Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D022505.699ON55655627050.0
ZYRO0G06666g5.699ON5035505288e-60
TDEL0B022205.699ON4895504735e-52
YIL146C (ATG32)5.699ON5295934475e-48
Skud_9.225.699ON5375624203e-44
Smik_9.235.699ON5275614151e-43
CAGL0H06545g5.699ON4924614016e-42
KNAG0L021005.699ON4445403696e-38
Suva_9.435.699ON5133663462e-34
NCAS0G002605.699ON5103342942e-27
Ecym_40215.699ON4595542612e-23
SAKL0E14850g5.699ON4703402471e-21
AFR283W5.699ON4524702425e-21
Kwal_55.197165.699ON4673482354e-20
KLTH0E01122g5.699ON4723602337e-20
TBLA0E020905.699ON7491422091e-16
KLLA0A00660g5.699ON5244901742e-12
Kpol_2001.735.699ON4111231171e-05
SAKL0F14476g7.475ON177114740.91
TPHA0D045805.699ON470373741.9
Smik_12.1658.295ON490979742.2
Skud_12.1748.295ON490761733.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02250
         (556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...  1046   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   207   8e-60
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   186   5e-52
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   176   5e-48
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   166   3e-44
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   164   1e-43
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   159   6e-42
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   146   6e-38
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   137   2e-34
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   117   2e-27
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   105   2e-23
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   100   1e-21
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...    98   5e-21
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...    95   4e-20
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...    94   7e-20
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    85   1e-16
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    72   2e-12
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    50   1e-05
SAKL0F14476g Chr6 (1154903..1155436) [534 bp, 177 aa] {ON} simil...    33   0.91 
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             33   1.9  
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    33   2.2  
Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa]...    33   3.5  

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/556 (94%), Positives = 526/556 (94%)

Query: 1   MNVNKEHGNLKGKKAEPLEAPVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTP 60
           MNVNKEHGNLKGKKAEPLEAPVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTP
Sbjct: 1   MNVNKEHGNLKGKKAEPLEAPVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTP 60

Query: 61  RDIAVEMATVRLNSEASGVSTPSVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGI 120
           RDIAVEMATVRLNSEASGVSTPSVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGI
Sbjct: 61  RDIAVEMATVRLNSEASGVSTPSVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGI 120

Query: 121 LSSSDTSEEEEGYDINGKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDK 180
           LSSSDTSEEEEGYDINGKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDK
Sbjct: 121 LSSSDTSEEEEGYDINGKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDK 180

Query: 181 ICTVSDLNRRVPSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLN 240
           ICTVSDLNRRVPSNNAMTPDT       DYM            FIMPRLSLTKKERQQLN
Sbjct: 181 ICTVSDLNRRVPSNNAMTPDTEEEEEGEDYMTASKSLTSSSTSFIMPRLSLTKKERQQLN 240

Query: 241 ANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLN 300
           ANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLN
Sbjct: 241 ANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLN 300

Query: 301 RISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLK 360
           RISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLK
Sbjct: 301 RISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLK 360

Query: 361 ETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXX 420
           ETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHT          
Sbjct: 361 ETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTKGDGSGGSKK 420

Query: 421 XNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATV 480
            NEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATV
Sbjct: 421 GNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATV 480

Query: 481 PVPLSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGL 540
           PVPLSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGL
Sbjct: 481 PVPLSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGL 540

Query: 541 NTDDASSLLALGYILI 556
           NTDDASSLLALGYILI
Sbjct: 541 NTDDASSLLALGYILI 556

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  207 bits (528), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 158/550 (28%), Positives = 256/550 (46%), Gaps = 93/550 (16%)

Query: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDII 88
           SILDPHLSVLELL R              T P + A++     +    +G +    G I 
Sbjct: 25  SILDPHLSVLELLRRP-----------SDTRPHE-ALKGEVSDIVGNCAGTTGTGNGSI- 71

Query: 89  SQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQPK 148
           SQSW TI R D    L     +   Q+  AGILSSSDTSE+E                  
Sbjct: 72  SQSWQTIHRND--SCLSVVPERCPSQATAAGILSSSDTSEDEP----------------- 112

Query: 149 RLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVP-----------SNNAM 197
                   D  +S   V ++L ++P +  +  +     LN  +P           +NN  
Sbjct: 113 --------DAVNSPSAVHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDSNNINNNNKN 164

Query: 198 TPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLF 257
              T       D              FIMP+LSL++K ++      FRIL++GR   K +
Sbjct: 165 GSTTGSNGEEDDNDTITKSLNSSSNSFIMPKLSLSQKTQK------FRILVLGRPGLKFY 218

Query: 258 KMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICE 317
             IP K+Q++F+L +S+D  E++++T ILVV QE +E++SLLNR+ +     RP+I +C+
Sbjct: 219 HSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNP-NRPVIPVCQ 277

Query: 318 KDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQI 377
                Q +N+L+S L+N L++LLY P V++N  +L  M  FL+E S    + +      +
Sbjct: 278 SGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNS-----DM 332

Query: 378 KEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHDRKPKENEEYNKW 437
             + PN+G++             R+K    R                 +K   NE+ N+W
Sbjct: 333 DAEEPNNGSK-------------RLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKVNRW 379

Query: 438 IIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVL----LH 493
           ++WG+SL++GVG+GYCIS+  SS W SL       ++ +    P  +S + FV     L 
Sbjct: 380 VLWGVSLTLGVGVGYCISHLVSSTWISLT------TNPLGPVDPESVSKDLFVFDRQELK 433

Query: 494 DSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNT-------DDAS 546
             + D ++   F  ++   K ++ +  + +K  + + L+    +   N        +  +
Sbjct: 434 LGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTN 493

Query: 547 SLLALGYILI 556
            +LALGY+++
Sbjct: 494 RVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  186 bits (473), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 170/550 (30%), Positives = 250/550 (45%), Gaps = 98/550 (17%)

Query: 22  VTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVST 81
            T     S+LDPHLSVLELLER              T      VE A    N+  S    
Sbjct: 23  TTAFEKKSLLDPHLSVLELLER-----------TGDTQRVGRGVEKADDMANTTNS---- 67

Query: 82  PSVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEE--EGYDINGKK 139
                 IS SW  I R D    +     +   Q+A  GILSSSDTSEEE       N   
Sbjct: 68  ------ISSSWQAIHRND--AMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAH 119

Query: 140 NSPLHL--QPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVPSNNAM 197
            +  H   QP RL                      P K D   I    D   + PS    
Sbjct: 120 FTQFHQSQQPPRL----------------------PFKLDVPVILPARD---QEPSGQTQ 154

Query: 198 TPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLF 257
           TPD        D              F+MP+LSL++K      +++ RILI+GR   K +
Sbjct: 155 TPDNDDER---DDETLTKSLSNSSNSFVMPKLSLSQK------SHKLRILILGRPGLKFY 205

Query: 258 KMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICE 317
           + IP ++Q+ F+L +  D +E+++FT IL+V QE +E++SLLNR+ +     RP+I +C+
Sbjct: 206 QSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEMVSLLNRVCQCAPT-RPVIPVCQ 264

Query: 318 KDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQI 377
                Q +NVL+S L++ LI+LLY P VISN  +L+ M  FL + S              
Sbjct: 265 TGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYRFLLDLS-------------- 310

Query: 378 KEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHDRKPKENEEYNKW 437
             K  +D + +     +  L   ++K   H+                 R+ KE  + NKW
Sbjct: 311 --KTISDNSEDDEDEEERELLDKKIKKS-HQRKKKRAGSYDKTDKPRKRRSKET-KINKW 366

Query: 438 IIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVLLHDS-- 495
           I+WGISL++GVG+GYC+SYF S   S L+        SI+   P    N++ V+  DS  
Sbjct: 367 IVWGISLTVGVGVGYCMSYFAS---SGLISMSAKSIASINGCRP----NDNVVVFDDSSL 419

Query: 496 ---DNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLN------AFSYLNGLNTDDAS 546
              + D + +  F  ++  LK ++ +    +K  + K L+      + +Y      D+++
Sbjct: 420 GMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSN 479

Query: 547 SLLALGYILI 556
            +LALGYIL+
Sbjct: 480 RVLALGYILL 489

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  176 bits (447), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 160/593 (26%), Positives = 262/593 (44%), Gaps = 103/593 (17%)

Query: 1   MNVNKEHGNLKGKKAEPLEAPVTTIITNS---------ILDPHLSVLELLERGFQNVHEQ 51
           +   +  G     K+ P ++  TTI T S         +LDPHLSVLELL +        
Sbjct: 3   LEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSK-------- 54

Query: 52  DDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDIISQSWHTIQRRDLEESLHNNSNKL 111
                  +P  +   + T   + + SG    +V D IS SW  IQ  DL  S      + 
Sbjct: 55  ----TGHSPSPMGQNLVT---SIDISG--NHNVNDSISGSWQAIQPLDLGASFI--PERC 103

Query: 112 VLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQ- 170
             Q+    ILSSSDTSEEE+                      ++Q   +  +N++K+ Q 
Sbjct: 104 SSQTTNGSILSSSDTSEEEQ---------------------ELLQAPAADIINIIKQGQE 142

Query: 171 -------SSPVKADSDKICTVSDLNRRVPSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXX 223
                  S P K     I        + P N              D +            
Sbjct: 143 GANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNS 202

Query: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFT 283
           F+MP+LSLT+K         FR+LI+GR  S  ++ IP ++Q+LF+L K +D   + ++T
Sbjct: 203 FVMPKLSLTQKNPV------FRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYT 256

Query: 284 AILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQP 343
            I+++ QE RE++SLLNRI +  + K P+I IC+    +Q KNVLKS+LRN L+ LL+ P
Sbjct: 257 GIVIIFQELREMVSLLNRIVQYSQGK-PVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPP 315

Query: 344 FVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVK 403
            V++N  +L +M   L++ S+++ E        + E+  +D        +  T S+   +
Sbjct: 316 VVVTNKRDLKKMFQRLQDLSLEYGE-------DVNEEDNDD-------EAIHTKSRSYCR 361

Query: 404 NDKHRHTXXXXXXXXXXXNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPW- 462
           N K  ++                  K+ + +  W  WGIS++IG+  G C++YF ++ + 
Sbjct: 362 NKKAENSKKKSPKSNKKPKR-----KKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYE 416

Query: 463 -------------SSLVQYFNPESDSI-SATVPVPLSNESFVLLHDS--DNDSETKKYFF 506
                         + +   +  SD+I +     P S E F+         +  +  +  
Sbjct: 417 HQTVKSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIM 476

Query: 507 KSINFLKYSINKVKVIIKDTIRKPLNAFSYLNG---LNTDDASSLLALGYILI 556
           KS+  +K +  K+   +   + KPL     LN     + D+++ +LALGYIL+
Sbjct: 477 KSLTIIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  166 bits (420), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 148/562 (26%), Positives = 254/562 (45%), Gaps = 98/562 (17%)

Query: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDII 88
            +LDPHLSVLELL +   +      +++++   DI+               S   V D I
Sbjct: 40  GLLDPHLSVLELLGKTGHSPSPMGHSLVTSI--DIS---------------SHHYVNDSI 82

Query: 89  SQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQPK 148
           S SW  I   DL  S      +   Q+    ILSSSDTSEEE                  
Sbjct: 83  SGSWQAIHPLDLGASF--VPERSSSQTTNGSILSSSDTSEEE------------------ 122

Query: 149 RLCEPIIQDICSSHMNVVKRLQ-----SSPVKA--DSDKICTV-------SDLNRRVPSN 194
              + ++Q   +  +N++K+ Q     +SP +      K+ ++       +    +   +
Sbjct: 123 ---QELLQAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDD 179

Query: 195 NAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSS 254
           N +  D        D              F+MP+LSL++K         FR+LI+GR  S
Sbjct: 180 NNVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNP------VFRLLILGRTGS 233

Query: 255 KLFKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIA 314
             ++ IP + Q+LF+L K +D   + ++T I+++ QE RE++SLLNRI +  + K P+I 
Sbjct: 234 NFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGK-PIIP 292

Query: 315 ICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPK 374
           IC+    +Q KNVLKS+LRN LI LLY P V++N  +L +M   L++ S+++ E   N  
Sbjct: 293 ICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDD 352

Query: 375 IQIKEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHDRKPKENEEY 434
               +++ +  +R+                  +R+            +    K K+    
Sbjct: 353 EDNDDEIIHTNSRSY-----------------YRNKKANSSKKKSFKSNKKPKKKKQRSL 395

Query: 435 NKWIIWGISLSIGVGIGYCISYFGSSPWSSLV-QYFNPES-------------DSISATV 480
            +W  WG+S++IG+  G C++YF ++ +     + FN  S             D+++   
Sbjct: 396 TRWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNLRSSILTSLLSLDSYHDTVNTPA 455

Query: 481 PVPLSNESFVLLHDSDN---DSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYL 537
               S+    L  D      +  +  +  KS+  +K + +K+ V + + + +PLN    L
Sbjct: 456 TTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENL 515

Query: 538 N---GLNTDDASSLLALGYILI 556
           N     + D+++ +LALGYIL+
Sbjct: 516 NKNSDFSLDESNRILALGYILL 537

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  164 bits (415), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 148/561 (26%), Positives = 247/561 (44%), Gaps = 106/561 (18%)

Query: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDII 88
            +LDPHLSVLELL +   +      +++++   DI+                  +V D I
Sbjct: 40  GLLDPHLSVLELLGKTGHSPSPMGQSLVTSI--DISGHQ---------------NVNDSI 82

Query: 89  SQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQPK 148
           S SW  IQ  DL  S      +   Q+    ILSSSDTSEEE+                 
Sbjct: 83  SGSWQAIQPLDLGASFI--PERCSSQTTNGSILSSSDTSEEEQ----------------- 123

Query: 149 RLCEPIIQDICSSHMNVVKRLQ--------SSPVKADSDKICTVSDLNRRVPSNNAMTPD 200
                ++Q   +  +N++K+ Q        S P +     I        + P       D
Sbjct: 124 ----ELLQAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDIND 179

Query: 201 TXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMI 260
                   D +            F+MP+LSL++K         FR+LI+GR  S  ++ I
Sbjct: 180 DEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNP------VFRLLILGRTGSNFYQSI 233

Query: 261 PHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDA 320
           P ++Q+LF+L K +D   + ++T I+++ QE RE++SLLNRI +  + K P+I IC+   
Sbjct: 234 PKEYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQ 292

Query: 321 FLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEK 380
            +Q KNVLKS+LRN LI LL+ P V++N ++L +M   L++ S+++              
Sbjct: 293 TIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLEY-------------- 338

Query: 381 VPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHDRKPKENEEYNKWIIW 440
                        D   +K R     +R+            +    K K+   +  W  W
Sbjct: 339 ----AEDENEEGDDDETTKSR---SYYRYKKANNSKRKSPKSNKKPKKKKQRFFTSWFTW 391

Query: 441 GISLSIGVGIGYCISYFGSSPW--------------SSLVQYFNPESDSI-SATVPVPLS 485
           GIS++IG+  G C++YF ++ +               + +   +  SD++ +     P S
Sbjct: 392 GISITIGISFGCCVTYFVTAAYDHQTVKSLSLRSSLLTSMLSLDSSSDTVNTPATASPSS 451

Query: 486 NESFVLLHDSDNDSETKKYFF-------KSINFLKYSINKVKVIIKDTIRKPLNAFSYLN 538
           +E F+       D  T +  F       KS++ +K +  K+   +   + +PL+    LN
Sbjct: 452 SEHFLWF-----DKGTLQINFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPLSFLENLN 506

Query: 539 ---GLNTDDASSLLALGYILI 556
                + D+++ +LALGYIL+
Sbjct: 507 RSSDFSIDESNRILALGYILL 527

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  159 bits (401), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 124/461 (26%), Positives = 216/461 (46%), Gaps = 80/461 (17%)

Query: 6   EHGNLKGKKAEPLEAPVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAV 65
           + G +K   +  L +       +SILDPH SV+ELL+R                      
Sbjct: 5   QRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQR---------------------- 42

Query: 66  EMATVRLNSEASGVSTPSVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSD 125
                    +  G   PS   ++ +SW  I+  D+ +   +N ++   QS T+ ILSSS 
Sbjct: 43  ---------QMEGSEVPSESGVLGESWQQIRESDVGDGGDSNFDQ---QSNTSAILSSSS 90

Query: 126 TSEEEEGYDINGKKNSP------LHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSD 179
            + E+E  DI  +           H+  +   +   Q       +++K  QS   + DS+
Sbjct: 91  EASEDEDLDIQQQLLGGQQEYKNFHMTAEEQLQEQAQGQGFGRPSLLKGTQSRLSEQDSN 150

Query: 180 KICTVSDLNRRVPSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQL 239
           +  +V  +  +   ++++           D M            F+MP+LSLT K  Q  
Sbjct: 151 RSGSVRTIVDKGSCSSSLDEHELNSIFTSDSMSLTKSTGSSSTSFVMPKLSLTYKPSQAK 210

Query: 240 NANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLL 299
                ++L+VGRLS +  + IP +++  F + +S D +E+Q +  I++V QE +E +++L
Sbjct: 211 -----KLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIVFQELKEFVAML 265

Query: 300 NRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFL 359
           NRI +    K+P+I IC+    ++ KN+LKS+L+ND ITL Y P  I+N + ++++    
Sbjct: 266 NRIVQYTD-KKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANEKSMEKL---- 320

Query: 360 KETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRV---KNDKHRHTXXXXXX 416
                      +   +++  K+ N+ +  + ++SD +LS +     KN++ +        
Sbjct: 321 -----------FKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRRK-------- 361

Query: 417 XXXXXNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYF 457
                 +H  KP  N  Y+KWI WGISL+IGV IGY  +Y 
Sbjct: 362 ------KHGGKPSTN--YSKWITWGISLTIGVSIGYYATYM 394

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  146 bits (369), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 137/540 (25%), Positives = 226/540 (41%), Gaps = 110/540 (20%)

Query: 27  TNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVS-TPSVG 85
            NS+LDPHLSVLELLE+  +                          ++EA G S     G
Sbjct: 5   ANSVLDPHLSVLELLEKSCER-----------------------GGHAEAPGSSRNKGAG 41

Query: 86  DI-ISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLH 144
            I +S+SW T++R +L     + S     Q    G+LSSSDTSEE E    +        
Sbjct: 42  QIQLSESWCTVERDELSAMERSAS-----QQTNNGVLSSSDTSEEGEPEQGSPGDGEGGG 96

Query: 145 LQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVPSNNAMTPDTXXX 204
           +   R+  P +             LQS+    D      V D                  
Sbjct: 97  VADTRMARPAMS------------LQSTSSTLDG-----VDD------------------ 121

Query: 205 XXXXDYMXXXXXXXXXXXXFIMPRLSLT-----KKERQQLNANEFRILIVGRLSSKLFK- 258
               D              FIMP+L  T           L    F++ ++GR + K  + 
Sbjct: 122 ----DSATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQE 177

Query: 259 MIPHKFQNLFQLQKS-YDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICE 317
            +P +F++ F+L    +D+ +      IL+V+QE RELISLLNR+      + P++A+ +
Sbjct: 178 TVPEQFRHRFELTAGVHDLAQCADRQGILIVVQEVRELISLLNRV-HCACPEVPVVAVYD 236

Query: 318 KDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQI 377
           +D  +Q KNVL+++ R  L++LL+ P  +SN E LD+M  F+   +              
Sbjct: 237 RDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDNLA-------------- 282

Query: 378 KEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHDRKPKENEEYNKW 437
           +++ P     N P ++      D  ++D HR                  KP+    + +W
Sbjct: 283 RQQEPAGVIHNDPQTTQ-EQHPDHNEDDPHRGPS---------------KPEGT--FKRW 324

Query: 438 IIWGISLSIGVGIG-YCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVLLHDSD 496
           ++WG+S+S+G+G G YC+SY  SS        F     +++AT     +  +       D
Sbjct: 325 LLWGVSISLGIGAGYYCVSYVVSSSMCVSCFNFRHTDHTLAATTSTAAAAAAAATPSGID 384

Query: 497 NDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNTDDASSLLALGYILI 556
           +D+++       ++ +K S+ +    +K  + KP +        +  D +  L LGY +I
Sbjct: 385 HDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDRSQEWHLHDPNRFLQLGYAVI 444

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  137 bits (346), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 110/366 (30%), Positives = 172/366 (46%), Gaps = 90/366 (24%)

Query: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMAT-VRLNSEASGVSTPSVGDI 87
            +LDPHLSVLELL +              ++P  +   + T + +++  +      V D 
Sbjct: 40  GLLDPHLSVLELLGK------------TGSSPSPLGQSLVTSIDISNHHN------VIDN 81

Query: 88  ISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQP 147
           IS SW TIQ  DL  S      +   Q+    ILSSSDTSEEE+                
Sbjct: 82  ISGSWQTIQPLDLGASF--IPERCSSQTTNGSILSSSDTSEEEQD--------------- 124

Query: 148 KRLCEPIIQDICSSHMNVVKRLQ--------SSPVKA-------------------DSDK 180
                 ++Q   +  +N++K+ Q        S P K                      D 
Sbjct: 125 ------LLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDV 178

Query: 181 ICTVSDLNRRVPSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLN 240
           +C  +D       +N M  +        D +            F+MP+LSL++K      
Sbjct: 179 VCIDND------DDNGMYEE--------DSVTITKSLTSSTNSFVMPKLSLSRKN----- 219

Query: 241 ANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLN 300
              FR+LI+GR  +  ++  P ++Q+LF+L KS+D   + ++T I++V QE RE++SLLN
Sbjct: 220 -PVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLN 278

Query: 301 RISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLK 360
           RI    + K P+I IC+    +Q KNVLKS+L+N LI LLY P V +N ++L +M   L+
Sbjct: 279 RIVEYAQGK-PIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQ 337

Query: 361 ETSIKF 366
           + S+++
Sbjct: 338 DLSLEY 343

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 162/334 (48%), Gaps = 27/334 (8%)

Query: 243 EFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDI---NEYQKFTAILVVIQETRELISLL 299
           +F+ILI GRL    ++ IP ++Q LF +    +    NE   FTA L++ +E +EL+SLL
Sbjct: 184 KFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLL 243

Query: 300 NRISRS---EKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRML 356
           NRIS     +KV  P+I IC+    ++ K++LK +L+N+ +TLL  P +I N E   R L
Sbjct: 244 NRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLL-SPIIIINDE---RAL 299

Query: 357 VFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVKND--KHRHTXXXX 414
           + + +T     +   +           +   + P+ +D  +    +K      +      
Sbjct: 300 LKMFKTMQSISKTVISASSSTTSSDNEEEESSDPSMNDKVIDVKTIKESMMSSQKKKNKK 359

Query: 415 XXXXXXXNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISY--FGSS---PWSSLVQYF 469
                   EH R    +   NKW++W ISL++G G+GY ISY  F SS   P   +    
Sbjct: 360 KHHNNRRKEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQT 419

Query: 470 NPESDSISATVPVPLSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRK 529
            P    +S+ + +  SN++ + L  +  +  +  YF  +  F K ++N++    K  IRK
Sbjct: 420 RP--GPLSSLIHLK-SNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRK 476

Query: 530 PLNAFSYL--NGLNT-----DDASSLLALGYILI 556
           P   F  L    +N+     D+   +LAL Y+L+
Sbjct: 477 PFAMFENLITTTINSKDWKFDEQDRILALCYLLL 510

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 6/33 (18%)

Query: 29 SILDPHLSVLELLERGFQNVHEQDDTIMSTTPR 61
          S+LDPHLSVLE+LER      + +DT+M  + R
Sbjct: 37 SLLDPHLSVLEMLER------KDNDTVMEASSR 63

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 139/554 (25%), Positives = 221/554 (39%), Gaps = 140/554 (25%)

Query: 21  PVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVS 80
           P TT    SILDPHLSVLE+LE                       E+  V    E SG S
Sbjct: 20  PGTT--QRSILDPHLSVLEILE---------------------GKELNKVEGPHELSGAS 56

Query: 81  TPSVGDI---------ISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEE 131
             S             IS+SW +I+  D       N   L  QSA  GILSSSDTSE  E
Sbjct: 57  RVSGKQFEGERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSA-VGILSSSDTSE--E 113

Query: 132 GYDINGKKNSPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRV 191
             DI+     P           II     +    +  L+S     D + + TVS     +
Sbjct: 114 EQDIHPSPPPPNSAS-SAFDSRIINIAGQAFSATLSHLRSEDEDDDGETV-TVS-----L 166

Query: 192 PSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGR 251
           P  N MT                          +MP+LSL+ +        E ++LIVG+
Sbjct: 167 P--NTMT------------------------SLVMPKLSLSDR------IIESKVLIVGQ 194

Query: 252 LSSKLFKMIPHKFQNLFQLQ-----KSYDINEYQKFTAILVVIQETRELISLLNRISRSE 306
            + K +  IP  +Q +F++      +  D++E  K++ I+V+  +      LL+RI    
Sbjct: 195 PARKFWFSIPKSYQKMFEICSLSVLRDKDVDE--KYSTIMVIFHDMGLAPELLDRIC--N 250

Query: 307 KVKRP-LIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIK 365
           KV RP +I IC+K       ++LK Y+  + I L   P V+SN  E  R+L  L + S  
Sbjct: 251 KVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRLLKHLHQLS-S 309

Query: 366 FYEQAYNPKIQIK--EKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNE 423
             +  Y  ++ ++  +K+P                                         
Sbjct: 310 GSDSGYETEVTVEPVKKLPRKAK------------------------------------- 332

Query: 424 HDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVP 483
             ++P +   +  W++W  S++IG+GIG C+S   S+ ++ LV    P   ++      P
Sbjct: 333 --KRPSKPSTFRDWVVWTASITIGIGIGCCVSLMVSTRYAFLV----PRQLAVDDITSSP 386

Query: 484 LSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLN--GLN 541
           LS E          D  +   F  + +  K S+ K+   ++      L + ++++  G+ 
Sbjct: 387 LSPEG--------TDKSSHNLFLHAYSLCKTSLKKLASSLRPFFSDRLESCTWIHTLGIE 438

Query: 542 TDDASSLLALGYIL 555
                SL+++G I+
Sbjct: 439 LSYDDSLISMGRIM 452

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 91/340 (26%), Positives = 166/340 (48%), Gaps = 54/340 (15%)

Query: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTP-SVGDI 87
           SILDPH SVL+LLER   N  EQ++ +   + + I VE+ +      +     P ++   
Sbjct: 30  SILDPHFSVLQLLER---NGCEQEEDVNQASSQ-IPVELKSAFNRPLSPHKRYPEALNQS 85

Query: 88  ISQSWHTIQRRD--LEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHL 145
           IS SW +I+  D  +  SLH+ S+     S   GILSSSDTSEEE  +      NSP   
Sbjct: 86  ISDSWQSIKMVDYSILNSLHDTSS-----SQAVGILSSSDTSEEELDH-----LNSP--- 132

Query: 146 QPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVPSNNAMTPDTXXXX 205
                  P  Q +  +   +  + Q+  + A +            +P+   +  D     
Sbjct: 133 ------SPSSQQVFPNGPPISFQTQAGVLTASA-----------TLPNPGVLEED----- 170

Query: 206 XXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQ 265
              D              F+MP+LSL+++      ++ F IL+VG+ + K +  +P  +Q
Sbjct: 171 ---DNETVTVSLAASSNSFVMPQLSLSQR------SHRFEILVVGKPARKFWNNVPKMYQ 221

Query: 266 NLFQLQ--KSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQ 323
            +F +   +S    +   +TA++++ Q+T+E+  +L+ +  ++   + +I IC++    Q
Sbjct: 222 KMFDIGDFESISAPKVSHYTAVMIIFQDTKEVSFILDSLV-TKLDGKAIIPICQRGQKQQ 280

Query: 324 CKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETS 363
             ++L+ +++   I L++QP V+SN +E+ ++L +L   S
Sbjct: 281 LASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLS 320

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 21/23 (91%)

Query: 435 NKWIIWGISLSIGVGIGYCISYF 457
           N+W+IWG+SL++GVGIG CIS+ 
Sbjct: 352 NRWVIWGLSLTVGVGIGCCISFI 374

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 107/470 (22%), Positives = 191/470 (40%), Gaps = 122/470 (25%)

Query: 28  NSILDPHLSVLELLER--GFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVG 85
             ILDPHLSVLE+L+R  G      ++  +M+   R +                   S+ 
Sbjct: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVER-----------------SLH 71

Query: 86  DIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHL 145
             IS+SW  I+R D   S  + ++++    ++ GILSSSDTSEEE   ++    +  +HL
Sbjct: 72  HSISESWQAIKRSDY--SFLSGTHEVGAMHSSVGILSSSDTSEEEA--EMRPSAHGTVHL 127

Query: 146 QPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVPSNNAMTPDTXXXX 205
               L  P+ Q        ++    +S  + D  +  T+S     +PS++          
Sbjct: 128 G-SSLASPMRQ--------LLVEEDNSCAEEDDCQTVTIS-----MPSSST--------- 164

Query: 206 XXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQ 265
                              +MP+LSL+++        E ++L+VG+ + K +  IP  +Q
Sbjct: 165 -----------------SLVMPKLSLSQR------LGEPQLLLVGQPARKFWLTIPKCYQ 201

Query: 266 NLFQLQKSYDINEY---QKFTAILVVIQETRELISLLNRISRSEKVKRP-LIAICEKDAF 321
            LF ++    +  +   Q++ A++VV  +  +   LL+ +   EK   P +I +C+K   
Sbjct: 202 KLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLC--EKAPCPTVIPVCQKGQK 259

Query: 322 LQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKV 381
                +LK Y     I +   P ++SN  E  R+L  L     +  E  Y  ++ +K K 
Sbjct: 260 STLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNLCNE-SESGYETELTVKSK- 317

Query: 382 PNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHDRKPKENE----EYNKW 437
                                                    +  R+P++ +        W
Sbjct: 318 -----------------------------------------KQHRRPRKKDAGPVALRHW 336

Query: 438 IIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNE 487
            IW  S +IG+GIG CIS   ++ ++       P +  I A +P  ++++
Sbjct: 337 AIWTASFTIGIGIGCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVASD 386

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 160/348 (45%), Gaps = 82/348 (23%)

Query: 28  NSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDI 87
           NSILDPHLSVL+LLER    VH +      +   DI       R +SE  G S       
Sbjct: 29  NSILDPHLSVLQLLERN--EVHSEPQEFRHS---DIPSPHLLSRSSSEPMGRS------- 76

Query: 88  ISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQP 147
           IS SW +I+  D   S+ N   +   Q   AGILSSSDTSE+E  + ++   N       
Sbjct: 77  ISDSWQSIRHTDY--SILNLIGETSHQ--PAGILSSSDTSEDEPDHFLSPSPNEYAFANG 132

Query: 148 KRLCEP------------IIQDICSSHMNVVKRLQSSPVKADSD-KICTVSDLNRRVPSN 194
            +   P             +QD    H NV +         D+D +  T+S +N    S+
Sbjct: 133 AKTVFPEASHAPEGPSLATLQDSVYEHSNVAE---------DNDNETVTLSLIN----SS 179

Query: 195 NAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIVGRLSS 254
           N+                           F+MP+LSL +  R+      F ILIVG+ + 
Sbjct: 180 NS---------------------------FVMPKLSLAQPLRK------FSILIVGKPAQ 206

Query: 255 KLFKMIPHKFQNLFQL--QKSYDINEYQKFTAILVVIQETRELISLLNRIS-RSEKVKRP 311
           + ++ IP  +Q +F++   +S+   +  +F+AI+V+  + +   SLL  ++ RS  +   
Sbjct: 207 RFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSSNI--- 263

Query: 312 LIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFL 359
            IA+C++    Q  N+L  + +   + L+Y   V+S+ +++ R+L +L
Sbjct: 264 -IAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYL 310

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/29 (65%), Positives = 23/29 (79%)

Query: 435 NKWIIWGISLSIGVGIGYCISYFGSSPWS 463
           N+W+IW ISL++GVGIGYCIS   SS  S
Sbjct: 347 NRWVIWSISLTVGVGIGYCISCLLSSTMS 375

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score = 94.4 bits (233), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 93/360 (25%), Positives = 168/360 (46%), Gaps = 96/360 (26%)

Query: 28  NSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTP----- 82
           NSILDPHLSVL+LL+R                  D   E+++++ + E +  +TP     
Sbjct: 38  NSILDPHLSVLQLLDRA-----------------DPPSELSSLK-HGEIAKPATPRRSGF 79

Query: 83  -SVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKN- 140
            SV   IS+SW +I+  D   S+ N       Q A  GILSSSDTSE+E    ++   N 
Sbjct: 80  ESVNCSISESWQSIKHTDC--SMVNTQGDATHQHA--GILSSSDTSEDEPDAQLSPSPNN 135

Query: 141 -------------SPLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDL 187
                        +P +L+   L E    +I            ++P + + ++  T+S +
Sbjct: 136 FAFPNSATSIFPEAPHNLEASSLREYQNSEI------------ANPREENDNETVTMSLM 183

Query: 188 NRRVPSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRIL 247
           N    S+N+                           F+MP+LSL ++      + +F IL
Sbjct: 184 N----SSNS---------------------------FVMPKLSLIQQ------SQKFCIL 206

Query: 248 IVGRLSSKLFKMIPHKFQNLFQLQKSYDIN--EYQKFTAILVVIQETRELISLLNRISRS 305
           IVG+ + + ++ IP  +  +F+++    ++  E  K++A++V+  E +E   LL +++  
Sbjct: 207 IVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELLEKVAAH 266

Query: 306 EKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIK 365
                 +IA+C++    Q  N+L  Y +++ I L+Y   V+S+ +++ R+L +L   S +
Sbjct: 267 NSN---IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTE 323

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 19/20 (95%)

Query: 435 NKWIIWGISLSIGVGIGYCI 454
           N+W+IW ISL++GVG+GYCI
Sbjct: 354 NRWVIWSISLTVGVGLGYCI 373

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 83/142 (58%), Gaps = 9/142 (6%)

Query: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSS-KLFKMIPHKFQNLFQLQ-KSYDINEYQK 281
           FIMP+LS T   R+      FRILI+G   +   ++ IP  ++ LF+L   ++D N ++ 
Sbjct: 336 FIMPKLSWTNTFRK------FRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDYN-FKH 388

Query: 282 FTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLY 341
           +  I +VI +  +  S+LN+I +    K+P+I ICEK    + KN+LK Y++   ++LLY
Sbjct: 389 YAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDLSLLY 448

Query: 342 QPFVISNTEELDRMLVFLKETS 363
            P V +N + ++ + + L + S
Sbjct: 449 PPIVGTNRDGMNTLYLHLNDLS 470

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 73/146 (50%), Gaps = 33/146 (22%)

Query: 436 KWIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPE-----SDSISATV---PVPLSNE 487
           K I W +SLS+GVG+G+C+SY+ S+ +S++ +  +       S+S++ TV   P+P S  
Sbjct: 612 KIIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIP-SPT 670

Query: 488 SFVLLHDSDNDSETKKY--------FFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNG 539
           ++ +    +N S T  Y        F  S+  LK ++  +    K     P      LNG
Sbjct: 671 TYSM---EENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQG----LNG 723

Query: 540 LNT---------DDASSLLALGYILI 556
           ++          +D + +LALG++L+
Sbjct: 724 VDQILPSKYNFYEDPAMILALGFVLL 749

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 22/119 (18%)

Query: 30  ILDPHLSVLELLERGFQNVHEQDDTIMSTT---PRDIAVEMATVRLNSEASGVSTPSVGD 86
            LDPH S++ELLE    ++ E  +    T    P +    +  +RL  E SG++   V D
Sbjct: 27  FLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRL--ELSGMN---VDD 81

Query: 87  IISQ-------------SWHTIQRRDLEE-SLHNNSNKLVLQSATAGILSSSDTSEEEE 131
           I S+             SW  IQ  D     + ++++   + + T GILSS+D+SEEE+
Sbjct: 82  INSENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTVGILSSTDSSEEEQ 140

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 107/490 (21%), Positives = 196/490 (40%), Gaps = 101/490 (20%)

Query: 28  NSILDPHLSVLELLER----GFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPS 83
           +SILDPH SV++LL       F +   Q+  ++    +   ++   +  ++ + G     
Sbjct: 39  HSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKG----- 93

Query: 84  VGDIISQSWHTIQRRDL-------EESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDIN 136
               ++ SW  I R +          + HN SN    Q    G+LSS DTSEEE   +IN
Sbjct: 94  ----LTDSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQF-GGVLSS-DTSEEE--VEIN 145

Query: 137 GKKNSPLHLQPKR---LCEPI----IQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNR 189
              +  L    +    L  P+      D  +S   V +     PVK+      + ++L  
Sbjct: 146 AAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGA 205

Query: 190 RVPSNNAMTPDTXXXXXXXDYMXXXXXXXXXXXXFIMPRLSLTKKERQQLNANEFRILIV 249
               +  +  +                       F+MP+LSL++  ++      F+ILI+
Sbjct: 206 GTGEDETIMVN--------------LGHSWAGSFFVMPKLSLSESMKR------FKILIL 245

Query: 250 --GRLSSKLFKMIPHKFQNLFQLQKSYDIN--EYQKFTAILVVIQETRELISLLNRISRS 305
             G  ++  +  +    + +F + K  + +  E  K+TA +++  +++++ ++LNR+ + 
Sbjct: 246 SDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWK- 304

Query: 306 EKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIK 365
           +     LI IC+K         +K++  ++ I L+  P VIS+  E+  +L  L    ++
Sbjct: 305 KYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVE 364

Query: 366 FYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTXXXXXXXXXXXNEHD 425
             +  Y   I  K K P  G +  P      L+K                          
Sbjct: 365 V-DSDYETDIPKKTK-PRKGAKKKPAPH---LAK-------------------------- 393

Query: 426 RKPKENEEYNKWIIWGISLSIGVGIGYCISY----FGSSPWSSLVQYFNPESDSISATVP 481
                     +W  W IS+++GVGIG C+++    F +S ++S V         I A V 
Sbjct: 394 ----------RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVD 443

Query: 482 VPLSNESFVL 491
               N   +L
Sbjct: 444 AIEGNSPSIL 453

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 18/123 (14%)

Query: 436 KWII--WGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVLLH 493
           KW+   +GIS+++GVG+GYCI        SSLV   +  S+ I + VP   +N+   L  
Sbjct: 305 KWLFVYYGISITLGVGVGYCI--------SSLV--VSQNSNDIQSIVPSTPNNDIIALES 354

Query: 494 DSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNTDDASSLLALGY 553
              N      Y   + NFLK SI  V  I+K  I   +N   Y      +D++ ++A+ Y
Sbjct: 355 QDLNSHNGDDY---NWNFLKLSIKNVYSILKRFITTSINLLEY---KTLNDSNKIIAMSY 408

Query: 554 ILI 556
           +L+
Sbjct: 409 VLL 411

>SAKL0F14476g Chr6 (1154903..1155436) [534 bp, 177 aa] {ON} similar
           to uniprot|Q12262 Saccharomyces cerevisiae YPR046W MCM16
           Protein involved in kinetochore-microtubule mediated
           chromosome segregation binds to centromere DNA
          Length = 177

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 59/114 (51%), Gaps = 16/114 (14%)

Query: 252 LSSKLFKMIPHKFQ---NLFQLQKSYDI--NEYQKF-TAILVVIQETRELISLLNRISRS 305
           L ++LFK++   ++   NL + ++  +I   E+ +  T  + +++ETREL S L + S  
Sbjct: 74  LDTRLFKLMEENYKLDKNLVENEEKQNILVKEFSELRTEYIELLKETRELTSHLEKPSEG 133

Query: 306 EKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFL 359
           EK         E+D  ++ KN++   L+  +  L++Q       E++D  L +L
Sbjct: 134 EKP-------VERDPAIETKNIV---LKELITALIFQSGYQGTNEKIDEWLEYL 177

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 171/373 (45%), Gaps = 62/373 (16%)

Query: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFK--MIPHKFQNLFQLQKSYDINEYQK 281
           F+MPRLS +KKE   L A    I +VG  +   ++  +     +  F L  S D      
Sbjct: 120 FVMPRLSYSKKE-GSLKA----ISVVGSHADSFYQEYLQVSTGEYCFMLDVSTD------ 168

Query: 282 FTAILVVIQETRELISLLNRISRSEKVKRPLIAICEK-----DAFLQCKNVLKSYLRNDL 336
            +  L+V+Q   EL+ +L R SR   V   ++++  +     +    C  VL S ++   
Sbjct: 169 NSVSLLVVQNHLELLDIL-RHSRDITVVAIVLSLDHRRGDNLEIIKNCNKVLSS-MKERK 226

Query: 337 ITLLYQPFVI-----------SNTEELDRMLVFLKE-------TSIK--FYEQAYNPKIQ 376
             +LY P +I           S T+ +  +L FL+E        SI+     Q  + ++ 
Sbjct: 227 WPMLYYPNLIIIHERANNNHGSKTKVIANLLQFLREHEPSKLNGSIRSDTVSQERSERM- 285

Query: 377 IKEKV-PNDGNRNAPTSSDLTLSKDRVK---------NDKHRHTXXXXXXXXXXXNEHDR 426
           IKE   PN    +AP ++   LS+  ++           K++              + D 
Sbjct: 286 IKELFKPN----SAPVNNKKNLSRSSIRAIRNVKSMRKSKYKPRIPLTERDKSGIGKKDD 341

Query: 427 KPKENEE-YNKWIIWGISLSIGVGIGYCIS-YFGSSPWSSLVQYFNP-ESDSISATVPVP 483
           K + +++ + KW +  IS+ IG+G+GYC+S    S+ +S L++ F+  E++ + A + V 
Sbjct: 342 KNQNDKDWFYKWSV-SISIGIGIGVGYCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVV 400

Query: 484 LSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNTD 543
              +S  +    DN         ++ +FL  ++  + VI+K  I KP+ +F   N  N D
Sbjct: 401 TDTDSDFIKDTIDNGQTIN--LPQTWDFLTSTVRHICVIMKYIILKPI-SFLGSNWQNLD 457

Query: 544 DASSLLALGYILI 556
           D++ ++A+ Y+L+
Sbjct: 458 DSNRIIAMSYVLL 470

>Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa] {ON}
            YLR106C (REAL)
          Length = 4909

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 11   KGKKAEPLEAPVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATV 70
            +G   E +E    +I T+ IL    S  +++  GF+++ E DD  +ST+ + I V +  +
Sbjct: 3909 EGPSVEEIEQAFRSIFTSIIL----SFQKIIGDGFESISESDDKWLSTSFKKIMVNVKLL 3964

Query: 71   RLNSEASGVSTPSVGDIIS 89
            R     SG+ + ++G  +S
Sbjct: 3965 R-----SGLVSKNIGAALS 3978

>Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa] {ON}
            YLR106C (REAL)
          Length = 4907

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 11   KGKKAEPLEAPVTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATV 70
            +G   E +E     I T+ IL    S  +L+E GF+++ E DD  +ST+ + I + +  +
Sbjct: 3906 EGPSVEDIEQAFRRIFTSIIL----SFQKLIEDGFESISEADDRWLSTSFKKIMINVKLL 3961

Query: 71   R 71
            R
Sbjct: 3962 R 3962

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,346,481
Number of extensions: 2633750
Number of successful extensions: 9961
Number of sequences better than 10.0: 46
Number of HSP's gapped: 10233
Number of HSP's successfully gapped: 68
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)