L  S+   +
Sbjct: 398 AQIKTIVSLTQ---GTSLESSMA-----LVLDSIRQIITSRTSAEAAKLLQLFHSIFKYL 449

Query: 668 SSSSTADEE----STMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEL-QAEKDLLHE 722
            + S   EE    S +  A+ +L D +Q+ +V +RA+ E      ++E+L +A   L H+
Sbjct: 450 IAHSYDREELGTESVLRAALNKLMDDLQSTQVNQRAVQELEAAHAQIEDLKKAVTKLEHQ 509

Query: 723 KL 724
           K 
Sbjct: 510 KF 511

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  288 bits (737), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 151/424 (35%), Positives = 248/424 (58%), Gaps = 13/424 (3%)

Query: 1304 PRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKG-VFSNLEKAFAAREV---KSL 1359
            P+  K +KQ+HW+K+E  DN+IW      R      E G +F+ +E +F  +EV   KS 
Sbjct: 995  PQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKKSK 1054

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
              K K+  +  +FLSRD++QQFGINLHMYS+ + ++ +  +L C  + +   SV+EF  K
Sbjct: 1055 TEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFFCK 1114

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             ++  +  +++RNY+PY+ D+         + P KD ++L+RAD+++L+L  NL+ YWA 
Sbjct: 1115 EDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYWAD 1168

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            R + L ++ T            +K+D A+  L  S+  R+   ++L +GNYMN   K  +
Sbjct: 1169 RSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKTVE 1226

Query: 1540 GFKLSTLQRLTFIKDSTNS-MTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLA 1598
            G K+S+L +L FIK S+N+ ++FL+++EK+IR  YP    F+ +L  V ++ K+++E + 
Sbjct: 1227 GVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEHIG 1286

Query: 1599 NDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTL 1658
             +C EF   V +V  S+  G LS S K HP D +L KV   +   + K +LL D+ NLT 
Sbjct: 1287 TECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNLTK 1346

Query: 1659 MEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEE 1718
             +   L+  YGED  DK + +SFF    +F++ ++K  ++NI+       YE+ K M+E 
Sbjct: 1347 HDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNMLES 1406

Query: 1719 QQRK 1722
            Q +K
Sbjct: 1407 QSKK 1410

 Score = 42.4 bits (98), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 676 ESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQL 735
           EST+  +I  L D +Q+DE+ARRA+ E ++L + ++ LQ+E   L E+    +  L+ QL
Sbjct: 504 ESTVQNSINELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQL 563

Query: 736 E 736
           +
Sbjct: 564 K 564

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  287 bits (735), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 251/417 (60%), Gaps = 17/417 (4%)

Query: 1309 KMKQLHWEKIETTDNSIWTTGKAERFAD--DLFEKGVFSNLEKAF-----AAREVKSLAS 1361
            K+KQ+HW+KI+    ++W   +++R +   +L   G+F  +++ F     +     + A+
Sbjct: 961  KLKQIHWDKIDDIKETVWC-DQSQRVSKSTELASFGIFQEIDELFQLNPTSPAIANATAN 1019

Query: 1362 KRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPE 1421
              K    K++ LSR+++Q+FGINLH++S  +VE+L +K+L CD + L   SVIEF  K E
Sbjct: 1020 LLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFCKEE 1079

Query: 1422 ITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRM 1481
            I  +  ++ + ++PY+ ++         + P++DPN+L RAD+IYL+L  NL+ YW +R 
Sbjct: 1080 INNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDRADRIYLELFYNLRSYWGARS 1133

Query: 1482 RALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGF 1541
            + L +I T             ++D A  +LQ S  L+ +F +I+ +GNYMN   +   G 
Sbjct: 1134 KYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPVAGI 1191

Query: 1542 KLSTLQRLTFIKDST-NSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAND 1600
            +LS+L +L F K ST N+M+F++ +E+I+R  YPS + F++ L+ +LEV  I ++ +  +
Sbjct: 1192 QLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHVQQE 1251

Query: 1601 CKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLME 1660
              EF   + ++ER   IG LSD S+FHP D+ + K    +   +KK DLL D+  LT+ +
Sbjct: 1252 AHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLTMSD 1311

Query: 1661 FDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVE 1717
            F+ LM  +GE+ ++  ++NSFFKKF DFI  +RKA ++N +       YE+ +R +E
Sbjct: 1312 FEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRALE 1368

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 126/285 (44%), Gaps = 37/285 (12%)

Query: 492 WLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRML 551
           WL ++E TI    +    V +     N   +  +++YC+ TM  +N L       + +  
Sbjct: 289 WLEAVETTIKDETQWHDDVPS-----NQKPQQLMIDYCVSTMFLINSLIQGIPTYRGKSR 343

Query: 552 LRTKLENSGFLRIMNKI----KLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQ 607
           L   L+++G  RI ++I    +  + E ++DEI  Y++ + +  +  +     + NV+ +
Sbjct: 344 LIRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQSREGEINSKFVIDTPTHLNVSFK 403

Query: 608 DPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNV 667
             +  +  L Q   GT  E  +      L L S R I       + +K L+L  S+   +
Sbjct: 404 SQIKTIVTLTQ---GTSLESYMT-----LVLDSIRQIVTSRTSAEATKLLQLFQSIFKYL 455

Query: 668 SSSSTADEESTMNMAIQ----RLYDSMQTDEVARRAILESRTLTKKLEE-------LQAE 716
              S  DEE    +A+Q    +L D +Q+ +V +RA+ E   +  K+EE       L+ +
Sbjct: 456 IEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMKRVIAKLEHQ 515

Query: 717 KDLLHEKLSKAENGLVGQLENDLN---------ERDQILAKNQRV 752
           K++    ++K  N     L   L+         E  +IL KN+R+
Sbjct: 516 KEIAKSVIAKELNATKAALSIKLDYITELEERLESVEILRKNERM 560

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  282 bits (721), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 147/424 (34%), Positives = 243/424 (57%), Gaps = 13/424 (3%)

Query: 1305 RSQKKMKQLHWEKIETTDNSIWT-TGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKR 1363
            + ++ +KQ+HWEK+   + ++W    + +    +L   G+FS +E++F  +E     +K 
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1364 KDDLDKI---TFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKP 1420
            KD  +K    +FL RD++QQFGINLHM+S  S E  V K+L+CD + +   + +EF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1421 EITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASR 1480
            ++  V+ +L R + PY+TD+      ED   P KDP +L R D+I+L+L  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1481 MRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQG 1540
               L  +TT            +K+D  +  L+     +++  +I+ +GNYMN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1541 FKLSTLQRLTFIKDSTNSMT-FLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
             KLS+L +L F+K S +  T FL+++E+IIR+ YP    F  +L  V ++ KIS++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            +C EF   +  V  +++ G LSD S+ HP D ++ K+   +   + K DLL D+  L  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
            +   LM  +GED +D  A+NSFF+ F +F   ++K  ++NI+       YE+ K M+E +
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1720 QRKA 1723
            QR A
Sbjct: 1210 QRTA 1213

 Score = 42.0 bits (97), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 75/357 (21%), Positives = 142/357 (39%), Gaps = 72/357 (20%)

Query: 389 FFKCFKVLSMLSQGIYEFSKH--------KLMTDTIARGLFSTRLGTRKMAIEIFVCMLE 440
           + +CFK L    QG  +            KL+ D +      TRL  + ++ E+ +    
Sbjct: 221 YLRCFKTLMNHKQGRLQILNKPPLLMFFCKLLNDDV------TRLKCKVVSAEMLL---- 270

Query: 441 KRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHLKVLQAWLFSIENTI 500
                    +L  +D+++      H             HL+P       Q W   +  T+
Sbjct: 271 ---------MLTYVDEDYGYEKVLH-------------HLSP-----CFQGWFNYMAKTL 303

Query: 501 D---GRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLE 557
                  +  S +G    LK    E    ++   +++ VN +  A     Q++ L   L+
Sbjct: 304 SRDPSEFRDASFLGG---LK---PEKCRADFMTTSLLVVNSILQALPTKDQKVSLMQTLK 357

Query: 558 NSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNNLW 617
             G     + IK L  +    +I  Y    L+    ++E+ +    ++       L+ L 
Sbjct: 358 ECGIHHCFHLIKQLQVDDTDKQIAIY----LELETELIEATSAADQIDDSVYQPALHYLL 413

Query: 618 QSCKGTENEKLLISLIQHLFLSSSRLI--EEVDDPTKLSKQL-KLMDSLVTNVSSSSTAD 674
              KGT    L+   + HLF S ++++      +  KL + L  ++D L+ N   + + +
Sbjct: 414 SRTKGT----LIEQDLAHLFESLNKILATRTTSESIKLFRSLGSILDYLIDNFCQAVSTE 469

Query: 675 EESTMNMAIQRLYDSMQTDEVARRAILESR-------TLTKKLEELQAEKDLLHEKL 724
             S +  +I +  D+++++E+ RRA+ E          L K+L EL+  KD+  EKL
Sbjct: 470 PASLVQESINKFLDNLESEEIGRRAMKEMTELENTIVVLRKELSELRDFKDISKEKL 526

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  278 bits (710), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 153/478 (32%), Positives = 277/478 (57%), Gaps = 45/478 (9%)

Query: 1308 KKMKQLHWEKIETTDNSIWT--TGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRKD 1365
            K +KQ+HW+KIE   +++W   T +++   +DL EKGVF+ +   F   E K++  K+K 
Sbjct: 801  KPLKQIHWDKIEDISDTLWNEPTTRSD-LKEDLNEKGVFNEIVNLF---EQKAVRMKKKS 856

Query: 1366 DL------DKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
            ++      +K++ LSRD++QQFGINLHM+SS SVEDL+ K+L+CD D +   SV+EF +K
Sbjct: 857  NVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVLEFFNK 916

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             +   +  ++ R++ PY +DW+        K P++D + L+RAD+IYL++  N++ YW  
Sbjct: 917  DDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNMRYYWKI 970

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            R  +L I  T            +K+D     ++ S  L+  F +++ +GN+MN+  K+ Q
Sbjct: 971  RSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN--KKTQ 1028

Query: 1540 GFKLSTLQRLTFIK-DSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLA 1598
            G KLS+L +L+ +K +S  +++FL+ +E+IIR  YP    F ++L  + ++ KI+IE + 
Sbjct: 1029 GIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKINIESIE 1088

Query: 1599 NDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTL 1658
            ++  E+++ +  ++ S E G LS + K HP D+   K+   LP   +K +LL+++  LT+
Sbjct: 1089 SEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQCKLTM 1148

Query: 1659 MEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMV-- 1716
             +F+  M+  GED ++  A+N+FF+ F++F+  + K  ++N +       +E+ ++++  
Sbjct: 1149 NDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQQLLQK 1208

Query: 1717 ---EEQQRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSA 1771
               E Q  K+   EA                     T+D L+++L++V P +  P S+
Sbjct: 1209 ASTETQVEKSADDEAA-------------------DTIDILIKKLRSVDPQQTIPGSS 1247

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  278 bits (711), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 150/461 (32%), Positives = 252/461 (54%), Gaps = 31/461 (6%)

Query: 1274 VPPPALPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETTDNSIWTTG-KAE 1332
            V PPA PL  G                   P ++K++KQ+HW+K+E   +++W  G + +
Sbjct: 842  VTPPAPPLPNGLLSLSSASIDSMTVNLAPVP-TEKRLKQIHWDKVEDIKDTLWEDGLQRQ 900

Query: 1333 RFADDLFEKGVFSNLEKAFAAREVKSLASK---------------RKDDLDKITFLSRDI 1377
                 L   G+FS +E  F  +    +A+K                 ++L KI+FLSRD+
Sbjct: 901  ETIRGLQTDGIFSQIEDIFKMKSPTKIANKTSAISSTVLSSNNGKSSNELKKISFLSRDL 960

Query: 1378 SQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYT 1437
            +QQFGINLHM+S LS  + V K+LKCD D +   ++++F  K E+  +  +L   Y PY+
Sbjct: 961  AQQFGINLHMFSQLSDMEFVMKVLKCDNDIVQNVNILKFFCKEELVNIPKSLLNKYEPYS 1020

Query: 1438 TDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXX 1497
                G           K  +DLQRAD+I+L+L +NL+ YW  R ++L  ++T        
Sbjct: 1021 RGENG-----------KAASDLQRADRIFLELCINLRFYWNVRSKSLLTLSTYERDYYDL 1069

Query: 1498 XXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTN 1557
                + +D  +  L  S+  +N+  +I  +GN+MN   +  +G KL +L +L F++ ST+
Sbjct: 1070 IFKLQNIDDGISHLNRSDKFKNLMFIITEIGNHMN--KRIVKGIKLKSLTKLVFVRSSTD 1127

Query: 1558 -SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIE 1616
             +M+FL+++EKIIR+ YP    F+ +L+ V ++ KIS+E +  +C EF   + N+    +
Sbjct: 1128 QTMSFLHFIEKIIRIKYPDIYGFVDDLKKVEDLGKISLEHIEIECHEFHNKIENLVTQFQ 1187

Query: 1617 IGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKF 1676
             G LS+     P D+++ KV   +   R K +LL D+  LTL++ + LM+ YGED +DK 
Sbjct: 1188 TGKLSNEENLDPRDQIVKKVKFKINRARIKSELLMDQCKLTLIDLNKLMRYYGEDPNDKE 1247

Query: 1677 ARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVE 1717
            ++N FF+ F +F+  ++K  ++NI+       YE+ K ++E
Sbjct: 1248 SKNEFFQPFIEFLTMFKKCAKENIEKEEMERVYEQRKNLLE 1288

 Score = 42.7 bits (99), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 25/109 (22%)

Query: 655 KQLKLMDSLV----------------TNVSSSSTADEESTMNMAIQRLYDSMQTDEVARR 698
           K LKLM+SL+                 N+ S+  AD  S    ++ +L DS+Q+DE+ARR
Sbjct: 470 KLLKLMNSLLFYLIDSFQVPTNPSFDENIESAENAD--SVFQDSVNKLLDSLQSDEIARR 527

Query: 699 AILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILA 747
           A+ E   L KK+         L+EKL   EN     L   L+E + +++
Sbjct: 528 AVTEIDDLNKKISH-------LNEKLDLVENCSKDHLIKKLDESEALIS 569

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  272 bits (696), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 248/434 (57%), Gaps = 14/434 (3%)

Query: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAER-FADDLFEKGVF---SNLEKAFAARE 1355
             ER  +  +++KQ+HW+KIE    +IW   +     A  L E G+    S+L K   +  
Sbjct: 911  MERKEQDSQRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAP 970

Query: 1356 VKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIE 1415
             K+  + R ++   +  L RD++QQFGINLHM+S+LSVED V K+L CDR  +   SV+E
Sbjct: 971  TKA-NTGRLNEEGPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLE 1029

Query: 1416 FLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQP 1475
            F ++ ++  +  +L+  + PY++D+         K P KD + L+RAD+I+L L  NL+ 
Sbjct: 1030 FFARDDLVNIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRS 1083

Query: 1476 YWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTS 1535
            YW  R   L  + T            ++VD A+  ++ S  L++   +I+ +GNYMN   
Sbjct: 1084 YWRQRSICLLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--R 1141

Query: 1536 KQAQGFKLSTLQRLTFIKDSTN-SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISI 1594
            KQA G KLS+LQ+L F+K S + +++FL+ VE+ +R+   +   F+ EL  VL++  + +
Sbjct: 1142 KQAPGIKLSSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVV 1201

Query: 1595 EQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEV 1654
             Q+  D +E+ + +  V++S++ G LSDS  FHP DR+L KV P +    +K  LL ++ 
Sbjct: 1202 GQVEQDFQEYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQF 1261

Query: 1655 NLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKR 1714
             LT+   + LM++YGED      RN FF  F  FI +++KA ++NI+       Y   K 
Sbjct: 1262 KLTMRALENLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKE 1321

Query: 1715 MVEEQQRKAERKEA 1728
            +++++ + + + +A
Sbjct: 1322 LLQQKTKASSKNDA 1335

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 114/237 (48%), Gaps = 20/237 (8%)

Query: 527 EYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENN 586
           +YCL ++  +N +   ++ + +++    +L+     R+   +  L + ++  EI+ Y++ 
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEIDKYKS- 406

Query: 587 KLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLF--LSSSRLI 644
            L++  +   +      +N+     L N + Q+     ++  L   +  LF  LS + + 
Sbjct: 407 -LEEEVIQKTNPEFPQLLNVSYGKFLTNIIHQT-----HQNPLEHCMHQLFETLSKTLVA 460

Query: 645 EEVDDPTKLSKQLKLMDSLVTNVSSSSTADE----ESTMNMAIQRLYDSMQTDEVARRAI 700
             + D  K+   L L  S++  +   S  +E    +S +N+++  L D +Q+DE+A+RA+
Sbjct: 461 RTMSDNLKV---LTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRAM 517

Query: 701 LESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQ 757
            E     K++E L++E   L +     + G++ +L     +  Q LA+ +   ++L+
Sbjct: 518 SELELAQKEIENLESEIRALRKDKEITKGGVLSELR----QTQQALAEKETAIEKLE 570

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  271 bits (692), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 242/431 (56%), Gaps = 30/431 (6%)

Query: 1304 PRSQKKMKQLHWEKIETTDNSIWTTG-KAERFADDLFEKGVFSNLEKAFAAREVKSLASK 1362
            P  ++++KQ+HW+++E   +++W    + +    +L   GVFS +E  F  R    +ASK
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1363 RK---------------DDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDF 1407
                             ++L K++FLSRD++QQFGINLHM+S LS  + V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1408 LHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYL 1467
            +   ++++F  K E+T +  +L   Y PY+   EG           K  +DLQRAD+I+L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1468 QLMVNLQPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAV 1527
            +L +NL+ YW  R + L  ++T            +K+D  +  L  S   +N+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1528 GNYMNDTSKQAQGFKLSTLQRLTFIKDSTN-SMTFLNYVEKIIRMNYPSFNSFLQELEPV 1586
            GN+MN   K  +G KL +L +L F++ S + +M+FL+++EKIIR+ YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1587 LEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKK 1646
             ++ KIS+E +  +C EF+  + N+    + G LS      P D+++ KV   +   + K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1647 GDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXX 1706
             +LL  +  LTL++ + LM+ YGED SDK ++N FF+ F +F+  ++K  ++NI+     
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1707 XAYERHKRMVE 1717
              YE+ K ++E
Sbjct: 1278 RVYEQRKSLLE 1288

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 75/153 (49%), Gaps = 25/153 (16%)

Query: 609 PVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNVS 668
           PV + N L    K +  E  +  +IQ L+    ++++     ++  K LKL++SL+  + 
Sbjct: 429 PVCIENCLLLKVKDSPIETPINEIIQSLW----KILDSKKPYSESIKLLKLINSLLFYLI 484

Query: 669 SS------STADE--------ESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQ 714
            S      S+ DE        +S    ++ +L DS+Q++E+ARRA+ E   L  K+ +  
Sbjct: 485 DSFQAPICSSFDENLDLAQNVDSVFQDSVNKLLDSLQSNEIARRAVTEIDDLNNKILD-- 542

Query: 715 AEKDLLHEKLSKAENGLVGQLENDLNERDQILA 747
                L+EKL+  EN     L   L+E + +++
Sbjct: 543 -----LNEKLNLVENYSKDHLIAKLDESEALVS 570

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  270 bits (689), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/432 (32%), Positives = 256/432 (59%), Gaps = 18/432 (4%)

Query: 1305 RSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFE---KGVFSNLEKAFAAREVKSLAS 1361
            +S+KK+KQ+HW+KIE   N++W    A+   D + E    G+F  ++  F+ +++  +  
Sbjct: 854  QSKKKLKQIHWDKIENVKNTLW--DHADGRQDTILELEHAGIFEKVQGMFSVQDL-VVKP 910

Query: 1362 KRKDDLDK----ITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFL 1417
            KR  ++ +    ++FLSRD SQQ  INLH+++ L+ ++++ K+L CD D +   SV+EF 
Sbjct: 911  KRAVNVRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFF 970

Query: 1418 SKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYW 1477
             K E+  +     R+++PY+ D+     +  ++ P K+P++L+RAD+++L L  NL+ YW
Sbjct: 971  CKDEMVNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYW 1025

Query: 1478 ASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQ 1537
            A R + L +I+T            +K+D A+ +++ SE  +    +I+ +GNYMN  +K 
Sbjct: 1026 AERSQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKA 1083

Query: 1538 AQGFKLSTLQRLTFIKDSTN-SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQ 1596
             +G +L++L +L FIK + N + +FL++VEK++R++YP    F+ +L  V ++ KI+I+Q
Sbjct: 1084 VEGIRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQ 1143

Query: 1597 LANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNL 1656
            +   C+E+   +  +  S+  G LSD ++ HP D++L KV   +   + K +LL  +  L
Sbjct: 1144 VQLQCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKL 1203

Query: 1657 TLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMV 1716
            T  +F   M  YGED  D   + +FF +F +F + +RK   +NI+      AYE+ K++ 
Sbjct: 1204 TNNDFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIA 1263

Query: 1717 EEQQRKAERKEA 1728
            E + +K ER + 
Sbjct: 1264 ELRNKKNERNDT 1275

 Score = 34.7 bits (78), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 659 LMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKD 718
           LMD+   N  S ++   E+    A+ +L DS+ ++E+ +RA+ E + L K ++ L  E D
Sbjct: 478 LMDNFQNNQKSVAS---ETLFQEAVTKLMDSLHSNEITKRAMSELKELEKTVQSLNEEID 534

Query: 719 LLHE 722
            L E
Sbjct: 535 RLRE 538

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  270 bits (689), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/474 (32%), Positives = 254/474 (53%), Gaps = 12/474 (2%)

Query: 1308 KKMKQLHWEKIETTDNSIWTTGKAER-FADDLFEKGVFSNLEKAFAAREV-----KSLAS 1361
            KK+KQ+HW+K+E  +++IW   +  R     L   GV   +E  F  +E      KS A+
Sbjct: 870  KKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKSCAT 929

Query: 1362 KRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPE 1421
            +       ++FLSRD++Q FGINLHM+S+LSV++ V K+L CD D +    V+EF ++ E
Sbjct: 930  EGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFNREE 989

Query: 1422 ITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRM 1481
            +  +S +  R Y+PY   +       +    E  P  L+R D+I+L+L   L+ YW+ R 
Sbjct: 990  LGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWSVRS 1048

Query: 1482 RALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGF 1541
              L ++ T            +K++ A+  L+ES  L+N   +I+ +GNYMN  +K A G 
Sbjct: 1049 HCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAASGV 1106

Query: 1542 KLSTLQRLTFIKDSTN-SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAND 1600
            K+S+L +L FIK S N +++FL+Y+E++IR  YP    F+ +L+ V ++ K++++QL  +
Sbjct: 1107 KISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQLELE 1166

Query: 1601 CKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLME 1660
            C E+   +  +  +++ G LSD +K +P D VL K+         K  LL  ++ L+  +
Sbjct: 1167 CSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLSSND 1226

Query: 1661 FDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQ 1720
             + LM+ YGED  D   +N FF  FA+F+  ++K   +NI+       YE+ ++++E++Q
Sbjct: 1227 MNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLEDKQ 1286

Query: 1721 --RKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSAR 1772
              R    K                   D    +DKLL++L+ V      P   R
Sbjct: 1287 SSRSKSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKPRERR 1340

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  270 bits (689), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 141/420 (33%), Positives = 241/420 (57%), Gaps = 16/420 (3%)

Query: 1305 RSQKKMKQLHWEKIETTDNSIWTTG-KAERFADDLFEKGVFSNLEKAF-----AAREVKS 1358
            + ++ +KQ+HWEKI+  + ++W    + E    +L   G+F  ++  F       ++VK+
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1359 LASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLS 1418
              S +K    K +FLSRD++QQFGINLHMYS   VE+ V K+L+CD D L   SV+EF +
Sbjct: 908  DNSTKKTTQLK-SFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFN 966

Query: 1419 KPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWA 1478
              E+T +  +L+R+++PY+ D++      + K P  DPN+L+R D+I+L+L  NL+ YW 
Sbjct: 967  NEELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYWR 1020

Query: 1479 SRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQA 1538
             R + L I  T            + +D A+  ++ +  L+ +  +I+ +GNYMN   K  
Sbjct: 1021 ERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNV 1078

Query: 1539 QGFKLSTLQRLTFIKDST-NSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQL 1597
             G +L++L +L+F+K S  N+++FL+++EK++R+ YP    F  +L     +  IS + +
Sbjct: 1079 SGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHI 1138

Query: 1598 ANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLT 1657
             ++C+E+   V +V R    G LS  S  HP D ++ KV   +   + K  LL D+  L 
Sbjct: 1139 QSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLI 1198

Query: 1658 LMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVE 1717
              + D LM+ +GE+  DK A+NSFF  F +F   ++K  ++NI+       YE+ K++++
Sbjct: 1199 SADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

 Score = 42.7 bits (99), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 117/248 (47%), Gaps = 30/248 (12%)

Query: 516 LKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEK 575
           L+ +  E   +++   T+  +N +  A T  Q+++ L  +L+ +G  R    +K     +
Sbjct: 377 LQFTNTEQLRIDFASTTLFLINSILQALTDKQRKLQLVKRLKENGIHRCFYLMKDNLKNE 436

Query: 576 VIDE-IESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQ 634
           +IDE IE Y N    +  L+ +  +K S  +L    + L ++  + K T  E+   +LIQ
Sbjct: 437 IIDEQIEIYINT---EHVLIAQFADKPSLADLFYG-NALESIVANTKNTSLEQPFGTLIQ 492

Query: 635 HL--FLSSSRLIEEVDDPTKLSKQLKLM-DSLVTNVSSSSTADEESTMNMAIQRLYDSMQ 691
            +   L S    E V    K+ K L +M   L +N+ ++   D ES    +I  L D+++
Sbjct: 493 SISEMLKSKTTSESV----KVLKALIIMFQFLESNLYNNMEFDPESVFQDSINTLVDNLE 548

Query: 692 TDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLEN--DLNERDQILAKN 749
           +DE+A+RA+ E   L   +  LQ EK               GQLE   D N +DQI+ K 
Sbjct: 549 SDEIAKRAMGEINFLQDAVRSLQEEK---------------GQLEKLRDTN-KDQIIQKF 592

Query: 750 QRVTQQLQ 757
           +  T  L+
Sbjct: 593 EYTTALLK 600

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  269 bits (687), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 153/518 (29%), Positives = 276/518 (53%), Gaps = 43/518 (8%)

Query: 1274 VPPPALPLMGGKXXXXXXXXXXXXXXFERYPRSQKKMKQLHWEKIETTDNSIWT-TGKAE 1332
            V PPA PL  G                 + P ++K++KQ+HW+K+E   +++W  T + +
Sbjct: 843  VTPPAPPLPNGLLSSSSVSINPTTTDL-KPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQ 901

Query: 1333 RFADDLFEKGVFSNLEKAFAAREVKSLASKR---------------KDDLDKITFLSRDI 1377
                +L   G+FS +E  F  +    +A+KR                ++L KI+FLSRD+
Sbjct: 902  ETIKELQTDGIFSQIEDIFKMKSPTKIANKRNAESSIALSSNNGKSSNELKKISFLSRDL 961

Query: 1378 SQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYT 1437
            +QQFGINLHM+S LS  + V K+L CD D +   ++++F  K E+  +  ++   Y PY+
Sbjct: 962  AQQFGINLHMFSQLSDMEFVMKVLNCDNDIVQNVNILKFFCKEELVNIPKSMLNKYEPYS 1021

Query: 1438 TDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRALKIITTXXXXXXXX 1497
               +G           K  +DLQRAD+I+L+L +NL+ YW +R ++L  ++T        
Sbjct: 1022 QGKDG-----------KAVSDLQRADRIFLELCINLRFYWNARSKSLLTLSTYERDYYDL 1070

Query: 1498 XXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTN 1557
                +K+D A+  L  S   +++  +I  +GN+MN   +  +G KL +L +L F++ S +
Sbjct: 1071 IFKLQKIDDAISHLNRSPKFKSLMFIITEIGNHMN--KRIVKGIKLKSLTKLAFVRSSID 1128

Query: 1558 -SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIE 1616
             +++FL+++EK+IR+ YP    F+ +L+ + ++ KIS+E + ++C EF + + ++    +
Sbjct: 1129 QNVSFLHFIEKVIRIKYPDIYGFVDDLKNIEDLGKISLEHVESECHEFHKKIEDLVTQFQ 1188

Query: 1617 IGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKF 1676
            +G LS      P D+++ KV   +   + K +LL  +  LTL++ + LM+ YGED  DK 
Sbjct: 1189 VGKLSKEENLDPRDQIIKKVKFKINRAKTKSELLIGQCKLTLIDLNKLMKYYGEDPKDKE 1248

Query: 1677 ARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQQRKAERKEAKXXXXXXX 1736
            ++N FF+ F +F+  ++K  ++NI+       YE+ K +++   R +  K++        
Sbjct: 1249 SKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKSLLD--MRTSSNKKSNGSDENDG 1306

Query: 1737 XXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKR 1774
                       R  +D L+ +L+ V   + DP   R+R
Sbjct: 1307 EKV-------NRDAVDLLISKLREV---KKDPEPLRRR 1334

 Score = 43.1 bits (100), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 114/228 (50%), Gaps = 44/228 (19%)

Query: 553 RTKLENSGFLR---IMNKIKLL--------NYEKVIDEIESYENNKLDDFNLMLESKNKN 601
           +T LE   FL+   I N I  L        N   ++++I+ +++ +   F+ M+++ N  
Sbjct: 353 KTALEILNFLKKNNIHNTITFLELAYKDDPNSVVIMEQIKQFKSKESAIFDSMIKTTNDT 412

Query: 602 SNVNL--------QDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKL 653
           ++++          +P+ L N L    K +  E  +  +IQ L+    ++++     ++ 
Sbjct: 413 NSLHPTKDIARIESEPLCLENCLLLKAKDSPVEAPINEIIQSLW----KILDSQKPYSES 468

Query: 654 SKQLKLMDSLVT------NVSSSSTADE--ESTMNM------AIQRLYDSMQTDEVARRA 699
            K LKL++SL+        VS++ + DE  ES  N+      ++ +L DS+Q+DE+ARRA
Sbjct: 469 IKLLKLINSLLFYLIDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDSLQSDEIARRA 528

Query: 700 ILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILA 747
           + E       +++L A+   L+EKL+  EN     L   L+E + +++
Sbjct: 529 VTE-------IDDLNAKISHLNEKLNLVENHDKDHLIAKLDESESLIS 569

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  263 bits (673), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/423 (34%), Positives = 249/423 (58%), Gaps = 16/423 (3%)

Query: 1306 SQKKMKQLHWEKIETTDNSIWTT-GKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRK 1364
            S  K+KQ+HW+K+E    +IW+  G+ +  A  L   G    + + F  R  +SL  K K
Sbjct: 917  SNLKLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAK 974

Query: 1365 DDL----DKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKP 1420
             +     DK++ L RD++QQFGINLHM+S+LSV++ V K+L CDRD ++  SV+EF ++ 
Sbjct: 975  SETSSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFARE 1034

Query: 1421 EITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASR 1480
            +++ +  ++A    PY TD +        + P  D   L+RAD+I+L+L  NL+ YW  R
Sbjct: 1035 DLSIIPRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPR 1088

Query: 1481 MRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQG 1540
               L  ++T            ++VD A+  ++ S  L++   +I+ +GNYMN   KQA G
Sbjct: 1089 SLCLLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGG 1146

Query: 1541 FKLSTLQRLTFIKDSTN-SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599
             +LS+LQ+LTF+K S + +M+ L+ VE+ +R+   S   F+++L  VL++  + + Q+  
Sbjct: 1147 IRLSSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQ 1206

Query: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659
            D  E+ Q ++ V++S+E G LS    FHP DR+L KV P +    +K  LL ++  LT+ 
Sbjct: 1207 DFHEYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMR 1266

Query: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEEQ 1719
              + LM++YGED S+  ++N FF+ F +F+++++K  ++N +       Y + K +++ +
Sbjct: 1267 ALENLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNR 1326

Query: 1720 QRK 1722
             ++
Sbjct: 1327 SKE 1329

 Score = 40.0 bits (92), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 42/61 (68%)

Query: 676 ESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQL 735
           ES +++++ +L D++Q+DE+A RA+ E +T    +++L +E  +L ++ S ++  ++ +L
Sbjct: 493 ESVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSEL 552

Query: 736 E 736
           E
Sbjct: 553 E 553

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  259 bits (663), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 139/424 (32%), Positives = 237/424 (55%), Gaps = 14/424 (3%)

Query: 1305 RSQKKMKQLHWEKIETTDNSIWTTGKAER-FADDLFEKGVFSNLEKAFAAREV----KSL 1359
            +  KK+KQ+HW ++     +IW     +R    +L   GVF  ++ +F  ++V     + 
Sbjct: 1138 KEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTD 1197

Query: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419
             +K KD     +FLSRD++QQFGINLH+++S  V +L+ K+L+CD D     +++EF +K
Sbjct: 1198 EAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNK 1257

Query: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479
             E T +S ++ARNY+PY  D++            KD ++L+RAD+I+L+L  NL+ YWA 
Sbjct: 1258 EEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAYWAE 1311

Query: 1480 RMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539
            R + L ++ T            +++D AV  L  S   +    ++L +GN+MN   K A+
Sbjct: 1312 RSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAE 1369

Query: 1540 GFKLSTLQRLTFIKDS-TNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLA 1598
            G  +S+L +L FIK S  N+++FL+++EK IR  +P    F+ +L  V E+  +S++ + 
Sbjct: 1370 GILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHIT 1429

Query: 1599 NDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTL 1658
             +CKEF   V     ++  G LS     HP D++L KV   +   + K + L D+  LT 
Sbjct: 1430 MECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTN 1489

Query: 1659 MEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVEE 1718
                 +++ YGED +D+ +++ FFK  A+F   ++K  ++NI        YE+ K M++ 
Sbjct: 1490 HSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLDN 1549

Query: 1719 QQRK 1722
            + +K
Sbjct: 1550 KLQK 1553

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  253 bits (645), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 135/426 (31%), Positives = 243/426 (57%), Gaps = 28/426 (6%)

Query: 1306 SQKKMKQLHWEKIETTDNSIW--TTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKR 1363
            S+ ++KQ+HW+K+E   +++W  TT + E   + L   G+FS +E  F  ++   +ASK+
Sbjct: 878  SKNRLKQIHWDKVEEIKDTLWEDTTQRQETLKE-LQTDGIFSQIEDIFKMKDPVKIASKK 936

Query: 1364 KDDL-----------DKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPS 1412
              +              ++FLSRD++QQFGINLHM+S +S  + V K+L CD + +   +
Sbjct: 937  NGNSSTSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVN 996

Query: 1413 VIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVN 1472
            +++F  K E+  +  ++   Y PY+   +G KS+          +DLQRAD+I+L+L +N
Sbjct: 997  ILKFFCKEELVSIPKSMLSKYEPYSQG-KGGKSV----------SDLQRADRIFLELCIN 1045

Query: 1473 LQPYWASRMRALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMN 1532
            L+ YW +R ++L  ++T            +K+D  +  L  S   +++  +I  +GN+MN
Sbjct: 1046 LRSYWNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN 1105

Query: 1533 DTSKQAQGFKLSTLQRLTFIKDSTN-SMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVK 1591
               K  +G KL +L +L F++ S + +++FL+++EK+IR  YP    F+ +L+ + ++ K
Sbjct: 1106 --KKMVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGK 1163

Query: 1592 ISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLN 1651
            +S+E +  +C+EF   V       + G LS+     P D+++ KV   +   + K DLL 
Sbjct: 1164 VSLEHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLV 1223

Query: 1652 DEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYER 1711
            D+  LTL++   LM+ YGED +DK ++N FF+ F +F+  ++K  ++NI+       YE+
Sbjct: 1224 DQCKLTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQ 1283

Query: 1712 HKRMVE 1717
             K ++E
Sbjct: 1284 RKNLLE 1289

 Score = 40.4 bits (93), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 7/76 (9%)

Query: 672 TADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGL 731
           T + +S    +I +L DS+Q+D++ARRA++E       +++L  +   L+E++S  EN  
Sbjct: 506 TQNVDSVFQDSIDKLLDSLQSDDIARRAVIE-------IDDLNCKISTLNERISLVENYS 558

Query: 732 VGQLENDLNERDQILA 747
             QL   L+E + +L+
Sbjct: 559 KDQLLTKLDESEILLS 574

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  250 bits (638), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/417 (31%), Positives = 234/417 (56%), Gaps = 27/417 (6%)

Query: 1309 KMKQLHWEKIETTDNSIWT-TGKAERFADDLFEKGVFSNLEKAFAAREVK------SLAS 1361
            ++KQ+HWEK+E  ++++W  + + E  A +L   G+F  +   F  + +K      + AS
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1362 KRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPE 1421
            K+++     T L R+++QQFGINLHM+SSL  ++ V K+L+C+ D +   SV+EF +K E
Sbjct: 912  KKQNG----TLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1422 ITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRM 1481
            +T +  +L + ++PY    E +KS            +L+RAD+I+ +L   L  YW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENIKS----------KFELERADRIFFELCFQLHSYWRERS 1014

Query: 1482 RALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGF 1541
              L I+ T            +KVD  +  L  S   R+   +I+ +GNYMN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1542 KLSTLQRLTFIKDST-NSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAND 1600
            ++ +L +L F+K S  N+++FL+++EKIIR+ YP   SF+ EL  + ++ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1601 CKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLME 1660
             +EF   +  +   +E G LS + +  P D++L K    +   + K +L+  ++ L   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1661 FDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVE 1717
            +  +M+ +GED SD+ ++N+FF    +FI  ++K  ++NI+       YE+ ++M +
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

 Score = 38.1 bits (87), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 108/224 (48%), Gaps = 22/224 (9%)

Query: 525 ILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYE 584
           I EY    M  +N +     +  ++  +  KL++    ++  ++  L+ + + ++I  Y+
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 585 NNKLDDFNLMLESKNKNSNVNLQDPVSL--------LNNLWQSCKGTENEKLLISLIQHL 636
            N   D N+ L+  N+N       P+S+        L  L +  K T  E+ + +L+  +
Sbjct: 383 KN---DENIRLKIINEN-------PLSIPDISYGATLMLLIEKSKSTPLEEPIGALLDSV 432

Query: 637 F--LSSSRLIEEVDDPTKLSKQLK-LMDSLVTNVSSSSTADE-ESTMNMAIQRLYDSMQT 692
              L +    E +     +S  L  L+D L + +SS+  A+  +  +  +I+RL D++++
Sbjct: 433 LKILDTRTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLES 492

Query: 693 DEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLE 736
           DEVARRA+ E R     +++L  E   L  + + ++  ++ QLE
Sbjct: 493 DEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  247 bits (631), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 145/484 (29%), Positives = 260/484 (53%), Gaps = 39/484 (8%)

Query: 1308 KKMKQLHWEKIETTDNSIWTTGKAE-RFADDLFEKGVFSNLEKAFAAREVKSLASKRKDD 1366
            K MKQ+HWEK+  T  S+W           +L   G+FS +E  F +++      KR++ 
Sbjct: 968  KNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDA---VIKRRNP 1024

Query: 1367 LDK-----ITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPE 1421
             D+     +T L R+++QQFGINLHM+S +S +DL  K+L+CD       SVIEF +  +
Sbjct: 1025 KDQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNED 1084

Query: 1422 ITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRM 1481
            +T +  N+ R + PY+ D++   S      P KD ++L R D I+L L  NL+ YW  R 
Sbjct: 1085 LTNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERS 1139

Query: 1482 RALKIITTXXXXXXXXXXXXRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGF 1541
            + L ++ T             ++D+A+ +++ S+ L++V  +I+A+GN+MN   K   G 
Sbjct: 1140 QCLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGI 1197

Query: 1542 KLSTLQRLTFIKDSTNS-MTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAND 1600
            +LS+L +LT+IK ++ S  +FL+++E++IR+ YP    F  +L  V  +  ++++ L  +
Sbjct: 1198 RLSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLE 1257

Query: 1601 CKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLME 1660
              +    +  V RSI+ G LS+    HP D +L KV   +     K  +L D+  LT ++
Sbjct: 1258 YDDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNID 1317

Query: 1661 FDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVXXXXXAYERHKRMVE--- 1717
             + L+  +GED  D   + +FFK  ++F+  +RK  ++NI+       YE+ +++++   
Sbjct: 1318 LEKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSKI 1377

Query: 1718 EQQRKAERKEAKXXXXXXXXXXXXXXRTDRRGTMDKLLEQLKNVGPSRADPSSARKRALA 1777
            + Q  +   E +                D++  +D+LL++L+ V      P++A +R  +
Sbjct: 1378 QAQWDSSMDEIEE---------------DQQDAVDQLLKKLRGV----EQPTTAVRRRKS 1418

Query: 1778 RKKM 1781
             K++
Sbjct: 1419 SKRL 1422

>ZYRO0G10274g Chr7 complement(823030..825732) [2703 bp, 900 aa] {ON}
           similar to uniprot|P25339 Saccharomyces cerevisiae
           YGL014W PUF4 member of the PUF protein family YGL014W
          Length = 900

 Score = 36.6 bits (83), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 73/170 (42%), Gaps = 45/170 (26%)

Query: 360 AMANILMKQIYKTTPKDHLS---------SKLLEKE---NSFFKCFKVLSMLSQGIYEFS 407
           A+ NIL+K +      DHL+           ++ KE   +S+   +KV+ +L   + E S
Sbjct: 753 ALCNILLKHV------DHLTLDPFGNYVVQYIITKEVEQDSYDYTYKVVHLLKPKVVELS 806

Query: 408 KHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGS----- 462
            HK  ++ I + +  TR+ +  M +EI    L  R  +   A+LN    N+ + +     
Sbjct: 807 LHKFGSNVIEK-IIRTRVVSETMIMEI----LNNRGDTDVPALLNDGYGNYVLQTALDVS 861

Query: 463 ---NFHMFQNLKKLPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSL 509
              N ++++ L  +              V    + SI+NT  GR  MG L
Sbjct: 862 HENNEYLYKRLSDI--------------VRPMMIGSIKNTPHGRRIMGIL 897

>Klac_YGOB_Anc_8.398 Chr4 complement(1565442..1567220) [1779 bp, 592
            aa] {ON} ANNOTATED BY YGOB -
          Length = 592

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 1787 GTVNMMHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSKGFRDDLSEEEI 1846
            G+ NM + L + SDSI+  P   A GS PFG+ G+++        SP    +++  +   
Sbjct: 234  GSGNMTNGLASSSDSILGKP---AFGSVPFGSTGSTTS-------SPFGQLQNNAGKNAQ 283

Query: 1847 SERAKTLLMGLRGTASPSKRN 1867
            +  A+T   G   + SP++ N
Sbjct: 284  NSNAQTPPFGTNVSQSPAQTN 304

>Ecym_3438 Chr3 (822940..823872) [933 bp, 310 aa] {ON} similar to
           Ashbya gossypii ADL381W
          Length = 310

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 706 LTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQ 757
           L  KLE L+     +HE LSK  + +   LEN +  R+ IL K+    QQLQ
Sbjct: 27  LKYKLELLE-----IHEDLSKMRDAVTSTLENAIGRREGILGKHMDRLQQLQ 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 179,798,688
Number of extensions: 7810321
Number of successful extensions: 36168
Number of sequences better than 10.0: 513
Number of HSP's gapped: 37611
Number of HSP's successfully gapped: 686
Length of query: 1957
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1832
Effective length of database: 39,148,149
Effective search space: 71719408968
Effective search space used: 71719408968
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 74 (33.1 bits)