Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D022405.700ON1187118756510.0
NCAS0G002505.700ON1183118034420.0
KNAG0L021105.700ON1200121033390.0
Skud_9.215.700ON1221121831950.0
Smik_9.225.700ON1230125431940.0
Suva_9.415.700ON1219122231880.0
YIL147C (SLN1)5.700ON1220121931550.0
ZYRO0G06644g5.700ON1166116731240.0
SAKL0E14872g5.700ON1140115731130.0
Kpol_2001.745.700ON1113115030320.0
Kwal_55.197075.700ON1143116230100.0
KLLA0A00638g5.700ON1155115728730.0
TPHA0D045905.700ON1127116928420.0
Ecym_40205.700ON1125118625340.0
AFR284W5.700ON1103117025040.0
TPHA0E002505.700ON1068116624700.0
TBLA0E021005.700ON1140117421290.0
CAGL0H06567g5.700ON116973219730.0
TDEL0B022105.700ON109568919580.0
KLTH0E01100g5.700ON117771918480.0
TBLA0I016805.700ON121475117820.0
Kpol_1043.685.700ON104268315810.0
NDAI0F003105.700ON125948214770.0
Smik_8.2964.385ON6251811882e-13
Skud_8.2734.385ON6231671811e-12
YHR206W (SKN7)4.385ON6221701782e-12
ADL388W4.385ON4821461772e-12
CAGL0F09097g4.385ON6301261739e-12
NDAI0D034304.385ON5971711731e-11
Suva_15.4124.385ON6171671721e-11
TBLA0A107004.385ON5871581711e-11
KAFR0B069904.385ON5451261692e-11
NCAS0A064504.385ON6091281692e-11
KNAG0M001804.385ON6151261683e-11
Ecym_74744.385ON4961201665e-11
TPHA0C001504.385ON5101261631e-10
SAKL0B12408g4.385ON4651331621e-10
Kpol_265.24.385ON5491261612e-10
Kwal_47.167704.385ON4611581602e-10
TDEL0D003204.385ON5471281602e-10
KLLA0A10219g4.385ON4751221603e-10
KLTH0D17182g4.385ON4641641584e-10
ZYRO0G00484g4.385ON6471261586e-10
Ecym_50775.230ON7951501505e-09
KAFR0J007005.230ON6201921471e-08
ADR343C5.230ON7491651425e-08
KNAG0B051405.230ON6481401416e-08
ZYRO0A11154g5.230ON7761491353e-07
TDEL0E039805.230ON7301311319e-07
Suva_10.845.230ON6951491301e-06
YLR006C (SSK1)5.230ON7121491282e-06
NCAS0D029005.230ON7621431282e-06
Smik_12.685.230ON7121491282e-06
Kwal_33.152885.230ON5871711273e-06
CAGL0D02882g5.230ON6671521263e-06
Skud_12.725.230ON7021491255e-06
KLLA0E09505g5.230ON6351051245e-06
NDAI0I020005.230ON8901621246e-06
Kpol_1004.45.230ON7141521221e-05
KLTH0B02684g5.230ON5951681202e-05
TPHA0N008505.230ON6701501131e-04
TBLA0D031705.230ON7651771103e-04
SAKL0G12100g5.230ON738741103e-04
KLTH0G18612g8.34ON1524131930.035
SAKL0B01210g8.34ON1588132920.041
CAGL0K12562g8.34ON1682135920.051
Klac_YGOB_Anc_8.348.34ON157178910.059
KLLA0E04533g7.222ON42180840.29
YFL033C (RIM15)8.34ON1770131840.35
Ecym_15088.34ON1694134830.46
TBLA0B015507.222ON394104800.96
Smik_6.468.34ON1760132801.1
Suva_6.268.34ON1753132801.2
Kwal_14.11598.34ON152175801.3
Skud_6.388.34ON1758132791.5
TDEL0C005908.34ON1602125791.6
ACR218W8.34ON1569128772.5
TBLA0C048703.515ON1650135754.1
KLTH0G01892g3.515ON165769736.7
KNAG0C045805.487ON50868728.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02240
         (1187 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  2181   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1330   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1290   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1235   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  1234   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1232   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  1219   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1207   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1203   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1172   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1164   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1111   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1099   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   980   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   969   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   956   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   824   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   764   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   758   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   716   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   691   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   613   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   573   0.0  
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    77   2e-13
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    74   1e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    73   2e-12
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    73   2e-12
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    71   9e-12
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     71   1e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    71   1e-11
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    70   1e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    70   2e-11
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    70   2e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    69   3e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    69   5e-11
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    67   1e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    67   1e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    67   2e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    66   2e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    66   2e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    66   3e-10
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    65   4e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   6e-10
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    62   5e-09
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    61   1e-08
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    59   5e-08
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    59   6e-08
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    57   3e-07
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    55   9e-07
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    55   1e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    54   2e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    54   2e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    54   2e-06
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    54   3e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    53   3e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    53   5e-06
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    52   5e-06
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    52   6e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    52   1e-05
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    51   2e-05
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    48   1e-04
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    47   3e-04
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    47   3e-04
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    40   0.035
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    40   0.041
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    40   0.051
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    40   0.059
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    37   0.29 
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    37   0.35 
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    37   0.46 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    35   0.96 
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    35   1.1  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    35   1.2  
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    35   1.3  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    35   1.5  
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    35   1.6  
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    34   2.5  
TBLA0C04870 Chr3 (1182058..1187010) [4953 bp, 1650 aa] {ON} Anc_...    33   4.1  
KLTH0G01892g Chr7 complement(142143..147116) [4974 bp, 1657 aa] ...    33   6.7  
KNAG0C04580 Chr3 (900175..901701) [1527 bp, 508 aa] {ON} Anc_5.4...    32   8.0  

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 2181 bits (5651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1096/1187 (92%), Positives = 1096/1187 (92%)

Query: 1    MVARVFARKRISQRLKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTS 60
            MVARVFARKRISQRLKRLAHLNTKPPYRISIRTQ                  TTGVYFTS
Sbjct: 1    MVARVFARKRISQRLKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTS 60

Query: 61   SYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWES 120
            SYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWES
Sbjct: 61   SYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWES 120

Query: 121  TESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSS 180
            TESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSS
Sbjct: 121  TESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSS 180

Query: 181  LETTGILTDPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTA 240
            LETTGILTDPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTA
Sbjct: 181  LETTGILTDPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTA 240

Query: 241  IEKSNVAIVSAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSI 300
            IEKSNVAIVSAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSI
Sbjct: 241  IEKSNVAIVSAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSI 300

Query: 301  KKTHFLYNKAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVML 360
            KKTHFLYNKAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVML
Sbjct: 301  KKTHFLYNKAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVML 360

Query: 361  VTLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRK 420
            VTLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRK
Sbjct: 361  VTLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRK 420

Query: 421  STATGXXXXXXXXXXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTL 480
            STATG              HPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTL
Sbjct: 421  STATGNSNSLNENSASLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTL 480

Query: 481  TIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLED 540
            TIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLED
Sbjct: 481  TIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLED 540

Query: 541  RVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSS 600
            RVRART                 TVFIANISHELRTPLNGILGMTAISMEEEDITKIRSS
Sbjct: 541  RVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSS 600

Query: 601  LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRL 660
            LKLIFRSG            FSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRL
Sbjct: 601  LKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRL 660

Query: 661  SIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNS 720
            SIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNS
Sbjct: 661  SIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNS 720

Query: 721  KFEKVYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSD 780
            KFEKVYVKGGTEFTSIPAELAALSKRESTA          IKEKLDGIPANVFASDSDSD
Sbjct: 721  KFEKVYVKGGTEFTSIPAELAALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSD 780

Query: 781  DPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGE 840
            DPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGE
Sbjct: 781  DPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGE 840

Query: 841  ELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATM 900
            ELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATM
Sbjct: 841  ELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATM 900

Query: 901  MNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXX 960
            MNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVA   
Sbjct: 901  MNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSI 960

Query: 961  XXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPF 1020
                             ATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPF
Sbjct: 961  NSRRSRSSLITSNSSRIATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPF 1020

Query: 1021 LQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAF 1080
            LQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAF
Sbjct: 1021 LQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAF 1080

Query: 1081 DNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECL 1140
            DNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECL
Sbjct: 1081 DNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECL 1140

Query: 1141 DAGMDGFLSKPIKRPQLKTILLEYCPKVDSMGRATSTGEESKHTKSN 1187
            DAGMDGFLSKPIKRPQLKTILLEYCPKVDSMGRATSTGEESKHTKSN
Sbjct: 1141 DAGMDGFLSKPIKRPQLKTILLEYCPKVDSMGRATSTGEESKHTKSN 1187

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 1330 bits (3442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1180 (58%), Positives = 834/1180 (70%), Gaps = 60/1180 (5%)

Query: 24   KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
            KPP+R+ IRTQ                  TTGVYFTS+YKNLR++RLYIAAQLKSSQIDQ
Sbjct: 12   KPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 71

Query: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
             L YLYYQSYW+S+RDTLQ  L N+VAGNK++ NW  +E V++KFL+S++ FS  ++YD 
Sbjct: 72   NLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDS 131

Query: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
            +F+ VL+ TNNGTG+ I   VL+KL+PL+TN PLSSSLET GILTDPVLNG++Y+MSMSL
Sbjct: 132  SFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSL 191

Query: 204  PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263
            P+FANPSIIL+ S+VYGYITI+M+A+GL +VFNDTTA+E+SNVAIVS VYNN+S L+AYH
Sbjct: 192  PIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYH 251

Query: 264  LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323
                PYG  + V +  F++ N+SFLN AL++GKGGS+KKT F Y K +AVGYSPC+F   
Sbjct: 252  FVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFV 311

Query: 324  NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383
            NW+++VSQ ESVF  PSTKL KII+G VV I VFV L+T PLA++AVKPIVRL+KATE++
Sbjct: 312  NWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELM 371

Query: 384  TEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXXXXXXXXHPMV 443
            +EGRGL+ TTPGS +VSR+SS++     R++I S+  S                      
Sbjct: 372  SEGRGLKSTTPGSKNVSRSSSIKH--YVRSNIPSTASSVHN------------------- 410

Query: 444  LTSENVLVT-----NHSGLSRIPV-----------NMNQELLDRASAST-VNTLT--IDS 484
             + +N+  T     N  GL+  P+           N   E++  A+ S   N+++   D 
Sbjct: 411  FSGDNLSTTTNGHLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDH 470

Query: 485  NDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRA 544
             D LS RSK L T  NL EARVP  R+LF DELSDLT+TFN MTDALD+HY LLEDRVRA
Sbjct: 471  TD-LSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRA 529

Query: 545  RTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLI 604
            RT                 T+FIANISHELRTPLNGILGMTAISMEE DI KIRSSLKLI
Sbjct: 530  RTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLI 589

Query: 605  FRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIIL 664
            FRSG            FSKNVL+RT LEKR+FCITDVALQ+KSIFGKVAKDQ VRLSI+L
Sbjct: 590  FRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVL 649

Query: 665  SPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEK 724
             PNI+RTM+L+GDSNRIIQ+VMNLVSNALKFTPVDGKV V+IKL+GEYDE  S+ S F+K
Sbjct: 650  LPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKK 709

Query: 725  VYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKE----KLDGIPANVFASDSDSD 780
            V VK GTEF    A+ A L   +             IKE           ++ ++ SD  
Sbjct: 710  VLVKSGTEFIETKAK-AILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEK 768

Query: 781  D-PSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLG 839
                +            +++  ++  SI STSTSSYDDA+FN+QFKKTP+LYEDEDGNLG
Sbjct: 769  KYDEKEDEGEEDNSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLG 828

Query: 840  EELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAT 899
             EL+  KTWV  IEV DTGPGID SLQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 
Sbjct: 829  IELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLAN 888

Query: 900  MMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXX 959
            MMNGTM L+S VG GS F FTVPL QTR ++L+E +HP+EDEFNP S+ NR+VKF +A  
Sbjct: 889  MMNGTMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKLAKS 948

Query: 960  XXXXXXXXXXXXXXXXXX-ATVREESRLETRSNHSDVSTSNKNESASPQPESGSN----- 1013
                                 V+EE   +   ++ +     K E A  +     +     
Sbjct: 949  LRSRKSRSSTTTFSTTNSLHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEH 1008

Query: 1014 -------LNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEG 1066
                   +N+DRPFLQSTGTA S+  + TV   GK   +LVAEDNHVNQEVIKRML+LEG
Sbjct: 1009 NNHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEG 1068

Query: 1067 VKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVA 1126
            V+NI+LA DGQDAF+ VK++ E+GE +DMIFMDVQMPKVDGL +TKMIRNDL Y +PIVA
Sbjct: 1069 VENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVA 1128

Query: 1127 LTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCP 1166
            LTAFADDSNIKECL+AGM+GFLSKPIKRP++KTIL EYCP
Sbjct: 1129 LTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCP 1168

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1290 bits (3339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/1210 (57%), Positives = 818/1210 (67%), Gaps = 87/1210 (7%)

Query: 17   RLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQL 76
            RL     KPPYR+ IR Q                  TTGVYFTS+YKNLR++RLYIAAQL
Sbjct: 4    RLRSFTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQL 63

Query: 77   KSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFS 136
            KSSQIDQ L YLYYQ YW+++RDTLQ  LAN+VAGNKS +NW  ++SVLEKFL SS+ FS
Sbjct: 64   KSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFS 123

Query: 137  AVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTS 196
              +VYD +F TVL+ TNN TG+ I  DVL +L PLSTN+PL SSLET GI+T+PV NG+S
Sbjct: 124  VARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSS 183

Query: 197  YLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQ 256
            YLMSMSLP+FANPSIIL+ SRVYGY+T++M+A+GLLSVFNDTTA+E+S VAIVSAVY N 
Sbjct: 184  YLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNA 243

Query: 257  SELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYS 316
            ++LDAY    PP+G T+S+ +  F L N++FL+ AL+QGKGG++K T   Y   +AVGYS
Sbjct: 244  TKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYS 303

Query: 317  PCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRL 376
            P +  LANWV++V+QAESVF  P+TKL KIIAG VVGI VF ML+T PLA++AVKPIVRL
Sbjct: 304  PSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRL 363

Query: 377  KKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXXXXX 436
            +KATE+ITE RGLRPTTP SG  SR +S+ R+KS   S      ST              
Sbjct: 364  QKATELITESRGLRPTTPTSG--SRANSILRDKSSLISFPLHPVSTNN-----INNNNSN 416

Query: 437  XXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASA--STVNTLTI-DSNDRLSERSK 493
                P    S+    TN+S  S    N+ +E    A    S ++   + D  +RLS  SK
Sbjct: 417  EKAQP---PSDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSK 473

Query: 494  HLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXX 553
            H  T  NL +ARVP  R LF DELSDLTETFNTMTDALD+HY LLE+RVRART       
Sbjct: 474  HYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAK 533

Query: 554  XXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXX 613
                      TVFIANISHELRTPLNGILGMTAISMEE DI KIR+SLKLIFRSG     
Sbjct: 534  IEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLH 593

Query: 614  XXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMV 673
                   FSKNVL+RTKLEKRNFCITDVALQ+KSIFGKVAKDQHVRLSIILSPN++R+MV
Sbjct: 594  ILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMV 653

Query: 674  LYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEF 733
            LYGDSNRIIQ+VMNLVSNALKFTPVDGKV V++K+LG YDE  S+     KVYVK GTE 
Sbjct: 654  LYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEI 713

Query: 734  TSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDDPSEGTTINTSQQ 793
            T     L   S+ +                  D   ++  + ++ S D +   T  T + 
Sbjct: 714  TDSTPSLNVKSEGQGK----------------DKFTSDTASKNNTSSDTAYDATPTTDRV 757

Query: 794  RTSSNED--YVDNISIASTSTSSYDDAIFNSQFKKTPDLY-EDEDGNLGEELSQQKTWVF 850
               S+ED  Y DN S+ S++TSSYDDAIFNSQFKKT +LY ED++  +G EL   KTWV 
Sbjct: 758  AQESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVI 817

Query: 851  RIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLEST 910
              EV D+GPGID  LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M LES 
Sbjct: 818  SFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESK 877

Query: 911  VGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXXXXX 970
            VG GSKF FT+PLTQTR I     E P+EDEFN KSK NRKVKF +A             
Sbjct: 878  VGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIV 937

Query: 971  XXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQ----------------------- 1007
                    +V   +  ++     D S S++    SP+                       
Sbjct: 938  TAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNR 997

Query: 1008 -------PESGSNLNLDRPFLQSTGTAISSANVPTVATLGKT------LNV--------- 1045
                     S S ++LDRPFLQSTGTA S+ ++P +++  +       LNV         
Sbjct: 998  DKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKK 1057

Query: 1046 ----------LVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDM 1095
                      LVAEDNHVNQEVIKRML LEGVK+IDLACDGQDAFD VK L+++G  Y++
Sbjct: 1058 TSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNL 1117

Query: 1096 IFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRP 1155
            IFMDVQMPKVDGL++TKMIR+DL  + PIVALTAFADDSNIKECLDAGMDGFLSKPIKR 
Sbjct: 1118 IFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRT 1177

Query: 1156 QLKTILLEYC 1165
            +LKTIL E+C
Sbjct: 1178 KLKTILKEFC 1187

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1218 (55%), Positives = 823/1218 (67%), Gaps = 96/1218 (7%)

Query: 25   PPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQT 84
            PP+RI IR Q                  TTGVYFTS+YKNLR++RLYIAAQLKSSQ+DQT
Sbjct: 13   PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72

Query: 85   LTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDEN 144
            L YLYYQ+Y++++RD LQ SL ++VAGNKS  NW  + SV++KFLSSS+ F   +VYD +
Sbjct: 73   LNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132

Query: 145  FDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLP 204
            F TVL+ TNNGTG+ I  DVL+ LFPLST+IPL SSLETTGILTDP++N T YLMSMSLP
Sbjct: 133  FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192

Query: 205  VFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHL 264
            +FANPSIIL+ SRVYGYITI+M+A+GL SVFNDTTA+EKSNVAI+SA YN Q     YH 
Sbjct: 193  IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252

Query: 265  ALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELAN 324
              PPYG   S+T   F ++N++F++   + GKGGS+KKT+    K +A+GYSPCSF+L N
Sbjct: 253  VFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVN 312

Query: 325  WVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIIT 384
            WV+VVSQ ESVF  P+TKLTKIIAG V+ I VFV+L+TLPL ++AVKPIVRL+KATE+IT
Sbjct: 313  WVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELIT 372

Query: 385  EGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXX---XXXXXXHP 441
            EGRGLRP+TP   +VSR SS RR  S   +  SS     TG                   
Sbjct: 373  EGRGLRPSTP--RTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGHGSSGHGSG 430

Query: 442  MVLTSENVLVT----NHSGLS------RIPVN-----------MNQELLDRASASTVNTL 480
            + L++E+ + +     H  LS      +IP N           +N +LL        N+L
Sbjct: 431  VALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLL------APNSL 484

Query: 481  TIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLED 540
              +  DR S RS  L T  NLTEAR+P  ++LF DELSDLTETFNTMTDALD+HY LLED
Sbjct: 485  RNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLED 544

Query: 541  RVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSS 600
            RVRART                 TVFIANISHELRTPLNGILGMTAISMEE D+ KIR++
Sbjct: 545  RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNN 604

Query: 601  LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRL 660
            LKLIFRSG            FSKNVLQRTKLE+R+FCITDVALQ+KSIFGKVAKDQ VRL
Sbjct: 605  LKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRL 664

Query: 661  SIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNS 720
            SI L PN++RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V V++KLLGEYD++SS+  
Sbjct: 665  SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKR 724

Query: 721  KFEKVYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSD 780
            +F++V+VK GTE T +   + ++ KR+                 L+   A++ +   +S 
Sbjct: 725  QFKEVHVKKGTEITDV---VESIDKRDLPTSLGRRKYV-----NLESTTASITSCRDNSA 776

Query: 781  DPSEGTTINT---------SQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLY 831
               E T  NT         +  R  S+ D  D  SI ST+TSSYDDAIFNSQF K  D  
Sbjct: 777  IQEEITKRNTAANENIYKKANDREKSSND--DVSSIVSTTTSSYDDAIFNSQFNKALDSD 834

Query: 832  EDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGL 891
             DE GN+G  +   KTWV  IEV DTGPGI+ SLQESVF+PFVQGDQTLSRQYGGTGLGL
Sbjct: 835  SDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGL 894

Query: 892  SICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRK 951
            SICRQLA MM+GTM LES VG GSKF FT+PL QT+ I     E P+EDEFNP+SK NR+
Sbjct: 895  SICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRR 954

Query: 952  VKFNVAXXXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSD-----------VSTSNK 1000
            VKF+VA                     T+  +  +E RS+  +               N+
Sbjct: 955  VKFSVAKSIKSRQSTSSLTTPVTNSN-TLANDVLIEARSSDEEEVEKTKNFIKRKEGENE 1013

Query: 1001 NESASPQP------------------------------ESGSNLNLDRPFLQSTGTAISS 1030
            N  A  QP                              E+  ++N+DRPFLQSTGTA SS
Sbjct: 1014 NGKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSS 1073

Query: 1031 ANVPTVA---TLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLK 1087
             NVPTV      G ++ +LV EDNHVNQEVI+RML+LEG+ NI+LACDGQ+AFD VK L 
Sbjct: 1074 RNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELT 1133

Query: 1088 ERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGF 1147
             +GE Y+MIFMDVQMPKVDGL +TKMIR DL Y+ PIVALTAFADDSNIKECL++GM+GF
Sbjct: 1134 SKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGF 1193

Query: 1148 LSKPIKRPQLKTILLEYC 1165
            LSKPIKRP+L TIL E+C
Sbjct: 1194 LSKPIKRPKLNTILSEFC 1211

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 1234 bits (3194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1254 (54%), Positives = 834/1254 (66%), Gaps = 107/1254 (8%)

Query: 14   RLKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIA 73
            RL+  +     PP+RI IR Q                  TTGVYFTS+YKNLR++RLYIA
Sbjct: 2    RLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIA 61

Query: 74   AQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSD 133
            AQLKSSQIDQTL YLYYQ+Y++++RD LQ SL +FVAGNKS+ NW  + SV++KFLSSS+
Sbjct: 62   AQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSN 121

Query: 134  YFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLN 193
             F   KVYD +F TVL+ TNNGTG+ I  DVL+ LFPLST+ PL SSLETTGILTDPV+N
Sbjct: 122  LFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVN 181

Query: 194  GTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVY 253
             T YLMSMSLP+FANPSIIL+ SRVYGYITIIM+A+GL SVFNDTTA+EKSNVAI+SA+Y
Sbjct: 182  NTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALY 241

Query: 254  NNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAV 313
            NNQ +   YH   PPYG  +++T   F +KN++F++ A + GKGGS+K+T+    K +A+
Sbjct: 242  NNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301

Query: 314  GYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPI 373
            GYSPCSF+L NWV+VVSQ ESVF  P+TKL KII G V+ I VFV+L+TLPLA++AV+PI
Sbjct: 302  GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361

Query: 374  VRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXX- 432
            VRL+KATE+ITEGRGLRP+TP +  VSR SS +R      ++ SS     TG        
Sbjct: 362  VRLQKATELITEGRGLRPSTPRT--VSRASSFKRGFGSGFTVPSSLLQFNTGESGSTISA 419

Query: 433  --------------XXXXXXXHPMVLTSENVLVTNHSGLSRIPVN-----------MNQE 467
                                   + L +E +L +      +IP N           +N +
Sbjct: 420  SGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDE--KKIPNNNTDAKVSMDGSLNHD 477

Query: 468  LLDRASASTVNTLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTM 527
            LL        N+L  +  DR S RS  L T  NLTEAR+P  R+LF DELSDLTETFNTM
Sbjct: 478  LL------APNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTM 531

Query: 528  TDALDEHYTLLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAI 587
            TDALD+HY LLEDRVRART                 TVFIANISHELRTPLNGILGMTAI
Sbjct: 532  TDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAI 591

Query: 588  SMEEEDITKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKS 647
            SMEE D+ KIR+SLKLIFRSG            FSKNVLQRTKLEKR+FCITDVALQ+KS
Sbjct: 592  SMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKS 651

Query: 648  IFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIK 707
            IFGKVAKDQ VRLSI L PN++RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V V++K
Sbjct: 652  IFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMK 711

Query: 708  LLGEYDEESSKNSKFEKVYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDG 767
            LLGEYD++ S+  +F++V+VK GTE T    E +  + +              ++     
Sbjct: 712  LLGEYDKDLSEKKQFKEVHVKRGTEIT----EYSEETNKCDIPISSNHRKHVDLESTTTS 767

Query: 768  IPANVFASDSDSDDPSEGTTINTSQQRTSSNEDYVDNISIAS------------TSTSSY 815
            I +N      D+    E  T    ++ T++NE+    ++ A             T+TSSY
Sbjct: 768  ITSN-----RDTSIIQEEIT----KRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSY 818

Query: 816  DDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQ 875
            DDAIFNSQF K P   EDE GNLG+ +   KTWV  IEV DTGPGID SLQESVF PFVQ
Sbjct: 819  DDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQ 878

Query: 876  GDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESE 935
            GDQTLSRQYGGTGLGLSICRQLA MMNGTM LES VG GSKF FT+PL QT+ I     +
Sbjct: 879  GDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMD 938

Query: 936  HPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXXXXXXXXXXXXATV--------------- 980
             P+EDEFNP+S+ NR+VKFNVA                    + +               
Sbjct: 939  FPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQI 998

Query: 981  ---------REE----SRLETRSNHSDV------STSNKNESASPQP------ESGSNLN 1015
                     RE      R+E +    +V      S++  +E  +  P      ES  ++N
Sbjct: 999  KRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVN 1058

Query: 1016 LDRPFLQSTGTAISSANVPTVATLGK---TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDL 1072
            LDRPFLQSTGTA SS NVPT+    K   ++ +LV EDNHVNQEVIKRML+LEG++NI+L
Sbjct: 1059 LDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIEL 1118

Query: 1073 ACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFAD 1132
            ACDGQ+AFD VK L  +G  Y+MIFMDVQMPKVDGL +TKMIR DL Y+ PIVALTAFAD
Sbjct: 1119 ACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFAD 1178

Query: 1133 DSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCPKVDSMGRATSTGEESKHTKS 1186
            DSNIKECL++GM+GFLSKPIKRP+LKTIL E+C      G+   T EE K  K+
Sbjct: 1179 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY--QGKKI-TSEEPKKAKT 1229

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1222 (56%), Positives = 828/1222 (67%), Gaps = 104/1222 (8%)

Query: 25   PPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQT 84
            PP+RISIR Q                  TTGVYFTS+YKNLR++RLYIAAQLKSSQIDQT
Sbjct: 13   PPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72

Query: 85   LTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDEN 144
            L YLYYQ+Y++++RD LQ+SL  +VAGNKSS NW  + S+++KFLSSS+ F   KVYD +
Sbjct: 73   LNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSS 132

Query: 145  FDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLP 204
            F TVL+ TNNGTG+ I  D+ ++LFPLST++ L SSLETTGILTDP+LN T YLMSMSLP
Sbjct: 133  FTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLP 192

Query: 205  VFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHL 264
            +FANPSIIL+ SRVYGYITIIM+A+GL SVFNDTTA+EKSNVAI+SAVYNNQS+  AYH 
Sbjct: 193  IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHF 252

Query: 265  ALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELAN 324
              PPYG ++S+T   F +KN++F++ A K GKGGS+KKT+    K +A+GYSPCSF+L N
Sbjct: 253  VFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVN 312

Query: 325  WVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIIT 384
            WV+VVSQ ESVF  PSTKL KII G V+ I VFV+L+TLPLA++AV+PIVRL+KATE+IT
Sbjct: 313  WVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELIT 372

Query: 385  EGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSS----------------------RKST 422
            EGRGLRP+TP +  VSRTSS +R  S   ++ SS                      R S 
Sbjct: 373  EGRGLRPSTPRT--VSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSASGHGCSGRGSA 430

Query: 423  ATGXXXXXXXXXXXXXXHPMVLTSENVLVTNHSGLSRIPVN--MNQELLDRASASTVNTL 480
            A                  +    E     N    ++I ++  +N +LL        N L
Sbjct: 431  AVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLL------APNAL 484

Query: 481  TIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLED 540
                NDR S RS  L T  NLTEAR+P  R+LF DELSDLTETFNTMTDALD+HY LLED
Sbjct: 485  RHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544

Query: 541  RVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSS 600
            RVRART                 TVFIANISHELRTPLNGILGMTAISMEE D+ KIR+S
Sbjct: 545  RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604

Query: 601  LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRL 660
            LKLIFRSG            FSKNVLQRTKLEKR+FCITDVALQ+KSIFGKVAKDQ VRL
Sbjct: 605  LKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664

Query: 661  SIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNS 720
            SI L PN +RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V+V++KLLGEYD+E S+  
Sbjct: 665  SISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKK 724

Query: 721  KFEKVYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLD-GIPANVFASDSDS 779
            +F++V+V+ GTE   I  ++  ++K ++             K+ +D         S+ D+
Sbjct: 725  QFKEVHVRKGTE---IIEDIGNINKHDA-------KKSENFKKSMDSESTTTSMTSNRDT 774

Query: 780  DDPSEGTTINTSQQRTSSNEDYV------------DNISIASTSTSSYDDAIFNSQFKKT 827
                E  T    ++ T++NE+              D  SI STSTSSYDDAIFNSQF K 
Sbjct: 775  STIQEEIT----KRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKA 830

Query: 828  PDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGT 887
                +DE G+LG+ +   KTW   IEV DTGPGID SLQESVF PFVQGDQTLSRQYGGT
Sbjct: 831  LGSDDDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGT 890

Query: 888  GLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSK 947
            GLGLSICRQLA MM+GTM LES VG GSKF FT+PL QT+ I       P+EDEFNP+S+
Sbjct: 891  GLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESR 950

Query: 948  MNRKVKFNVAXXXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSD------------- 994
             NR+VKFNVA                        E  R ++RSN  +             
Sbjct: 951  QNRRVKFNVARSIKSRQSASSIATPTANRCGLTNEMLR-KSRSNEEEEGRKIINIEEGKE 1009

Query: 995  ----------------------VSTSNKNESASP------QPESGSNLNLDRPFLQSTGT 1026
                                   S+++ NE  S       + ES  ++NLDRPFLQSTGT
Sbjct: 1010 GGNELDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGT 1069

Query: 1027 AISSANVPTVATLGK---TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNV 1083
            A S+ N+PTV+   K   ++ +LV EDNHVNQEVIKRML+LEG++NI+LACDGQDAFD V
Sbjct: 1070 ATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKV 1129

Query: 1084 KSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAG 1143
            K L  RGE Y+MIFMDVQMPKVDGL +TKMIR DL Y  PIVALTAFADDSNIKECL++G
Sbjct: 1130 KELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESG 1189

Query: 1144 MDGFLSKPIKRPQLKTILLEYC 1165
            M+GFLSKPIKRP+LKTIL+E+C
Sbjct: 1190 MNGFLSKPIKRPKLKTILIEFC 1211

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 1219 bits (3155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1219 (54%), Positives = 817/1219 (67%), Gaps = 87/1219 (7%)

Query: 19   AHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKS 78
            + L   PP+RI IRTQ                  TTGVYFTS+YKNLR++RLYIAAQLKS
Sbjct: 7    SKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 66

Query: 79   SQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAV 138
            SQIDQTL YLYYQ+Y++++RD LQ SL ++VAGNKS+ NW  + SV++KFLSSS+ F   
Sbjct: 67   SQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVA 126

Query: 139  KVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYL 198
            KVYD +F+ VL+ TNNGTG+ I  DVL+ LFPLST+ PL SSLET GILTDPVLN T YL
Sbjct: 127  KVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYL 186

Query: 199  MSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSE 258
            MSMSLP+FANPSIIL+ SRVYGYITIIM+A+GL SVFNDTTA+E S +AI+SAVYN+Q +
Sbjct: 187  MSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGK 246

Query: 259  LDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPC 318
               YH   PPYG  + +    F +KN +F++ A + GKGGS+K+T+ L  +  A+GYSPC
Sbjct: 247  ASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPC 306

Query: 319  SFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKK 378
            SF L NWV++VSQ ESVF  P+TKL KII G V+ I VFV+L+TLPLA++AV+PIVRL+K
Sbjct: 307  SFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 379  ATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSR---KSTATGXXXXXXXXXX 435
            ATE+ITEGRGLRP+TP +  +SR SS +R  S   ++ SS     +   G          
Sbjct: 367  ATELITEGRGLRPSTPRT--ISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGG 424

Query: 436  XXXXHPMVLTS--------------------ENVLVTNHSGLSRIPVN--MNQELLDRAS 473
                     ++                    EN +  NH+  ++I ++  +N +LL   S
Sbjct: 425  SGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTD-AKISMDGSLNHDLLGPHS 483

Query: 474  ASTVNTLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDE 533
                  L  +  DR S RS  L T  NLTEAR+P  R+LF DELSDLTETFNTMTDALD+
Sbjct: 484  ------LRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQ 537

Query: 534  HYTLLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEED 593
            HY LLE+RVRART                 TVFIANISHELRTPLNGILGMTAISMEE D
Sbjct: 538  HYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETD 597

Query: 594  ITKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVA 653
            + KIR+SLKLIFRSG            FSKNVLQRTKLEKR+FCITDVALQ+KSIFGKVA
Sbjct: 598  VNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVA 657

Query: 654  KDQHVRLSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYD 713
            KDQ VRLSI L PN++RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V V++KLLGEYD
Sbjct: 658  KDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYD 717

Query: 714  EESSKNSKFEKVYVKGGTEF-----TSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGI 768
            +E S+  ++++VY+K GTE      T+   +L  LS    +                  I
Sbjct: 718  KELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTI 777

Query: 769  PANVFASDSDSDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTP 828
               +   ++ ++   E      + +  +SN+D     SI ST+TSSYD+AIFNSQF K P
Sbjct: 778  QEEITKRNTVAN---ESIYKKVNDREKASNDDVS---SIVSTTTSSYDNAIFNSQFNKAP 831

Query: 829  DLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTG 888
               ++E GNLG  +   KTWV  IEV DTGPGID SLQESVF PFVQGDQTLSRQYGGTG
Sbjct: 832  GSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTG 891

Query: 889  LGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKM 948
            LGLSICRQLA MM+GTM LES VG GSKF FT+PL QT+ I   + E P+EDEFNP+S+ 
Sbjct: 892  LGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRK 951

Query: 949  NRKVKFNVAXXXXXXXXXXXXXXXXXXXXA-------TVREESRLETRS-NHSDVSTSNK 1000
            NR+VKF+VA                    +        VR + + ET+   + ++    K
Sbjct: 952  NRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEK 1011

Query: 1001 NESAS-------------------------------PQPESGSNLNLDRPFLQSTGTAIS 1029
            N++                                  + E   ++NLDRPFLQSTGTA S
Sbjct: 1012 NDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATS 1071

Query: 1030 SANVPTVATLGK---TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSL 1086
            S N+PTV    K   ++ +LV EDNHVNQEVIKRML+LEG++NI+LACDGQ+AFD VK L
Sbjct: 1072 SRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKEL 1131

Query: 1087 KERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDG 1146
              +GE Y+MIFMDVQMPKVDGL +TKMIR DL Y  PIVALTAFADDSNIKECL++GM+G
Sbjct: 1132 TSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNG 1191

Query: 1147 FLSKPIKRPQLKTILLEYC 1165
            FLSKPIKRP+LKTIL E+C
Sbjct: 1192 FLSKPIKRPKLKTILTEFC 1210

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1207 bits (3124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1167 (55%), Positives = 790/1167 (67%), Gaps = 79/1167 (6%)

Query: 15   LKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAA 74
            +++L     + P R+ IR Q                  +TGVYFT +YKNLR+ RLY+AA
Sbjct: 3    MRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAA 62

Query: 75   QLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDY 134
            QLKS+QIDQ L Y+YYQ YW+S+RDTLQ++LAN+VAGNK+ +NW  + +V++KFL+SS  
Sbjct: 63   QLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGL 122

Query: 135  FSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNG 194
            FS   +YD  F  VLS TNNGTGN I    L++L PLS N PL SSL++ GILT+PVLNG
Sbjct: 123  FSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNG 182

Query: 195  TSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYN 254
            TSYLMSMSLP+FANPSIIL+TS VYGYITI+M+AD L +VF+DTTA+EKSNVAI+SAVY+
Sbjct: 183  TSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYD 242

Query: 255  NQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVG 314
                L +Y+    P G  +S+      +KN +FL+ AL+QGKGG++++T FLY K VAVG
Sbjct: 243  QNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302

Query: 315  YSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIV 374
            YSPCS    NW++VV Q+E+VF  P+TKLTKII+G VVGI VFV LVT PLA++AVKPIV
Sbjct: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362

Query: 375  RLKKATEIITEGRGLRPTTPGSGS--VSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXX 432
            RL+KATE+ITEGRGLR ++PG+GS  VSR SS     S   S + SR +           
Sbjct: 363  RLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHD-- 420

Query: 433  XXXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERS 492
                       L  E +      G   +  ++N  L    ++S         N+ LS++S
Sbjct: 421  -----------LHGEQI----QHGFFAMNGSINHSLAASIASS--------GNEALSDKS 457

Query: 493  KHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXX 552
            K L T  NL EARVP+ R+ F DELS+LT+TFNTMTDALD+HY LLEDRVRART      
Sbjct: 458  KGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAA 517

Query: 553  XXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXX 612
                       TVFIANISHELRTPLNGILGMTAISMEE DI KI++SLKLIFRSG    
Sbjct: 518  KIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLL 577

Query: 613  XXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTM 672
                    FSKNVL+RTKLEKRNF +TDVALQ+KSIFGKVAKDQ VRLSI L PN++RTM
Sbjct: 578  HILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTM 637

Query: 673  VLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTE 732
            VL+GDSNRIIQ+VMNLVSNALKFTPVDGKV V + LLGEYD E S+N   +KVYV  GTE
Sbjct: 638  VLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697

Query: 733  FTSIPAELAALSKRESTAXXXXXXXXXXIKEK----LDGIPANVFASDSDSDDPSEGTT- 787
                                        I+EK    ++  P +  ++ S+    +E T  
Sbjct: 698  -----------------PKGNDEKDKGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPG 740

Query: 788  INTSQQRTSSNE--------DYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLG 839
            +N + ++ +S++        +  D +S  STSTSSY+D +F+SQFKKTP + +D    LG
Sbjct: 741  LNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELG 800

Query: 840  EELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAT 899
             E+  +K WV  I V DTGPGIDSSL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLAT
Sbjct: 801  VEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLAT 860

Query: 900  MMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXX 959
            MMNGTM L+S +G GS+F FTVPLTQTR I  D+    +EDEFNP SK NRKVKF +A  
Sbjct: 861  MMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKS 920

Query: 960  XXXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRP 1019
                              ++ +  S+L+                     +S  ++ LDRP
Sbjct: 921  LKSKRSKSSLMTVGPKSSSSDKSLSQLKLT-------------------DSDRSVRLDRP 961

Query: 1020 FLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDA 1079
            FLQSTGTA S+ N+ T +T+ K   +LVAEDN VNQEVIKRML+LEGV NI+L CDGQ+A
Sbjct: 962  FLQSTGTASSNTNLGTTSTINK---ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEA 1018

Query: 1080 FDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKEC 1139
             D VK L E GE Y++IFMDVQMPK+DGL +TKMIR DL Y HPIVALTAFADDSNI+EC
Sbjct: 1019 LDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIREC 1078

Query: 1140 LDAGMDGFLSKPIKRPQLKTILLEYCP 1166
            LDAGMDGFL+KPIKR QL+ I+ E+CP
Sbjct: 1079 LDAGMDGFLAKPIKRAQLRKIIEEFCP 1105

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1157 (55%), Positives = 796/1157 (68%), Gaps = 40/1157 (3%)

Query: 18   LAHLNTK--PPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQ 75
            + HL +K  PP+++ IRTQ                  TTGVYFT++YK+LRA+RL++AAQ
Sbjct: 4    IGHLRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQ 63

Query: 76   LKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYF 135
            LKSSQIDQ L YLYYQ YW+STRDTLQDSL  + AGN +  NW   E VLEKFL SSD F
Sbjct: 64   LKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLF 123

Query: 136  SAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGT 195
            S  ++YD  F TVL+ TNNG+GN +   VL  LFPLST+ PL+SSL+T+GILTDPVLN T
Sbjct: 124  SVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDT 183

Query: 196  SYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNN 255
             Y+MSMSLP+FA+PSI+L+ S + GYIT++M+A+ L  VFNDTTA++KS+VAI+SA Y+N
Sbjct: 184  VYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSN 243

Query: 256  QSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGY 315
            QS   +YH   PP+G  A + D +F ++N SF+  A    K GS+K+T F Y K VAVGY
Sbjct: 244  QSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGY 303

Query: 316  SPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVR 375
            SPC F+   WV+V+SQ E+VF  PST+LT II G  +GI+VF+ LVT PLA++AVKPIVR
Sbjct: 304  SPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVR 363

Query: 376  LKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXXXX 435
            L+KATEIIT  RGLR +   S   SRT+S R+  S  +SI S  ++              
Sbjct: 364  LQKATEIITARRGLR-SYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSN 422

Query: 436  XXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHL 495
                H    TS +V     S  +R+ + ++  L D    +   T T  +ND+ S +S + 
Sbjct: 423  FELHH---RTSNSV----DSQEARMELEISGALPD----TNPTTPTSYTNDQHSYKSDNF 471

Query: 496  ITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXXXX 555
            +  TNL +ARVP+  +LF DELS+LT+TFNTMTD LD HY LLEDRVRART         
Sbjct: 472  VNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIE 531

Query: 556  XXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXXXX 615
                    TVFIANISHELRTPLNGILGMTAISM E+D+ K+++SLKLIFRSG       
Sbjct: 532  AEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHIL 591

Query: 616  XXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLY 675
                 FSKNVLQRTKLE+RNF I DVALQ+KSIFGK+AKDQHV LSIILSPN++RTM+L+
Sbjct: 592  TELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILW 651

Query: 676  GDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTS 735
            GDSNRIIQ+VMNLVSNALKF+PVDGKV V+IKLLGEYD + SK+S +  V++K GTE   
Sbjct: 652  GDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPD 711

Query: 736  IPAELAALSKREST---AXXXXXXXXXXIKEKLDGIP-ANVFASDSDSDDPSEGTTINTS 791
              A  ++LS  E T   A            +KL   P A+   S SD  D SE  T   +
Sbjct: 712  ASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDT 771

Query: 792  QQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDG--NLGEELSQQKTWV 849
             +R  SN +  D++S+ S++ SSYDDAI ++Q +K P     ED   +LG +L   KTWV
Sbjct: 772  DKR--SNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWV 829

Query: 850  FRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLES 909
              IEV DTGPGI+ +L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTM LES
Sbjct: 830  IAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLES 889

Query: 910  TVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXXXX 969
             VG GSKF FTVPLTQTR +  D+ E+P+EDEFN  SK NRKVKF +             
Sbjct: 890  KVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKM------------- 936

Query: 970  XXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAIS 1029
                       +    + T  N    ST+ K   +  +   GS + +DRPFLQSTGTA S
Sbjct: 937  ----NKNSGGSKSRPSVNTSLNSGTDSTAEKMALSESEVSVGS-VRVDRPFLQSTGTATS 991

Query: 1030 SANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKER 1089
            + ++ TV +L +   +LVAEDN+VNQEV+KRML+LEG+ +IDLACDGQ+AFD VK+L+E 
Sbjct: 992  TRSITTVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEA 1051

Query: 1090 GEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLS 1149
             + Y +IFMDVQMP+VDGL +TKMIR +L+Y HPIVALTAFADDSNIK CLD+GM+GFLS
Sbjct: 1052 NDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLS 1111

Query: 1150 KPIKRPQLKTILLEYCP 1166
            KPIKRP+LK++L E+CP
Sbjct: 1112 KPIKRPKLKSVLSEFCP 1128

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1172 bits (3032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1150 (54%), Positives = 790/1150 (68%), Gaps = 63/1150 (5%)

Query: 24   KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
            KPPYRI+IR Q                  TTGVYFT +YK LR+ RL IAA+LKSSQIDQ
Sbjct: 10   KPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQIDQ 69

Query: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
            TL YL+YQ  ++++RDTLQ++L N+ AGNK+  NW  +E+V++KFLSSSD F   ++YD 
Sbjct: 70   TLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDL 129

Query: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
            NF  V++ TNNGTG+ I  +VL +LFPLSTN  L SSL   GILTDPVLNG+ YLMSMSL
Sbjct: 130  NFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSL 189

Query: 204  PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263
            P+  NPSIILS+SRVYGYITI+M+ADGL +V+ + TA+E SNV ++SA+YN+Q ++D +H
Sbjct: 190  PILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFH 249

Query: 264  LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323
                      S T I + ++N ++L+ AL +GK GSIKKT + +N+ +A+GYSPCSF L+
Sbjct: 250  FVFEVENDDFS-TLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLS 308

Query: 324  NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383
            NWV++V+Q E+VF  PSTKL KII+G VV I+VFV L+T PL+++AVKPIVRL+KATE+I
Sbjct: 309  NWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELI 368

Query: 384  TEGRGLRPTTPGS-GSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXXXXXXXXHPM 442
            ++GRGL+PT+  S G  S TS   RE       V S    + G                 
Sbjct: 369  SQGRGLKPTSNFSNGDSSSTSDNWRES------VESHVRASLGIFKS------------- 409

Query: 443  VLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFTNLT 502
                   L  N S   +   +MN E+ +R+S +      I S+D  S  S    T +NL 
Sbjct: 410  -------LRNNGSNELQSNDDMN-EINERSSKNNSTGDNIKSSDNDSSSSFQRYTTSNLV 461

Query: 503  EARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXXXXXXXXXXX 562
            +ARVP+  +   DELS+LT+TFN MT+ALD+HYTLLEDRVRART                
Sbjct: 462  QARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEA 521

Query: 563  XTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXXXXXXXXXFS 622
             TVFIANISHELRTPLNGILGMTAISMEE+D  KI+ +LKLIFRSG            FS
Sbjct: 522  KTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFS 581

Query: 623  KNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNRII 682
            KNVL+RT LEKR+FCIT++ALQ+KSIFGKVA+DQHV+L IIL PN +R+MVL+GDSNRII
Sbjct: 582  KNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRII 641

Query: 683  QVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTSIPAELAA 742
            Q+VMNLVSNALKFTP+DGKV V+IKLLGEYDEE S N  +++VY+K GTE          
Sbjct: 642  QIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL--------P 693

Query: 743  LSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDS---DDPSEGTTINTSQQRTSSNE 799
            +   + T            K+ ++G  A+  +  S S   D   E    N+      +N 
Sbjct: 694  IGNGKKTDMVRKKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNN 753

Query: 800  DYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGP 859
            D ++ +S+ ++ST SYDDA    QFKKTPDL +D++  LG ELS+ KTWV  +EV DTGP
Sbjct: 754  D-IEILSMTTSSTRSYDDAALQRQFKKTPDL-DDKEETLGVELSEPKTWVISVEVEDTGP 811

Query: 860  GIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIF 919
            GI+  LQE+VFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM LESTVG GSKFIF
Sbjct: 812  GIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIF 871

Query: 920  TVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXXXXXXXXXXXXAT 979
            TVPL QTR I  D+ +  +EDEFN +SK NR++KF +                     + 
Sbjct: 872  TVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKI-------------YDSSKSHDSN 916

Query: 980  VREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTV--- 1036
              +E  +++  +    +  +K+E+ +  P++ S + LDRPFLQSTGTA SS  +PT+   
Sbjct: 917  DEDEEGIKSSRDIDSSNNEHKDENGT-SPDNHSKVRLDRPFLQSTGTATSSQKIPTLINK 975

Query: 1037 --ATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYD 1094
                + K++ +LVAEDNHVNQEVIKRML+LE + NIDLACDGQDAFD VKSL +  E+YD
Sbjct: 976  EDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYD 1035

Query: 1095 MIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKR 1154
            +IFMDVQMPKVDGL +TKMIR DL Y+HPIVALTAFA+D NIKECLDAGMDGFL KPIKR
Sbjct: 1036 IIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKR 1095

Query: 1155 PQLKTILLEY 1164
            P+LK IL EY
Sbjct: 1096 PKLKQILQEY 1105

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1164 bits (3010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1162 (53%), Positives = 781/1162 (67%), Gaps = 55/1162 (4%)

Query: 13   QRLKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYI 72
            +RL+R        P  +SIRTQ                   TGVYFTSS+K+LRA RL++
Sbjct: 15   RRLRR--------PLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHV 66

Query: 73   AAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSS 132
            AAQLKSSQIDQ L YLYYQ YW+STRD LQ++L  ++AGN S+ NW    + L+KFL SS
Sbjct: 67   AAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSS 126

Query: 133  DYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVL 192
            + FS  +VYD +F  VL+V+NNG+GN I  ++L +LFPLST++ L SSLE TG+LTDPVL
Sbjct: 127  NLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVL 186

Query: 193  NGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAV 252
            NG+ YLMSMSLP+FANPSIILST++VYGYIT++++A+GL SV+NDTTA++ S+V IVS V
Sbjct: 187  NGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTV 246

Query: 253  YNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVA 312
            Y++  EL  YHL  PPY     V + ++Q++N SFL  A+K GKGGSIK T F  NK +A
Sbjct: 247  YDDH-ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIA 305

Query: 313  VGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKP 372
            VGYSPC+  LA WV++++Q E++F  PST+L KII G  + I+V   +VT PL+++AV+P
Sbjct: 306  VGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQP 365

Query: 373  IVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKST-ATGXXXXXX 431
            IVRL+KATEIIT GRGLR           +S++   K  RTS   S  S   TG      
Sbjct: 366  IVRLQKATEIITAGRGLRS--------DNSSTLFSHK--RTSTAESFSSIFGTGSVRRSG 415

Query: 432  XXXXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDS--NDRLS 489
                      +  +S+ V   N S        +NQE ++      VN+ T  S  N+  +
Sbjct: 416  SVARAGRDKYIPDSSKEVPRGNSSDAIH---EVNQENIEDIEMQKVNSPTPYSMMNESQA 472

Query: 490  ERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXX 549
             +S+  IT TNL EARVP+ ++LF DELS+LTETFNTMTD LD HY LLEDRVRART   
Sbjct: 473  VKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQL 532

Query: 550  XXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGX 609
                          TVFIANISHELRTPLNGILGMTAI+M EED  K++SSLKLIFRSG 
Sbjct: 533  EAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGE 592

Query: 610  XXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIM 669
                       FSKNVL+RTKLE+R+F I D+ALQ++SIFGK+AKDQHV L+I + PN++
Sbjct: 593  LLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLL 652

Query: 670  RTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKG 729
            R+MVL+GDSNRI+Q+VMNLVSNALKFTPVDGKV VK +LLGEYDEE SK S++++V+V  
Sbjct: 653  RSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLP 712

Query: 730  GTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDS---DDPSEGT 786
             TE  +   E    +K E  A          +      +P+   ++D  +      SE  
Sbjct: 713  PTESRTSSTE----AKDEKNAESCVDSDTNVL-----SLPSTAESTDEKNVKIGQRSESE 763

Query: 787  TINTSQQRTSSNEDY-VDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQ 845
             I++    +S  +D   D  SI S +TSSYDDAIF ++ +K     E+E+   G  L   
Sbjct: 764  AIDSEAIESSDEDDENEDTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEE---GRALESP 820

Query: 846  KTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTM 905
            K WV  +EV DTGPGID +L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMM+GTM
Sbjct: 821  KKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM 880

Query: 906  TLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXX 965
             L+S VG GSKF FTVPLTQT+ +  ++ E+P+EDEFNP SK NRKVKF +         
Sbjct: 881  KLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKS 940

Query: 966  XXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTG 1025
                                     N   V  S  N   +    S  ++ +DRPFLQSTG
Sbjct: 941  RSESSGTEGNG-------------GNSPGVEGSGGNSPGTGSEVSVGSVRVDRPFLQSTG 987

Query: 1026 TAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKS 1085
            TA+S+  V T ++L     +LVAEDN+VNQEVIKRML+LEG+++++LACDGQDAFD VK+
Sbjct: 988  TALSTTLV-TTSSLADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKA 1046

Query: 1086 LKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMD 1145
                G+ YD+IFMDVQMP+VDGL+AT+MIR +L Y HPIVALTAFADDSNIKECLDAGM+
Sbjct: 1047 QDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMN 1106

Query: 1146 GFLSKPIKRPQLKTILLEYCPK 1167
            GFLSKPIKRP++K IL EYCP+
Sbjct: 1107 GFLSKPIKRPKIKAILKEYCPR 1128

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1157 (51%), Positives = 772/1157 (66%), Gaps = 42/1157 (3%)

Query: 25   PPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQT 84
            PP+ + +RTQ                  TTGVYFT++YK++RA RL +AAQLKSSQ+DQ 
Sbjct: 20   PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79

Query: 85   LTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDEN 144
            L YLYYQ YW+STRDTLQD+L NF AGN S  NW S E  LEKFL SS  FSA +VYD +
Sbjct: 80   LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139

Query: 145  FDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLP 204
            F+TV++ TNNG+G+ I  +VL +LFPLS   PLSSSL TTGI+TDPV N T+YL+SMSLP
Sbjct: 140  FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199

Query: 205  VFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHL 264
            V  NPSIIL+T+ + GYIT+I +A+ L +V NDT A++KS+V+I+SAV+++ S L  YH 
Sbjct: 200  VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259

Query: 265  ALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELAN 324
              PP+G ++  + + F +KN +F+  A + GK GS+ KT+ +  + +AVGYSP +F+L N
Sbjct: 260  VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319

Query: 325  WVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIIT 384
            WV+VV+Q E VF  P+ +L KIIAG V  I+VF+ L+T P+A++AV+PIVRL+KATEIIT
Sbjct: 320  WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379

Query: 385  EGRGLRPTTPGSGSVSRTS---SMRREKSPRTSIVSSRKSTATGXXXXXXXXXXXXXXHP 441
             GR L+  +    S S T+   S  R  S +  ++     + T                P
Sbjct: 380  SGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNYNVFPP 439

Query: 442  MVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFTNL 501
                S +V   N   + R P ++ +      SA+T +T    SND  S  S+  I  TNL
Sbjct: 440  SRTDSPSVSARNSQTIPRGPGDLTR------SATTGSTPF--SNDSSSYTSERYIKSTNL 491

Query: 502  TEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXXXXXXXXXX 561
             EA VP+ R+ F DELS+LT+TFNTMTD LD HY LLE+RVRART               
Sbjct: 492  VEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANE 551

Query: 562  XXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXXXXXXXXXF 621
              TVFIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG            F
Sbjct: 552  AKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTF 611

Query: 622  SKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNRI 681
            SKNVL+RTKLE+R+F + D+ALQ+KSIFGK+AKDQHV+LSI L+PN +RT+VL+GDSNRI
Sbjct: 612  SKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRI 671

Query: 682  IQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEF-------- 733
            IQ+VMNLVSNALKFTPVDGKV V+IKLLGEYD + S++  +++V+V  G+E         
Sbjct: 672  IQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNL 731

Query: 734  -TSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDDPSEGTTINTSQ 792
             ++ P  L   S   S              +  +G       + ++ +D  E + +  S+
Sbjct: 732  TSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESK 791

Query: 793  QRTSSNEDYVDNISI-ASTSTSSYDDAIFNSQFKKTPDLYE-DEDGNLGEELSQQKTWVF 850
                 NED  + +SI +++++SSYDDAIF+SQFKK     + D + N   +L   KTWV 
Sbjct: 792  HE--ENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVI 849

Query: 851  RIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLEST 910
             +EV DTG GID SLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTM L+S 
Sbjct: 850  SMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSK 909

Query: 911  VGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXXXXX 970
            VG GSKFIFTVPL QT+ I  D +E  +EDEFN  S+ NRKVKF +              
Sbjct: 910  VGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKI-------------- 955

Query: 971  XXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISS 1030
                    +V+ +    +   HSD + S +  S S +   G N+ +DRPFLQSTGTA S+
Sbjct: 956  ---NSSRKSVQTKKSKSSIDGHSDNNVSERKASNSTENSVG-NVRVDRPFLQSTGTATST 1011

Query: 1031 ANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERG 1090
             ++ +VA+      VLVAEDN+VNQEVIKRML LEG+ ++D+ACDGQ+A++ V+ + + G
Sbjct: 1012 RSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNG 1071

Query: 1091 EFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSK 1150
            E Y MIFMDVQMP+VDGL ATKMIRNDL Y+ PIVALTA+ADDSNIK CL++GMDGFL K
Sbjct: 1072 ESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPK 1131

Query: 1151 PIKRPQLKTILLEYCPK 1167
            PIKRP LK I+ +YC K
Sbjct: 1132 PIKRPLLKKIIAQYCSK 1148

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1169 (53%), Positives = 772/1169 (66%), Gaps = 84/1169 (7%)

Query: 24   KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
            KPPYRISIR Q                  T GVYFT++YKNL+  RLYIAAQLK+SQIDQ
Sbjct: 10   KPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69

Query: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
            TL YLYYQ Y++S+ +TLQ+SL ++ AGN SS+NW  +  VLEKFL+SSD FS  ++YD 
Sbjct: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129

Query: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
            NF+ +++ TNN +GN +   V++KLF LS NI L SSLET GI TDPVLNG+++LMSMSL
Sbjct: 130  NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189

Query: 204  PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263
            P+FANPSIILS SR+YGY+++IM+A+GL SVFNDTTA+E S V ++SA Y+  + L+ ++
Sbjct: 190  PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249

Query: 264  -LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFEL 322
             L    Y       D+++++ N +F+   L  GKGG++KKT+     A AVGYS CSF L
Sbjct: 250  FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309

Query: 323  ANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEI 382
             NW+++V+Q E+ FS  +TKL +II+GVVV ++VFV L+T PL+++AV+P++RL+KATE 
Sbjct: 310  VNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATER 369

Query: 383  ITEGRGLRPTTPGSG-SVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXXXXXXXXHP 441
            I EGRGLRP  P  G SVSR SS++   S    +   R S                    
Sbjct: 370  IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHV---RSSLGFNANKLSDSGSITANNFK 426

Query: 442  MVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFTNL 501
               +S N + ++H     I  N N         S+ +++ I+ +D LS  S+   T  NL
Sbjct: 427  NNTSSSNSITSSH-----IYGNNN---------SSHSSMGINPDDDLSSSSQKYKTSANL 472

Query: 502  TEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXXXXXXXXXX 561
             EARVP+  +L  DELS+LT+TFNTMTDALD+HY LLE+RVRART               
Sbjct: 473  IEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANE 532

Query: 562  XXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXXXXXXXXXF 621
              TVFIANISHELRTPLNGILGMTAISMEE+D+ KIR +LKLIFRSG            F
Sbjct: 533  AKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTF 592

Query: 622  SKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNRI 681
            SKNVLQRTKLEKR+FCIT+VALQ+KSIFGK+AKDQHV+LSIIL PNI+R+ VL+GDSNRI
Sbjct: 593  SKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRI 652

Query: 682  IQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTSIPAELA 741
            IQVVMNLVSNALKFTPVDG V V+I LLGEYDEE SK   ++KVYVK GTE   +P  ++
Sbjct: 653  IQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTE---LPLNIS 709

Query: 742  ALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSD---DPSEGTTINTSQQRTSS- 797
             L   E+                      N  +  S+++   D +E  TI+      SS 
Sbjct: 710  HLKTEEN----------------------NDISRKSETELNNDENETHTISKDDTADSSI 747

Query: 798  ---NEDY----VDNISIAS---TSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKT 847
               NED     VD + +AS   TS+ SYDD     Q  K+ DL +DE+  LG EL +QKT
Sbjct: 748  KIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDEN-KLGVELKEQKT 806

Query: 848  WVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTL 907
            WV  +EV DTG GID  LQESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+TMMNGTM L
Sbjct: 807  WVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMEL 866

Query: 908  ESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXX 967
            ES VG GSKFIFT+PL QTR I + + E  + DEFN  SK NRKVKF  +          
Sbjct: 867  ESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNRKVKFKFSGSSSAKSIKT 925

Query: 968  XXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTA 1027
                            +R  T S  S  S S++ ++  P     S++ L+RPFLQSTGTA
Sbjct: 926  RNSIGSSL-------NNRHSTTSIDSSSSDSDEEDNVRP-----SSVRLNRPFLQSTGTA 973

Query: 1028 ISSANVPTV------ATLGKTLN------VLVAEDNHVNQEVIKRMLSLEGVKNIDLACD 1075
             S+ NVPT+       +  K LN      +LVAEDNHVNQEVIKRML LEG+ NIDLA D
Sbjct: 974  TSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARD 1033

Query: 1076 GQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSN 1135
            GQDAFD  K L E    YD+IFMDVQMP++DGL+ATKMIR +L Y  PIVAL+AF  + N
Sbjct: 1034 GQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEEN 1093

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            +KECLD GM+ FLSKPIKRP LK IL +Y
Sbjct: 1094 VKECLDVGMNDFLSKPIKRPDLKIILKKY 1122

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1186 (48%), Positives = 746/1186 (62%), Gaps = 77/1186 (6%)

Query: 2    VARVFARKRIS-QRLKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTS 60
            +A +F +K +S    +R+     +PPY+  + TQ                  TTGVYFT+
Sbjct: 1    MALLFIKKHLSIPTTRRIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTT 60

Query: 61   SYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWES 120
            +YK+LRA+RL +AAQL S+QI+QTL  +YYQ YW+S+RD++Q++L ++  GN SS N ++
Sbjct: 61   NYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDN 120

Query: 121  TESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSS 180
             + VL KFL SS+      +YD  F+ VLSV+ N TGN I  D+L  L PLS+N PL SS
Sbjct: 121  AKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSS 180

Query: 181  LETTGILTDPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTA 240
            +   G+L++PV NG+S+ MSMSLPV A  SI+   S   GYIT++M+AD + SV     A
Sbjct: 181  IIDDGMLSNPVFNGSSFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPA 240

Query: 241  IEKSNVAIVSAVYNNQSELDAYHLALPPYGF-TASVTDINFQLKNSSFLNGALKQGKGGS 299
            +  S V++++ VY+  + L++Y +  PP       + +I F + N+SFL  A      GS
Sbjct: 241  LNGSTVSVLAGVYDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGS 300

Query: 300  IKKTHFLYNKAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVM 359
            + KT+  Y   VAVGY+ CSF+L NWV+VV+Q E+VF  PSTKLTKII G V+GI+ F+ 
Sbjct: 301  VSKTNAFYEPNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFIC 360

Query: 360  LVTLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSR 419
            +VT  +A +AVKPIVRL+KATE+I  GRGLR     S S SRT+S+ R  S  +   + R
Sbjct: 361  IVTFIVANWAVKPIVRLQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLR 420

Query: 420  KSTATGXXXXXXXXXXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNT 479
            +                    P           N SG+ R      +  +D A A  +  
Sbjct: 421  EGDGLRKTPPSPYTPMHSHVEP-----------NPSGIGR------EYSVDIARAIGIEV 463

Query: 480  LTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLE 539
                 +   SER     T  N  E RVP+ R+LF DELS+LT+TFN+MTD LD HY LLE
Sbjct: 464  ----PSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLE 519

Query: 540  DRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRS 599
            DRVRART                 T+FIANISHELRTPLNGILGMTAI+M E D+ K+++
Sbjct: 520  DRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQN 579

Query: 600  SLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVR 659
            SLKLIFRSG            FSKN+L+R KLE+RNF + DVALQ+KSIFGK+AKDQ+V+
Sbjct: 580  SLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVK 639

Query: 660  LSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKN 719
             SI L PN++R MVL+GDSNRIIQ+VMNLVSNALKFTPVDGKV ++IKLLGEYDEE S+ 
Sbjct: 640  FSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEK 699

Query: 720  SKFEKVYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDS-- 777
                +V++K GTE +                           K   D I    + S S  
Sbjct: 700  CNNAEVFIKQGTEISD------------------------ETKNVFDTITEEKYVSCSGE 735

Query: 778  DSDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGN 837
             +DD     TI T Q+  +   D  DNIS+ S+ TSSYDDAIF+S+FKK P + + ++G+
Sbjct: 736  STDD-----TIETGQE-GAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGD 789

Query: 838  LGE--ELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICR 895
            L    +  ++K WV  IEV DTGPGID SLQESVF+PFVQGDQTLSRQYGGTGLGLSICR
Sbjct: 790  LSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICR 849

Query: 896  QLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFN 955
            QL+TMM GTM L S VG GSKFIFTVPL QT  ++  + E  +EDEFN +SK+NR+VKF 
Sbjct: 850  QLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFK 909

Query: 956  VAXXXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLN 1015
            +                     + +    R E+  + S V                    
Sbjct: 910  LNKGGKSRQSSLSVPEISGVPDSPLNSMGRSESELSVSSV-------------------R 950

Query: 1016 LDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACD 1075
            +DRPFLQSTGTA S+ ++PTV +L     VLVAEDN+VNQEVIKRML LEG+ +I+LACD
Sbjct: 951  VDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACD 1010

Query: 1076 GQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSN 1135
            G++A + V +L  + + Y+++FMDVQMPK+DGL AT+ IR +L Y +PIVALTAFADDSN
Sbjct: 1011 GEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSN 1070

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEYCPKVD-SMGRATSTGEE 1180
            IK CL++GMDGFLSKPIKR +L+ ILLEYCP ++ S+   T+ G E
Sbjct: 1071 IKVCLESGMDGFLSKPIKREKLRKILLEYCPVLNKSVSTTTNRGLE 1116

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1170 (47%), Positives = 716/1170 (61%), Gaps = 81/1170 (6%)

Query: 10   RISQRLKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANR 69
            R+    KRLA L  KPP++  +RTQ                  TTGVYFTS+Y+ LRA+R
Sbjct: 2    RLGYLRKRLAVL--KPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADR 59

Query: 70   LYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFL 129
            L++AA+L SSQ+DQ+LT LYYQ   +ST+DT+Q++L+++ AGN+S+ NW   + +L  FL
Sbjct: 60   LHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFL 119

Query: 130  SSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTD 189
              S  F    +YDE +  VLS  NN T   +A + L +L PL  +    +      + T 
Sbjct: 120  ERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETL 179

Query: 190  PVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIV 249
            P  N T  LMSM+LPV A  S I+    V G++TI+M+AD + +V NDT+ + +S V+I+
Sbjct: 180  P-YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSIL 235

Query: 250  SAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYN- 308
            + + N++  L  Y    PP     SVT+  + +KN+SFL  A        +  T   Y+ 
Sbjct: 236  TGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHF 295

Query: 309  -------KAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLV 361
                   K VAVGYS C F   +WV+VVSQ ESVF  P+ KLTKII G V+G++VF+ +V
Sbjct: 296  GALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIV 355

Query: 362  TLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKS 421
            T  LA +AVKPIVRL+KATE I  GRGLR       S S+ +S+ R             S
Sbjct: 356  TFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDR-------------S 402

Query: 422  TATGXXXXXXXXXXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLT 481
             + G              H     +EN     +SG      +  + L   A      T  
Sbjct: 403  NSRGSDHSLPRELFEKKHHVSPFVTENHAA--NSGSCSSMSDHERYLHHIARYHDGET-- 458

Query: 482  IDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDR 541
              S + LS+  K   + TN  + RVP+ R+LF DELS+LT+TFNTMTD LD  Y +LEDR
Sbjct: 459  --STNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDR 516

Query: 542  VRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSL 601
            VRART                 TVFIANI HELRTPLNGILGMTAI+M E+D  KI++SL
Sbjct: 517  VRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSL 576

Query: 602  KLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLS 661
            KLIFRSG            FSKNVL+RTKLE+R+F I D+ALQ+KSIFGK+AKDQHV+LS
Sbjct: 577  KLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLS 636

Query: 662  IILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSK 721
            I L PN +RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDGKV V+IKL+GEYD   S+   
Sbjct: 637  IYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACN 696

Query: 722  FEKVYVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDD 781
            F +VY+  GTE T+                             ++ IP  V   +   ++
Sbjct: 697  FSEVYILPGTEVTN---------------------------SSVNNIPTVVEEEEKACEE 729

Query: 782  PSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDL--YEDEDGNLG 839
                      +++ S   D  D ISI+S+  +SYDDA+ ++Q KK P     ED D N+ 
Sbjct: 730  EPTADDTPERKKKDSETVDDADAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVT 789

Query: 840  -EELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 898
              +L + ++WV  IEV DTGPGI+ SL ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 790  MSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLA 849

Query: 899  TMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAX 958
            TMM GTM LES VGSGSKF FTVPL QT  +K ++ +  +EDEFN  SK NRKVKF +  
Sbjct: 850  TMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQL-- 907

Query: 959  XXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDR 1018
                                ++ E          S + +  K+ES +    S  ++ +DR
Sbjct: 908  --NRSGKSRKGKMNNSNGAGSIAE----------SAIESFGKSESEA----SFGSVRVDR 951

Query: 1019 PFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQD 1078
            PFLQSTGTA S+ +VPT+++   +L +LVAEDN+VNQEVIKRML LEG  NIDLACDG+D
Sbjct: 952  PFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGED 1011

Query: 1079 AFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKE 1138
            A+  V +L E+GE YD+IFMDVQMP++DGL  TK++R  L YE+PIVALTAFADDSNIKE
Sbjct: 1012 AYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKE 1071

Query: 1139 CLDAGMDGFLSKPIKRPQLKTILLEYCPKV 1168
            CL++GM+ FL+KPIKRP LK ILLE+  ++
Sbjct: 1072 CLESGMNSFLAKPIKRPMLKKILLEHTSQL 1101

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1166 (47%), Positives = 707/1166 (60%), Gaps = 123/1166 (10%)

Query: 15   LKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAA 74
            LK L  L T PPY +++R Q                  +TGVYFT++YK+LRA +L+IAA
Sbjct: 3    LKNL-RLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAA 61

Query: 75   QLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDY 134
            QLKSSQ+DQ+L YLYYQS W    D L D+L  + +GNK++ NW  + S +  FL+SS  
Sbjct: 62   QLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSI 121

Query: 135  FSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNG 194
            FS   +YD NF  + +V+NNGTG  I  D++ +L PLS++  L +S+ T G LTDPVLN 
Sbjct: 122  FSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNT 181

Query: 195  TSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYN 254
            ++YLMS+SLP+F NPSIILS SRVYGY+TII  A  +++VFNDTTA+E SNVAI+SA Y 
Sbjct: 182  SNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYR 241

Query: 255  NQSEL-DAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAV 313
            N +   D YH   PPYG  ASV DI + L N+SFL  A  +   GS+  T F Y+  VAV
Sbjct: 242  NSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAV 301

Query: 314  GYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPI 373
            GYS C+F LANWV+VVSQ ESVF+  + KLTKII+G VVGI+  V  VT  ++Y+ VKPI
Sbjct: 302  GYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPI 361

Query: 374  VRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXX 433
            ++LK+ATE+I+ GRGLR   P   ++S  +S +   S RT+I  S     T         
Sbjct: 362  IKLKQATELISRGRGLR---PYYENLSDRTS-QDNTSTRTTIDLSDLDGYTNEKEKSL-- 415

Query: 434  XXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTL--TIDSNDR---L 488
                   P     E                 ++ L + AS S   TL   +  + R   L
Sbjct: 416  -------PTCTEDER----------------SKSLSNIASKSIFTTLRKILGFSSRSGML 452

Query: 489  SERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXX 548
            S  S + I   +    RVP+      DEL++L ETFN M D+LDEH  LLE+RV+ART  
Sbjct: 453  SPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKE 512

Query: 549  XXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSG 608
                           TVFIANISHELRTPLNGILGMTAI++EE+D  K++ SLKLI+RSG
Sbjct: 513  LEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSG 572

Query: 609  XXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNI 668
                        FSKNVLQ+TKLEK +FCI D+ALQ+KSIFGK+AKDQ V  SI++SPN+
Sbjct: 573  ELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNL 632

Query: 669  MRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVK 728
            +RTMV +GDSNRIIQV+MNLVSNALKFTP+DG V V+IKLLGEYDEE S  + ++KVY+K
Sbjct: 633  IRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIK 692

Query: 729  GGTEFT----SIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDDPSE 784
             GT FT    +IP E                     I +K+       FA  S S     
Sbjct: 693  EGTSFTGDNDAIPTE--------------------PISDKIS------FAGGSSS----- 721

Query: 785  GTTINTSQQRTSSNEDYVDNISIASTSTSSY-DDAIFNSQFKKTPDLYEDEDGNLGEEL- 842
               I+    +T  N++    I    ++ S Y ++ I  S +         E+ N G+EL 
Sbjct: 722  ---IHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYY---------ENKNPGQELL 769

Query: 843  ----SQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 898
                 + K WV  ++V DTGPGI  +LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 770  GVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 829

Query: 899  TMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAX 958
            ++M+GTM L+ST G GSKF FTVPL Q R I   E+E  +EDEFN  SK NRKV F    
Sbjct: 830  SIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNF---- 885

Query: 959  XXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDR 1018
                                   +  ++ +R   S    + KN+ A+   ++  N     
Sbjct: 886  -----------------------KTDKVTSRGIPS--KAAEKNDDANTNGQTTLNAEAKS 920

Query: 1019 PFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQD 1078
              L+ T   IS  N+           VL+ EDN VNQEVIKR+L LE +K I+ A DGQ+
Sbjct: 921  KTLKPTHITISEDNIDQ-----HDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQE 975

Query: 1079 AFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKE 1138
            A D VK      + +D+IFMD+QMP VDG +AT++IRN+L Y +PIVALTAFADDSN KE
Sbjct: 976  AIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKE 1035

Query: 1139 CLDAGMDGFLSKPIKRPQLKTILLEY 1164
            C ++GM+ FL+KPIKR +LK I+ E+
Sbjct: 1036 CENSGMNAFLAKPIKRFELKEIIKEF 1061

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1174 (41%), Positives = 679/1174 (57%), Gaps = 88/1174 (7%)

Query: 24   KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
            KPPYR S+R Q                   TGVYFT+ YK+L  NRLYIA+QLKSSQIDQ
Sbjct: 18   KPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSSQIDQ 77

Query: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
            TL YLYYQ YW+++R+T+Q  + +   G  ++S    ++SVL+KF+ +SD F    +YD+
Sbjct: 78   TLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDK 137

Query: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLS-TNIPLSSSLETTGILTDPVLNGTSYLMSMS 202
            N  ++++ TNN +G+ +   +L +L PLS TN  +   +  TGILTDP+LN T YLMSMS
Sbjct: 138  NLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYLMSMS 197

Query: 203  LPV---FANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSEL 259
            LP+   ++  + I + S +YGY+T++M+A+ L SVFNDT  +  S  A++SA+Y N +  
Sbjct: 198  LPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTLP 257

Query: 260  DAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCS 319
              +H   PP+    S+ D    +KN +F   A  + K GS KK   +  K  A+GY+P +
Sbjct: 258  RYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGYAPTN 317

Query: 320  FELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKA 379
            F L  WV+VV+  +  F   S KLTKII G VVGI+VFV L++LPL+Y+AV+PIVRL++A
Sbjct: 318  FPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRA 377

Query: 380  TEIITEGRGLR---PTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXXXXXXXXXX 436
            +E+IT+ RGLR     +    +   T     + +  + ++SS                  
Sbjct: 378  SELITKRRGLRNLNDDSFDDSNDDHTYDSNDDHTYESKLISST----------------- 420

Query: 437  XXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLI 496
                P +  S++ +    SG +R   N      +    +  N    +   R    S H +
Sbjct: 421  ----PTLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTH-V 475

Query: 497  TFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXXXXX 556
            + +   E +VP+ RKLF DEL++LT+TFN M++ALDEHY LLE RV  RT          
Sbjct: 476  SLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQA 535

Query: 557  XXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXXXXX 616
                   TVFIANISHELRTPLNGILGMT+ S+EE DI KI+  LKLIFRSG        
Sbjct: 536  EAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILT 595

Query: 617  XXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSP-NIMRTMVLY 675
                FSKNVL +TKLE R F I ++  Q+K+IF K+ + Q V+L I L P   +++++ Y
Sbjct: 596  ELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFY 655

Query: 676  GDSNRIIQVVMNLVSNALKFTP-VDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFT 734
            GDSNRI+QV+MNL+SNA+KFTP V+GKV+V + LLGEYDEE SK   + KV +K  T+  
Sbjct: 656  GDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIV 715

Query: 735  SIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDDPSEGTTINT---- 790
            +   EL      +S            +        A + ++ +    P   T   T    
Sbjct: 716  TESGELI-----KSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHP 770

Query: 791  -SQQRTSSNEDYVDNISIASTSTSS--YDDAIFNSQFKKTPDLYEDEDGNLG-----EEL 842
             +  R +SN   V+N SI+  S SS  YD+ +FN   K+      + DG++      E++
Sbjct: 771  GADSRRNSNVSTVNNSSISLDSESSKMYDNLMFNRLIKR------EGDGDINDIKALEQI 824

Query: 843  SQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMN 902
               K WV R EVID GPGID +L +SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  MM 
Sbjct: 825  EGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMK 884

Query: 903  GTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXX 962
            GT+ LES +G GSKFI+T+PL Q    K D  ++  E++ N  +  N  V  ++      
Sbjct: 885  GTLELESELGKGSKFIYTIPLLQVGGTKKDNDDN--EEDHNDNT--NSSVDIDII----- 935

Query: 963  XXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNE-----SASPQPESGSNLNLD 1017
                             V   S  +T S+ + + +++ NE     S S      +  +LD
Sbjct: 936  -------------EDTPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASLD 982

Query: 1018 RPFLQST---GTAISSANVPTVATLGK----TLNVLVAEDNHVNQEVIKRMLSLEGVKNI 1070
            +  LQ T      + +  +  +    K     L VLVAEDN VNQEVIKRML LE + +I
Sbjct: 983  KSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDI 1042

Query: 1071 DLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAF 1130
            +LA DG +AF+ VK      + YD+IFMD+QMPK+DGL +T  IR +LKYE  IVALTAF
Sbjct: 1043 ELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAF 1102

Query: 1131 ADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            AD+SNIKEC DAGMDGF+ KPIKR  L T+L E+
Sbjct: 1103 ADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/732 (58%), Positives = 491/732 (67%), Gaps = 48/732 (6%)

Query: 485  NDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRA 544
            NDR S RS+ L T TNL EAR+P  R+LF DELSDLT TFN MTDALD+HY LLEDRVRA
Sbjct: 452  NDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRA 511

Query: 545  RTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLI 604
            RT                 TVFIANISHELRTPLNGILGMTAISMEE DI KIR+SLKLI
Sbjct: 512  RTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLI 571

Query: 605  FRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIIL 664
            FRSG            FSKNVL+RT LEKRNFCITDVALQ+KSIFGKVAKDQHVRLSI L
Sbjct: 572  FRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISL 631

Query: 665  SPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEK 724
            +PN++RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDGKV V+IKLLGEYDEE++K   F++
Sbjct: 632  TPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQ 691

Query: 725  VYVKGGTE------FTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSD 778
            ++    ++       +S P  +       S+             EK           D D
Sbjct: 692  IHTIADSDAHQQHPVSSSPNGVLVKHLSTSSDSNSNLSDSDKYNEK---------TYDED 742

Query: 779  SDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNL 838
             D   E +  N S              S+ S+STSSYD+A+FN+QFKKTPDLYED +  L
Sbjct: 743  DD---EHSITNISDHSDDL-------SSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGL 792

Query: 839  GEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 898
            G EL+ QKTWVF IEV DTGPGID  L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 793  GTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 852

Query: 899  TMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAX 958
            TMM+GTM LES VG GSKF FTVPL QTRVIK DE E  +EDEFNP+SK NR+VKF  + 
Sbjct: 853  TMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDST 912

Query: 959  XXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQ--PESG----- 1011
                                  +      T    S+V   +  +S  P   P+ G     
Sbjct: 913  RSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGDENDS 972

Query: 1012 ----------------SNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQ 1055
                              ++LDRPFLQSTGTA SS NVPT+A +     +LVAEDNHVNQ
Sbjct: 973  KASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQ 1032

Query: 1056 EVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIR 1115
            EVIKRML+LEG+ NIDLACDGQDAFD V+SL E+ + YDMIFMD+QMPKVDGL +TKMIR
Sbjct: 1033 EVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIR 1092

Query: 1116 NDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCPKVDSMGRAT 1175
             DL Y+  IVALTAFADDSNIKEC++AGM+GFLSKPIKRP+LK IL EYCP    M ++ 
Sbjct: 1093 RDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSK 1152

Query: 1176 STGEESKHTKSN 1187
               +  K  + N
Sbjct: 1153 ENKDGDKKVEEN 1164

 Score =  507 bits (1306), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 291/368 (79%)

Query: 24  KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
           KPP+RI IR Q                  TTGVYFTS+YKNLR++RLYIAAQLKSSQ+DQ
Sbjct: 15  KPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQ 74

Query: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
            L YLYYQ YW+++RDTLQ++LA++VAGNK+  NWE + +V++KFLSSS+ F   +VYD 
Sbjct: 75  NLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYDY 134

Query: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
           +F  VL+ TNNGTG+++   +  +LFPLST++PL SSL T G+LTDPVLNGT YLMSMSL
Sbjct: 135 DFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSL 194

Query: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263
           P+FANPSII S  +VYGYIT++M+A+GL SVFNDTTA+EKSNVAIVSA Y+N +++D+Y 
Sbjct: 195 PIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYR 254

Query: 264 LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323
              PPYG + S+ +  F+L +SSFLNGA KQ KGGSIKKT F Y K VA+GY PCSF   
Sbjct: 255 FVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFV 314

Query: 324 NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383
           NWV+VVSQAESVF  PSTKLTKII+G VVGI+VFV L+T PLA +AVKPIVRL+KATE+I
Sbjct: 315 NWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374

Query: 384 TEGRGLRP 391
            EGRGLRP
Sbjct: 375 AEGRGLRP 382

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/689 (58%), Positives = 481/689 (69%), Gaps = 40/689 (5%)

Query: 481  TIDSNDRLS-ERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLE 539
            +++SN  +S +R++  +T +NL EARVP+ R  F DE S+LT+TFNTMT+ALD+HY LLE
Sbjct: 433  SLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLE 492

Query: 540  DRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRS 599
            DRVRART                 TVFIANISHELRTPLNGILGMTAISMEE DI KI+S
Sbjct: 493  DRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQS 552

Query: 600  SLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVR 659
            SLKLIFRSG            FSKNVLQRTKLEKR+F ITDVA+Q+KSIFGKVAKDQ V+
Sbjct: 553  SLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVK 612

Query: 660  LSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKN 719
             SI L PN +R MVLYGDSNRIIQ+VMNLVSNALKFTPVDGKV V+++LLGEYD++ S+N
Sbjct: 613  FSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSEN 672

Query: 720  SKFEKVYVKGGTEFTS---IPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASD 776
              F+ VYV  GTE      IP  +    K+E              KEK+        AS 
Sbjct: 673  EDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLE-----------KEKISEKHNEEEAST 721

Query: 777  SDSDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDG 836
            SD    SE T ++  +   S   D  D +S+ S STSSYDD IF++QFKK      DE+G
Sbjct: 722  SD----SEKTNLD-DKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDENG 776

Query: 837  NLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQ 896
            +L   L   K W   +EV DTGPGID SL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQ
Sbjct: 777  HL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQ 833

Query: 897  LATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNV 956
            LATMMNGTM L+S +G GSKF FT+PLTQTR I+  E E+ +EDEFNP SK NRKVKF V
Sbjct: 834  LATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEF-EDENAFEDEFNPLSKKNRKVKFKV 892

Query: 957  AXXXXXXXXXXXXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNL 1016
            A                    ++ +   +L  + + S+ S                N++L
Sbjct: 893  AKSIKSRKSKSSLSNSSGKGGSSDKSSKQL--KGSESEFSV--------------GNVSL 936

Query: 1017 DRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDG 1076
            DRPFLQSTGTA SS NV  V+ + K+  +LVAEDNHVNQEVIKRML+LEG+  IDLA DG
Sbjct: 937  DRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADG 996

Query: 1077 QDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNI 1136
            QDAFD VK+L+E+GE Y++IFMDVQMPKVDGL ATKMIR DL Y++PIVALTAFADDSNI
Sbjct: 997  QDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNI 1056

Query: 1137 KECLDAGMDGFLSKPIKRPQLKTILLEYC 1165
            + CL+AGM+GFLSKPIKRP+LKTI+ +YC
Sbjct: 1057 RVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

 Score =  467 bits (1201), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 231/382 (60%), Positives = 288/382 (75%)

Query: 14  RLKRLAHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIA 73
           RL  +A     PP+RISIRTQ                  TTGVYFTS+YK+LR+ RLY+A
Sbjct: 2   RLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVA 61

Query: 74  AQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSD 133
           AQLKSSQIDQ L YLYYQ YW+S++ TLQ SLAN+V+GNK+ +NW  + SVL+KFLSSS 
Sbjct: 62  AQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSA 121

Query: 134 YFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLN 193
            FS  +VYD +F TVL+ TNNGTG+ +  DVL KL PLS+N+ L +SLE+ G+LTDPVLN
Sbjct: 122 LFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLN 181

Query: 194 GTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVY 253
           GTSYLMSMSLP++ANPSIIL+ SRVYGY+TIIM+AD L SV++D TA+EKS+V IVSA+Y
Sbjct: 182 GTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIY 241

Query: 254 NNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAV 313
                L +Y     PYG T  + D  + + N+SFL+ AL+QGK GS ++T   YN+  AV
Sbjct: 242 KKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAV 301

Query: 314 GYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPI 373
           GYSPCSF+  NWV+++SQ+E+VF  PST+LTKII GVVVGI  FV + T PLA++AV+PI
Sbjct: 302 GYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPI 361

Query: 374 VRLKKATEIITEGRGLRPTTPG 395
           VRL+KATEIITEGRGLR  TPG
Sbjct: 362 VRLQKATEIITEGRGLRSGTPG 383

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/719 (53%), Positives = 481/719 (66%), Gaps = 16/719 (2%)

Query: 14  RLKRL-----AHLNTKPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRAN 68
           RLK+      A    KPP+ ISIRTQ                   TGVYFTSS+K++RA 
Sbjct: 3   RLKKFDLGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAE 62

Query: 69  RLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKF 128
           RLY+A+QLK+SQIDQ L YLYYQ Y++STRD LQ++L  ++AGN ++ NW    + L+KF
Sbjct: 63  RLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKF 122

Query: 129 LSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILT 188
           L SS+ FS  +VYD +F  VL+ +NN +GN +   VL +LFPLSTN+ L SSLE  G+LT
Sbjct: 123 LGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLT 182

Query: 189 DPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAI 248
           DPVLN T YLMSMSLP+FANPSIILSTS+VYGYIT++++A+GL +VFNDTTA+E S+V +
Sbjct: 183 DPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVIL 242

Query: 249 VSAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYN 308
           VS VY+N+ EL  YHL  PPYG  + + D  + + N SFL  A KQ KGGSIK THFLY+
Sbjct: 243 VSTVYDNR-ELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYS 301

Query: 309 KAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYF 368
           KAVA+GYSPCS +L  WV++++Q ES F  PST+L +II G  V I+V    VT PL+++
Sbjct: 302 KAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHW 361

Query: 369 AVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGXXX 428
           AV+PIVRL+KATEIIT GRGLR     +    + SS     S      S R+S   G   
Sbjct: 362 AVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRS---GSVA 418

Query: 429 XXXXXXXXXXXHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRL 488
                          L   +       G+     N     L +  + T  +L    +++ 
Sbjct: 419 RSSKHKYIPESAKGTLNKNDFEEIQPDGIE----NNEDAALQKVHSPTPGSLF---SEQR 471

Query: 489 SERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXX 548
           S RS+  IT TNL EARVP   +LF DELS+LTETFNTMTD LD HY LLEDRVRART  
Sbjct: 472 SARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQ 531

Query: 549 XXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSG 608
                          TVFIANISHELRTPLNGILGMTAI+M E D+ K++SSLKLIFRSG
Sbjct: 532 LEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSG 591

Query: 609 XXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNI 668
                       FSKNVL+RTKLE+R+F + ++ALQ++SIFGK+AKDQHV L+I + PN+
Sbjct: 592 ELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNV 651

Query: 669 MRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYV 727
           +RTMVL+GDSNRI+Q+VMNLVSNALKFTPVDG+V VK  LLGEYDE  + N  F++  V
Sbjct: 652 LRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAV 710

 Score =  427 bits (1097), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/395 (55%), Positives = 269/395 (68%), Gaps = 32/395 (8%)

Query: 789  NTSQQRTSSNEDY-VDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKT 847
            N   QR  SNE+   D  SI S + SSYDDAIF+S+ +K  +  E+EDG     L   + 
Sbjct: 810  NNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKG-NSGENEDG---RPLEHPRR 865

Query: 848  WVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTL 907
                +EV DTGPGI+ +LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMNG+M+L
Sbjct: 866  LAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSL 925

Query: 908  ESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXXXX 967
            +S VG GSKF FTVPLTQT+ +  +E E+P+EDEFNP SK NRKVKF V+          
Sbjct: 926  DSKVGVGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHS 985

Query: 968  XXXXXXXXXXATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTA 1027
                           ES +   S                       + +DRPFLQSTGTA
Sbjct: 986  SSSGQNSSVGTPTVSESEVSVGS-----------------------VRVDRPFLQSTGTA 1022

Query: 1028 ISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLK 1087
            +S+ +V T +   K   VLVAEDN+VNQEVIKRML+LEG+ ++DLACDGQDAFD VK+  
Sbjct: 1023 LSTRSVTTTSVANKC-KVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARN 1081

Query: 1088 ERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGF 1147
            E G+FYD+IFMDVQMP+VDGLSAT+MIRN+L Y HPIVALTA+ADD NIKEC+DAGM+GF
Sbjct: 1082 EAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGF 1141

Query: 1148 LSKPIKRPQLKTILLEYCP---KVDSMGRATSTGE 1179
            L+KPI+RP++K IL EYCP   K D   +  + G+
Sbjct: 1142 LAKPIRRPKIKEILSEYCPTYFKADGEKKGKTEGQ 1176

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/751 (52%), Positives = 472/751 (62%), Gaps = 105/751 (13%)

Query: 498  FTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTXXXXXXXXXXX 557
             + + E +VP+ R+LF DELS+LT+TFNTM+DALD+HY LLE+RVRART           
Sbjct: 471  MSTILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAE 530

Query: 558  XXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGXXXXXXXXX 617
                  TVFIANISHELRTPLNGILGMTAISMEE+DI  I+SSLKLIFRSG         
Sbjct: 531  AANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTE 590

Query: 618  XXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGD 677
               FSKNVLQRTKLE+R+FCITDVALQ+KSIFGKVAKDQHV+LSI L PN +RT+VL+GD
Sbjct: 591  LLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGD 650

Query: 678  SNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTE----F 733
            SNRIIQ+VMNLVSNALKFTP+DGKV V++ LLGEYD+E SK + +++V+VK GTE    +
Sbjct: 651  SNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENY 710

Query: 734  TSIPAEL---AALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDDPSEGTTINT 790
            + I  +L     ++ R + +          I EK D I  N           S  TT + 
Sbjct: 711  SKILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNN---------HQSSNTTFDI 761

Query: 791  SQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVF 850
            S    + +    D +S+ STSTSSYD+ +FN QFKK   L + ++  LG E+ + KTWV 
Sbjct: 762  SIHNRTRD----DTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVI 817

Query: 851  RIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLEST 910
             IEV DTGPGI  +LQESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMMNGTM LES 
Sbjct: 818  CIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESK 877

Query: 911  VGSGSKFIFTVPLTQTRVIKLDESE---HPYEDEFNPKSKMNRKVKF-----------NV 956
            VGSGSKF FTVPLTQTR I + E E     ++DEFN  SK NRKVKF           N 
Sbjct: 878  VGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANS 937

Query: 957  AXXXXXXXXXXXXXXXXXXXXATVREE---------SRLETRSNHSDVSTSNKNESASPQ 1007
            +                        EE         S  E +  H   STSN N   S  
Sbjct: 938  SLKSRKSKGSLNSSFVGEIQNVNEAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPS-- 995

Query: 1008 PESGSNLNLDRPFLQSTGTAISSANVP-------------------------------TV 1036
                    LDRPFLQSTGTA S+  +P                               T+
Sbjct: 996  --------LDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTI 1047

Query: 1037 ATLGKTLN----------------VLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAF 1080
               G T N                +LV EDNHVNQEVIKRML LE + NIDLACDG++A+
Sbjct: 1048 IQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAY 1107

Query: 1081 DNVKSL-----KERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSN 1135
              VK +      ++  +YD+IFMDVQMP++DGL +TK+IR++LKY  PIVALTAFAD+SN
Sbjct: 1108 TKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESN 1167

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEYCP 1166
            IKECLD GMDGFLSKPIKRP+LK IL E+CP
Sbjct: 1168 IKECLDVGMDGFLSKPIKRPKLKDILNEFCP 1198

 Score =  465 bits (1196), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 226/384 (58%), Positives = 288/384 (75%), Gaps = 3/384 (0%)

Query: 24  KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
           +PP  I IRTQ                   TG+YFT +YK++R +RL IAA+LKSSQ+DQ
Sbjct: 12  RPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQ 71

Query: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
           TL +LYYQ YW+S RDTLQ ++AN+ AGNKSSS W  ++ V+EKFLSSSD FS  ++YD 
Sbjct: 72  TLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDA 131

Query: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
           NF+ V++ TNNGTGN +  DVL KL PLS++ PL +SL ++G+LTDPVLN T+YLMSMSL
Sbjct: 132 NFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLMSMSL 191

Query: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQS-ELDAY 262
           P+ ANPSIIL+ S+VYGYITIIM+A+ L+SV+NDTTA+EKSNVAIVS  Y++ S  L  Y
Sbjct: 192 PILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEY 251

Query: 263 HLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFEL 322
           H   PPYG T  + DI + L+N SFL  A+   K GSI KT F YN  VA+GYSPCSF+L
Sbjct: 252 HFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDL 311

Query: 323 ANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEI 382
            +WV++VSQ ESVF  PSTKLT+IIAG VV I+VFV  VT PL+++AVKPIVRL+KATE+
Sbjct: 312 VSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATEL 371

Query: 383 ITEGRGLRPTTPGSGSVSRTSSMR 406
           I EGRGLR ++  + ++SR  S++
Sbjct: 372 IAEGRGLRSSS--NRTLSRNGSLK 393

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/683 (47%), Positives = 426/683 (62%), Gaps = 78/683 (11%)

Query: 486  DRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRAR 545
            D  S  S  ++   NL + +VP +R+   DELS+LTET+  MTDALDEH  LLE RV+ R
Sbjct: 436  DYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKER 495

Query: 546  TXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIF 605
            T                 TVFIAN++HELRTPLNGILGMTAI+MEE D+ +I+SSLKLI+
Sbjct: 496  TKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIY 555

Query: 606  RSGXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILS 665
            RSG            FSKNVL++TKLEK +FC+ D+ALQ++SIFGK++KDQHV+LSI + 
Sbjct: 556  RSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFIL 615

Query: 666  PNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKV 725
            PN +R+MVL+GD NRI+QV+MNLVSNALKFTPVDGK+ V IKLLGEYD++ S    ++ V
Sbjct: 616  PNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDV 675

Query: 726  YVKGGTEFTSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASDSDSDDPSEG 785
            Y+K                                           +  S+ D   P   
Sbjct: 676  YMK------------------------------------------EIRNSNGDKIKP--- 690

Query: 786  TTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQ 845
                 S + T S  D + N S+AS +  S ++ I++++FK   + ++D D  +G  L ++
Sbjct: 691  LMTLISSKDTMSVADNISNKSVASDTERSTNNTIYSNKFKNGSN-FQDTDDAIGVPLDKK 749

Query: 846  KTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTM 905
            + WV  +EV DTGPGI+ SLQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M+GTM
Sbjct: 750  RKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTM 809

Query: 906  TLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAXXXXXXXX 965
             LES VG GSKFIFTVPL QTR I+ + +E  +EDEFN  SK NR+VKF           
Sbjct: 810  KLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQ---------- 859

Query: 966  XXXXXXXXXXXXATVREESRLETRSNH-SDVSTSNKNESASPQPESGSNLNLDRPFLQST 1024
                          +   S +E      ++   S ++ES +  P   S         Q  
Sbjct: 860  ----EITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPSKSS---------QEM 906

Query: 1025 GTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVK 1084
            G +I            K   +L+ EDN VNQ V+ RML LEG++N  +ACDGQ+A + +K
Sbjct: 907  GNSIKYD--------VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIK 958

Query: 1085 SLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGM 1144
             ++ RGE+Y ++ MD+QMPKVDG++ATK+IR +LKY+ PIVALTAFADDSNI+ C  +GM
Sbjct: 959  EIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGM 1018

Query: 1145 DGFLSKPIKRPQLKTILLEYCPK 1167
            DGFL+KPIKR QLK IL E+CPK
Sbjct: 1019 DGFLAKPIKREQLKGILTEFCPK 1041

 Score =  379 bits (973), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 250/365 (68%)

Query: 24  KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
           K PY++ +RTQ                  +TGVYFT +Y++LR  +LYIAA+LKSSQIDQ
Sbjct: 11  KAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70

Query: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
           T+  LYYQ  W++ RD ++ +L ++ AGN+S+ NW ST  VL  FL SS  F    +YD 
Sbjct: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130

Query: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
            F+ +L+ TNN T + I  DVL  L PLS    L S L TTG+LTDPVLN ++YLMSMSL
Sbjct: 131 QFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190

Query: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263
           P+ ANPS+ LS SRV+GY+T++M+A+ + +V NDTTA+EKS VA++S+   N +    YH
Sbjct: 191 PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250

Query: 264 LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323
              PP+G +  + +  + ++NS+FL+ A    +GGSI K+  LY+KAVA+GY PCSF LA
Sbjct: 251 FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310

Query: 324 NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383
           NWV  VSQ E VF   S KLTKIIAG V+ I+VFV ++T PL+ ++V+PIVRL+KATE+I
Sbjct: 311 NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370

Query: 384 TEGRG 388
           ++  G
Sbjct: 371 SKRDG 375

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/482 (61%), Positives = 342/482 (70%), Gaps = 14/482 (2%)

Query: 488 LSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTX 547
            S +S HL T  NL EARVP  R+LF DELSDLT+TFNTMTDALD+HY LLEDRVRART 
Sbjct: 513 FSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTK 572

Query: 548 XXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRS 607
                           TVFIANISHELRTPLNGILGMTAISMEE DI+KIRSSLKLIFRS
Sbjct: 573 QLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRS 632

Query: 608 GXXXXXXXXXXXXFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPN 667
           G            FSKNVL+RT LEKR+FCITDVALQ+KSIFGKVAKDQ V+LSI L+PN
Sbjct: 633 GELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPN 692

Query: 668 IMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYV 727
            +RTMVLYGDSNRIIQ+VMNLVSNALKFTPVDGKV VK+KL+GEYDE  S  + F++VYV
Sbjct: 693 TIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYV 752

Query: 728 KGGTEF-----------TSIPAELAALSKRESTAXXXXXXXXXXIKEKLDGIPANVFASD 776
           K GTE             SIP+  +  +   ST             E  D   A+    +
Sbjct: 753 KQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFE--DEKSADDLDDE 810

Query: 777 SDSDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDG 836
             +   +E    + ++      +   DNIS+ STSTSSYDDAIFNSQFKK+P LY+D++ 
Sbjct: 811 KIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDEN 870

Query: 837 N-LGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICR 895
           N  G  +   KTWV +I V DTGPGID +LQESVF+PFVQGDQTLSRQYGGTGLGLSICR
Sbjct: 871 NDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICR 930

Query: 896 QLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFN 955
           QLA MM+GTM L+S VG GS F FTVPL QTR I  D+ EHP+EDEFNP+S+ NRKVKF 
Sbjct: 931 QLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFK 990

Query: 956 VA 957
           +A
Sbjct: 991 LA 992

 Score =  521 bits (1343), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/383 (65%), Positives = 304/383 (79%)

Query: 24  KPPYRISIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83
           KPP+RI IR Q                  TTGVYFT++YKNLR++RLYIAAQLKSSQIDQ
Sbjct: 10  KPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQ 69

Query: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143
           TL YLYYQ Y++S+RDTLQ +L N+VAGNKS+ NW  + S+L+KFLSSS+ FS  KVYD 
Sbjct: 70  TLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDA 129

Query: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203
           +F TVL+VTNNGTG+QI   +L KL PLSTNIPLSSSLETTGILTDPVLN ++YLMSMSL
Sbjct: 130 SFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSL 189

Query: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263
           P+FANPS+IL+ SRVYGY+T++M+A+GL +VFNDTTA+EKSNVAIVSAVYNN S L AY 
Sbjct: 190 PIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYR 249

Query: 264 LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323
               P G  + + +  ++L N SFL+ AL++GKGGS+K T F Y+K VA+GYSPC+F   
Sbjct: 250 FVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFV 309

Query: 324 NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383
           NWV+VVSQAESVF  PSTKL KIIAG VV I VFV ++T PLA++AVKPIVRL+KATE+I
Sbjct: 310 NWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELI 369

Query: 384 TEGRGLRPTTPGSGSVSRTSSMR 406
           +EGRGL+ T P S SVSR +S++
Sbjct: 370 SEGRGLKSTNPDSRSVSRNNSLK 392

 Score =  248 bits (632), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/159 (71%), Positives = 135/159 (84%), Gaps = 6/159 (3%)

Query: 1014 LNLDRPFLQSTGTAISSANVPTVATLGK------TLNVLVAEDNHVNQEVIKRMLSLEGV 1067
            ++LDRPFLQSTGTA SS NVP ++   K       + +LVAEDNHVNQEVIKRML+LEGV
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 1068 KNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVAL 1127
              IDLACDGQ+AFD VK+L E+ + Y++IFMDVQMPKVDGL +TKMIR DL Y+HPIVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1128 TAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCP 1166
            TAFADDSNIKECL++GM+GFLSKPIKRP+L+TI+ EYCP
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCP 1252

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 95/181 (52%), Gaps = 15/181 (8%)

Query: 984  SRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTL 1043
            +R+ T + HS+ +T+N    ASP   + S ++L  P L    +   +A   TV TL K  
Sbjct: 328  NRMSTAAIHSNNNTNN----ASP---AASTVSLQLPNLPDENSLTPNAQGTTV-TLRKGF 379

Query: 1044 NVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMP 1103
            +VL+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     YD++ MD+ MP
Sbjct: 380  HVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVMP 433

Query: 1104 KVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLE 1163
             +DG +AT ++R     E PI+A+T    + ++   L  GM+  L+KP  R  L +IL+ 
Sbjct: 434  NLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIR 492

Query: 1164 Y 1164
            Y
Sbjct: 493  Y 493

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 86/167 (51%), Gaps = 11/167 (6%)

Query: 998  SNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEV 1057
            SN   +ASP   + S ++L  P L    +   +A   TV TL K  +VL+ ED+ V+ ++
Sbjct: 338  SNHTNNASP---ATSTVSLQLPSLPDENSLTPNAQANTV-TLRKGFHVLLVEDDVVSIQL 393

Query: 1058 IKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRND 1117
              + L   G   + +  DG  A   ++  +     YD++ MD+ MP +DG +AT ++R  
Sbjct: 394  CSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVR-S 446

Query: 1118 LKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
               E PI+A+T    + ++   L  GM+  L+KP  R  L +IL+ Y
Sbjct: 447  FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 88/170 (51%), Gaps = 11/170 (6%)

Query: 995  VSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVN 1054
            + ++N   +ASP   + S ++L  P L    +   +A   TV TL K  +VL+ ED+ V+
Sbjct: 333  IQSNNNTNNASP---ATSTVSLQLPNLPDQNSLTPNAQNNTV-TLRKGFHVLLVEDDAVS 388

Query: 1055 QEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMI 1114
             ++  + L   G   + +  DG  A   ++  +     YD++ MD+ MP +DG +AT ++
Sbjct: 389  IQLCSKFLRKYGCT-VQVVSDGLSAISTLEKYR-----YDLVLMDIVMPNLDGATATSIV 442

Query: 1115 RNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            R     E PI+A+T    + ++   L  GM+  L+KP  R  L +IL+ Y
Sbjct: 443  R-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 80/146 (54%), Gaps = 10/146 (6%)

Query: 1019 PFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQD 1078
            P  Q+T +    AN PT  +L    +VL+ ED+ V  ++  + L   G  ++++  DG  
Sbjct: 297  PLAQATPSK-EEANPPT--SLRPGFHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLS 352

Query: 1079 AFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKE 1138
            A + V+  +     YD++ MD+ MP +DG +AT +IR+    + PI+A+T   +D ++  
Sbjct: 353  AIETVEKFQ-----YDLVLMDIVMPNLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVT 406

Query: 1139 CLDAGMDGFLSKPIKRPQLKTILLEY 1164
             L  GM+  L+KP  +  L ++L+ Y
Sbjct: 407  YLQHGMNDILAKPFTKDDLHSMLVRY 432

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            L K  +VL+ ED+ V+ ++  + L   G   + +  DG  A  N++  +     YD++ M
Sbjct: 401  LRKGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKFR-----YDLVLM 454

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158
            D+ MP +DG +AT ++R+    + PI+A+T   +D ++   L  GM+  L+KP  R  L 
Sbjct: 455  DIVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLH 513

Query: 1159 TILLEY 1164
            +IL+ +
Sbjct: 514  SILIRH 519

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 86/171 (50%), Gaps = 20/171 (11%)

Query: 1010 SGSNLNLDRPFLQSTGTAISS------------ANVPTVAT-LGKTLNVLVAEDNHVNQE 1056
            +G  L L    + +TG ++SS            +  PT    L K  +VL+ ED+ V+ +
Sbjct: 378  AGGILPLQEENINTTGHSVSSISKSDVDIKQENSQSPTATEELRKGYHVLLVEDDAVSIQ 437

Query: 1057 VIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRN 1116
            +  + L   G   +++  DG  A   +++ +     YD++ MD+ MP +DG +AT +IRN
Sbjct: 438  LCSKFLRKSGC-TVEVVTDGLAAISILEAFR-----YDLVLMDIVMPNLDGATATSIIRN 491

Query: 1117 DLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCPK 1167
                E PI+A+T   +D ++   L  GM   L+KP  R  L ++L+ +  K
Sbjct: 492  -FDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLIRHLSK 541

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 86/167 (51%), Gaps = 11/167 (6%)

Query: 998  SNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEV 1057
            +N   +ASP   + S ++L  P L    +   +A    V TL K  +VL+ ED+ V+ ++
Sbjct: 337  NNNGNNASP---TTSTVSLQMPNLPDENSLTPNAQGNAV-TLRKGFHVLLVEDDAVSIQL 392

Query: 1058 IKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRND 1117
              + L   G   + +  DG  A   ++  +     YD++ MD+ MP +DG +AT ++R+ 
Sbjct: 393  CSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRS- 445

Query: 1118 LKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
               E PI+A+T    + ++   L  GM+  L+KP  R  L +IL+ Y
Sbjct: 446  FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 82/158 (51%), Gaps = 10/158 (6%)

Query: 1029 SSANV-PTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLK 1087
            SS NV P V  L K  +VL+ ED+ V  ++  + L   G   + +  DG  A   +++ +
Sbjct: 403  SSNNVGPYV--LRKGFHVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLENHR 459

Query: 1088 ERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGF 1147
                 +D++ MD+ MP +DG +AT ++RN   Y  PI+A+T   +D ++   L  GM+  
Sbjct: 460  -----FDLVLMDIVMPNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDI 513

Query: 1148 LSKPIKRPQLKTILLEYCPKVDSMGRATSTGEESKHTK 1185
            L+KP  +  L ++L+ Y      +  A  TG ES   K
Sbjct: 514  LAKPFTKRDLHSMLVRYLRDKVPLCEAGGTGNESNGAK 551

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            L K  +VL+ ED+ ++ ++  + L   G   +++  DG  A   ++  +     YD++ M
Sbjct: 349  LRKGFHVLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLM 402

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158
            D+ MP +DG +AT +IR+    + PI+A+T   +D ++   L  GM+  L+KP  R  L 
Sbjct: 403  DIVMPNLDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLH 461

Query: 1159 TILLEY 1164
            ++L+ Y
Sbjct: 462  SMLIRY 467

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 69/128 (53%), Gaps = 7/128 (5%)

Query: 1037 ATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMI 1096
            A L    +VL+ ED+ V+  +  + L   G   +++  DG  A   ++  +     YD++
Sbjct: 375  AVLRPGFHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLV 428

Query: 1097 FMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQ 1156
             MD+ MP +DG +AT +IRN    + PI+A+T   +D ++   L  GM+  L+KP  +  
Sbjct: 429  LMDIVMPNLDGATATSIIRN-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDD 487

Query: 1157 LKTILLEY 1164
            L ++L+ Y
Sbjct: 488  LHSMLIRY 495

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            L K  +VL+ ED+ ++ ++  + L   G   + +  DG  A   +++ +     YD++ M
Sbjct: 399  LRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLENSR-----YDLVLM 452

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158
            D+ MP +DG +AT +IR+    + PI+A+T   DD ++   L  GM+  L+KP  R  L 
Sbjct: 453  DIVMPNLDGATATSIIRS-FDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLH 511

Query: 1159 TILLEY 1164
            ++L+ Y
Sbjct: 512  SMLIRY 517

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1045 VLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPK 1104
            VL+ ED+ V  ++  + L   G  ++++  DG  A + V+  +     YD++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPN 384

Query: 1105 VDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            +DG +AT +IR+    + PI+A+T   +D ++   L  GM+  L+KP  +  L ++L+ Y
Sbjct: 385  LDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            L K  NVL+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     +D++ M
Sbjct: 346  LKKGFNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKYR-----FDLVLM 399

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158
            D+ MP +DG +AT +IRN    E PI+A+T   +  ++   L  GM+  L+KP  R  L 
Sbjct: 400  DIVMPNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLY 458

Query: 1159 TILLEY 1164
            ++L  Y
Sbjct: 459  SMLTRY 464

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 72/133 (54%), Gaps = 7/133 (5%)

Query: 1032 NVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGE 1091
            NV     L    +VL+ ED+ V  ++  + L   G  ++++  DG  A   ++  +    
Sbjct: 296  NVDDSPILRPGFHVLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKFR---- 350

Query: 1092 FYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKP 1151
             YD++ MD+ MP +DG +AT ++R+    + PI+A+T   +D ++   L+ GM+  L+KP
Sbjct: 351  -YDLVLMDIVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKP 408

Query: 1152 IKRPQLKTILLEY 1164
              +  L ++L+ Y
Sbjct: 409  FTKDDLHSMLIRY 421

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            L K  +VL+ ED+ V+ ++  + L   G   + +  DG  A     S+ E+  F D++ M
Sbjct: 378  LKKGFHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAI----SILEKFRF-DLVLM 431

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158
            D+ MP +DG +AT +IRN      PI+A+T   +  ++   L  GM+  L+KP  R  L 
Sbjct: 432  DIVMPNLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLY 490

Query: 1159 TILLEY 1164
            +IL+ Y
Sbjct: 491  SILIRY 496

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 79/158 (50%), Gaps = 25/158 (15%)

Query: 1007 QPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEG 1066
            QP + SN+ LD P L+                     +VL+ ED+ +  ++  + L ++ 
Sbjct: 284  QPPAPSNMILDHPILRPG------------------FHVLLVEDDSICIQLCSKFL-MKY 324

Query: 1067 VKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVA 1126
               +++  DG  A   ++  +     +D++ MD+ MP +DG +AT ++R+    + PI+A
Sbjct: 325  ACTVEVVTDGLSAISTLEKFR-----FDLVLMDIVMPNLDGATATSIVRS-FDNQTPIIA 378

Query: 1127 LTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            +T   +D ++   L  GM+  L+KP  +  L ++L+ Y
Sbjct: 379  MTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 416

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 69/128 (53%), Gaps = 7/128 (5%)

Query: 1037 ATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMI 1096
            + L +  +VL+ ED+ V  ++  + L   G   +++  DG  A   ++  +     YD++
Sbjct: 328  SVLKEGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLV 381

Query: 1097 FMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQ 1156
             MD+ MP +DG +AT ++R+      PI+A+T   +D ++   L  GM+  L+KP  +  
Sbjct: 382  LMDIVMPNLDGATATSIVRS-FDNHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDD 440

Query: 1157 LKTILLEY 1164
            L ++L+ Y
Sbjct: 441  LHSMLIRY 448

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 70/122 (57%), Gaps = 7/122 (5%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
             +VL+ ED+ V  ++  + L   G  ++++  DG  A   ++  K+R   +D++ MD+ M
Sbjct: 329  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTLE--KQR---FDLVLMDIVM 382

Query: 1103 PKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILL 1162
            P +DG +AT ++R+    E PI+A+T   DD ++   L  GM+  L+KP  +  L ++L+
Sbjct: 383  PNLDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1163 EY 1164
             Y
Sbjct: 442  RY 443

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 84/164 (51%), Gaps = 9/164 (5%)

Query: 1003 SASPQPESG-SNLNLDRPFLQSTGTAISSAN-VPTVATLGKTLNVLVAEDNHVNQEVIKR 1060
            + SPQ  S    L++ +P    +  A ++ N +     L    +VL+ ED+ +  ++  +
Sbjct: 263  TQSPQMSSAVPTLSVRKPSTMDSNPASTTPNMILDHPILRPGFHVLLVEDDSICIQLCSK 322

Query: 1061 MLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKY 1120
             L   G   +++  DG  A   ++  +     YD++ MD+ MP +DG +AT ++R+    
Sbjct: 323  FLMKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRS-FDN 375

Query: 1121 EHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            + PI+A+T   +D ++   L  GM+  L+KP  +  L ++L+ Y
Sbjct: 376  QTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            L +  +VL+ ED+ V  ++  + L   G   +++  DG  A   ++  +     YD++ M
Sbjct: 372  LREGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKFR-----YDLVLM 425

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158
            D+ MP +DG +AT ++R+      PI+A+T   +D ++   L  GM+  L+KP  +  L 
Sbjct: 426  DIVMPNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLH 484

Query: 1159 TILLEY 1164
            ++L+ Y
Sbjct: 485  SMLIRY 490

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 75/150 (50%), Gaps = 34/150 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + + ++A +G +A +     K R     +I MD+Q+
Sbjct: 549  INVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVE-----KWRQGGIHLILMDLQL 602

Query: 1103 PKVDGLSATKMIRN-----------------------DL---KYEHP--IVALTAFADDS 1134
            P + GL ATK IR+                       DL   K+  P  IVALTAF+  +
Sbjct: 603  PLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHA 662

Query: 1135 NIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            + +E L AG + +L+KP+    L + + E+
Sbjct: 663  DRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 92/192 (47%), Gaps = 13/192 (6%)

Query: 979  TVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVAT 1038
            ++ E+S+ +     +  S  ++N S  P       +   RP   ST     ++   T   
Sbjct: 411  SIFEQSKQDNGDGRTSHSPPDENTSRRPVSPLNEAIEHTRPLRISTSGFTLTSATTTTEK 470

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            +   +NVL+ EDN +NQ ++   L    + +  +A +G++A   V+  K  G    +IFM
Sbjct: 471  VFPKINVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEA---VEMWKNGG--LHLIFM 524

Query: 1099 DVQMPKVDGLSATKMIRNDLKYEHP------IVALTAFADDSNIKECLDAGMDGFLSKPI 1152
            D+Q+P + G+ A K IR D + E P      IVALTA     + +  L +G + +L+KP+
Sbjct: 525  DLQLPVLSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPV 583

Query: 1153 KRPQLKTILLEY 1164
                L   + E+
Sbjct: 584  NLHWLSKKITEW 595

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 77/165 (46%), Gaps = 37/165 (22%)

Query: 1031 ANVPTVATLGKT---LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLK 1087
            A+VP+  T  +    +NVL+ EDN +NQ ++   L    + + ++A +G +A +     K
Sbjct: 494  ASVPSNQTRDRVFPKINVLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVE-----K 547

Query: 1088 ERGEFYDMIFMDVQMPKVDGLSATKMIRN--------------------------DLKYE 1121
             R     +I MD+Q+P + G+ A K IRN                            K+ 
Sbjct: 548  WRKGGIHLILMDLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFR 607

Query: 1122 HP--IVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             P  IVALTAF+  ++  E L AG + +L+KP+    L   + E+
Sbjct: 608  APVIIVALTAFSSHADRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 72/140 (51%), Gaps = 13/140 (9%)

Query: 1032 NVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGE 1091
            N  T A +   +NVL+ EDN +NQ ++   L    + +  +A +G++A D     KE G 
Sbjct: 506  NTSTSANVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVD---IWKEGG- 560

Query: 1092 FYDMIFMDVQMPKVDGLSATKMIRNDLKYEHP-------IVALTAFADDSNIKECLDAGM 1144
               +IFMD+Q+P + G+ A K IR+  K           IVALTA     + ++ L +G 
Sbjct: 561  -LHLIFMDLQLPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGC 619

Query: 1145 DGFLSKPIKRPQLKTILLEY 1164
            + +L+KP+    L   + E+
Sbjct: 620  NDYLTKPVNLHWLSKKITEW 639

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 70/149 (46%), Gaps = 34/149 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    +    +A +GQ+A D     +E G    +IFMD+Q+
Sbjct: 565  INVLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAID---VWREGG--IHLIFMDLQL 618

Query: 1103 PKVDGLSATKMIRNDLKYEHPI---------------------------VALTAFADDSN 1135
            P + G+ A K IR +L+ EH I                           VA TA    S+
Sbjct: 619  PVLSGIDAAKKIR-ELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSD 677

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             KE L +G + +L+KP+    L   + E+
Sbjct: 678  KKEALISGCNDYLTKPVNLHWLSNKINEW 706

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 28/131 (21%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            + VL+ EDN +NQ +++  L    + +  +A +GQ+A D     KE G   D+IFMD+Q+
Sbjct: 501  ITVLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDR---WKEGG--IDLIFMDLQL 554

Query: 1103 PKVDGLSATKMIRNDL-------------------KYEHP--IVALTAFADDSNIKECLD 1141
            P   G+ A K IR DL                   + + P  IVA TA    ++ +E L 
Sbjct: 555  PVFSGMDAAKKIR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALL 613

Query: 1142 AGMDGFLSKPI 1152
            +G + +L+KP+
Sbjct: 614  SGCNDYLTKPV 624

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 70/149 (46%), Gaps = 33/149 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  LA +GQ+A   V   KE G    +IFMD+Q+
Sbjct: 486  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA---VNIWKEGG--LHLIFMDLQL 539

Query: 1103 PKVDGLSATKMIRN-----------DLKYEHP----------------IVALTAFADDSN 1135
            P + G+ A K IR+            L   +P                IVALTA     +
Sbjct: 540  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMD 599

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             ++ L +G + +L+KP+    L   + E+
Sbjct: 600  KRKALVSGCNDYLTKPVNLHWLSKKITEW 628

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 69/149 (46%), Gaps = 33/149 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  LA +GQ+A   V   KE G    +IFMD+Q+
Sbjct: 504  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA---VNIWKEGG--LHLIFMDLQL 557

Query: 1103 PKVDGLSATKMIRN-----------DLKYEHP----------------IVALTAFADDSN 1135
            P + G+ A K IR+            L   H                 IVALTA     +
Sbjct: 558  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMD 617

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             ++ L +G + +L+KP+    L   + E+
Sbjct: 618  KRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (47%), Gaps = 26/143 (18%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  +A +G++A D     KE G    +IFMD+Q+
Sbjct: 545  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVD---IWKEGG--LHLIFMDLQL 598

Query: 1103 PKVDGLSATKMIR-------------------NDLKYEHPIVALTAFADDSNIKECLDAG 1143
            P + G+ A + IR                   N  K    IVALTA     + +  L +G
Sbjct: 599  PVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISG 658

Query: 1144 MDGFLSKPIKRPQLKTILLEY-C 1165
             + +L+KP+    L   + E+ C
Sbjct: 659  CNDYLTKPVNLHWLSKKITEWGC 681

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 71/149 (47%), Gaps = 33/149 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  LA +GQ+A   V   KE G    +IFMD+Q+
Sbjct: 503  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA---VNIWKEGG--LHLIFMDLQL 556

Query: 1103 PKVDGLSATKMIR--------------NDLKY-----------EHP--IVALTAFADDSN 1135
            P + G+ A K IR              N+  Y           + P  IVALTA     +
Sbjct: 557  PVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMD 616

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             ++ L +G + +L+KP+    L   + E+
Sbjct: 617  KRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 79/171 (46%), Gaps = 30/171 (17%)

Query: 1017 DRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDG 1076
            D PFL+S     ++ ++ T   +   ++VLV EDN +NQ ++   L    + +  +A +G
Sbjct: 394  DSPFLRSAMETFTTESI-TRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVAKNG 451

Query: 1077 QDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKY-----------EHP-- 1123
             +A D     KE G    +I MD++MP + G+ A K IR   K            EH   
Sbjct: 452  IEAVDR---WKEGG--MHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPA 506

Query: 1124 ----------IVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
                      IVALTA    S+  E L AG + +L+KP+    L   + E+
Sbjct: 507  KRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 71/152 (46%), Gaps = 36/152 (23%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  +A +G++A D  K     G  + +IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWK----EGNLH-LIFMDLQL 516

Query: 1103 PKVDGLSATKMIRNDLKYEHP----------------------------IVALTAFADDS 1134
            P + G+ A K IR +L+ E                              IVALTA     
Sbjct: 517  PVLSGIEAAKKIR-ELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQE 575

Query: 1135 NIKECLDAGMDGFLSKPIKRPQLKTILLEY-C 1165
            + +E L +G + +L+KP+    L   + E+ C
Sbjct: 576  DKREALISGCNDYLTKPVNLLWLSKKITEWGC 607

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 69/149 (46%), Gaps = 33/149 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  LA +GQ+A   V   KE G    +IFMD+Q+
Sbjct: 493  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA---VNIWKEGG--LHLIFMDLQL 546

Query: 1103 PKVDGLSATKMIRN-----------DLKYEHP----------------IVALTAFADDSN 1135
            P + G+ A K IR+            L   H                 IVALTA     +
Sbjct: 547  PVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMD 606

Query: 1136 IKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             ++ L +G + +L+KP+    L   + E+
Sbjct: 607  KRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 8/105 (7%)

Query: 1012 SNLNLDRPFLQSTGTAIS-SANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNI 1070
            S+  L RP  + T  ++    N+P      + +NVL+ EDN +NQ ++   L   G+ + 
Sbjct: 363  SSPELPRPLSRRTTPSLDKQGNLPKYKVFPR-INVLIVEDNAINQAILALFLRKNGI-SY 420

Query: 1071 DLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIR 1115
             +A DG +A +  K     G+ + +I MD+Q+P + GL ATK IR
Sbjct: 421  KVAKDGVEAIEKWK----EGDSH-LILMDLQLPLLSGLEATKKIR 460

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 78/162 (48%), Gaps = 34/162 (20%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    +    +A +G++A D     KE G    +IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVD---IWKEGG--LHLIFMDLQL 723

Query: 1103 PKVDGLSATKMIR------------NDLKY---------EHP--IVALTAFADDSNIKEC 1139
            P + G+ A + IR            N+LK          + P  IVALTA     + ++ 
Sbjct: 724  PVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKA 783

Query: 1140 LDAGMDGFLSKPIKRPQLKTILLEY-CPKV----DSMGRATS 1176
            L +G + +L+KP+    L   + E+ C +     DS  + TS
Sbjct: 784  LLSGCNDYLTKPVNLHWLSKKITEWGCMQALIDFDSWKQGTS 825

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 70/152 (46%), Gaps = 36/152 (23%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  +A +G++A D     KE G    +IFMD+Q+
Sbjct: 511  INVLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVD---KWKEGG--LHLIFMDLQL 564

Query: 1103 PKVDGLSATKMIRNDLKYE----------------------------HP--IVALTAFAD 1132
            P + G+ A K IR   K++                             P  IVA TA   
Sbjct: 565  PVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNS 624

Query: 1133 DSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
             ++ +E L +G + +L+KP+    L   + E+
Sbjct: 625  LTDKREALISGCNDYLTKPVNLHWLSKKITEW 656

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 79/168 (47%), Gaps = 29/168 (17%)

Query: 1019 PFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQD 1078
            PF+ S   ++++ ++ T   +   ++VLV EDN +NQ ++   L    + +  +A +G +
Sbjct: 383  PFILSAMESVTTESI-TRDKVFPKISVLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVE 440

Query: 1079 AFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIR-----NDLKYEHP---------- 1123
            A D     KE G    +I MD++MP + G+ A K IR     N +    P          
Sbjct: 441  AVDR---WKEGG--MHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGL 495

Query: 1124 -------IVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
                   IVALTA    ++  E L AG + +L+KP+    L   + E+
Sbjct: 496  TCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITEW 543

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 69/150 (46%), Gaps = 34/150 (22%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            + VL+ EDN +NQ ++   L    + +  +A +G++A   V+  KE G    +IFMD+Q+
Sbjct: 471  ITVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREA---VEKWKEGG--IHLIFMDLQL 524

Query: 1103 PKVDGLSATKMIRNDLKY---------------------EHPI-------VALTAFADDS 1134
            P + G+ A K IR   K                      E P+       VA TA    +
Sbjct: 525  PVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLT 584

Query: 1135 NIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
            + +E L +G + +L+KP+    L   + E+
Sbjct: 585  DKREALVSGCNDYLTKPVNLHWLSKKITEW 614

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 42/177 (23%)

Query: 1021 LQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAF 1080
            L+ST   +      T   +   +N+L+ EDN +NQ ++   L    +    +A +G++A 
Sbjct: 543  LKSTTNPVKPKMRSTSENIFPRINILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAV 601

Query: 1081 DNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHP----------------- 1123
            D     KE G    +IFMD+Q+P + G  A K IR   +YE                   
Sbjct: 602  D---KWKEGG--IHLIFMDLQLPVLSGTDAAKEIR---QYEKKIGIGIQKKQSSSSDLSL 653

Query: 1124 ----------------IVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEY 1164
                            IVA TA    ++ +  L AG + +L+KP+    L   + E+
Sbjct: 654  SESFLNTKSSACAPVIIVAFTASNSLADKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 6/74 (8%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            +NVL+ EDN +NQ ++   L    + +  +A +G++A D  K    +G  + +I +D+Q+
Sbjct: 462  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWK----QGGIH-LILLDLQL 515

Query: 1103 PKVDGLSATKMIRN 1116
            P + G+ ATK IRN
Sbjct: 516  PILSGIEATKEIRN 529

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 65/131 (49%), Gaps = 11/131 (8%)

Query: 1036 VATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDM 1095
            ++ +   ++VLV E   +++  + R L   G   + ++   +        +K     +D+
Sbjct: 1382 ISDIAYNMDVLVCEPIPIHRFKLTRDLESLGCSVVSVSMGDEMVRRATSDVK-----FDL 1436

Query: 1096 IFMDVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIK 1153
            IF  +++PK+  +   K++R  N +     I+A+TA+  ++  + C     D  L +P+ 
Sbjct: 1437 IFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLERPVS 1492

Query: 1154 RPQLKTILLEY 1164
              QL+++LL+Y
Sbjct: 1493 VQQLRSLLLKY 1503

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 1036 VATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDM 1095
            V  +G  ++VL+ E        I R   ++ ++++  +  G  A D +      G  +D+
Sbjct: 1433 VGEVGCNMDVLLCE-----PIPIHRYRLVKDLESLGCSVVGVGAGDELVRRATAGVKFDL 1487

Query: 1096 IFMDVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIK 1153
            I   +++PK+  +   K++R  N      PIVA+TA+  ++   +      D  L KP+ 
Sbjct: 1488 IITALKLPKLGAVDIAKLLRHTNSANCNTPIVAVTAYYGEAESTQVF----DDVLEKPVG 1543

Query: 1154 RPQLKTILLEYC 1165
              Q++ ++ +Y 
Sbjct: 1544 IEQIRCLIAKYA 1555

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 1036 VATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDM 1095
            V  +G  +++LV E   +++  + R L   G   + +      A D + S    G  +D+
Sbjct: 1535 VNDVGYRMDILVCEPIPIHRYRVTRDLESVGCTVVSVG-----AGDELVSRANSGVKFDL 1589

Query: 1096 IFMDVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGM-DGFLSKPI 1152
            I   +++PK+  +   K+I+  N +    PI+A+T F       E + A + D  L KPI
Sbjct: 1590 IVTALKLPKLGAIDIVKLIKHTNGINSRTPIIAITNF-----YHEAISAKVFDDVLEKPI 1644

Query: 1153 KRPQLKTILLEYCPK 1167
               +++ ++ +Y  K
Sbjct: 1645 MLDEIRHLVAKYALK 1659

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1090 GEFYDMIFMDVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGMDGF 1147
            G  +D+I   +++PK+  +   K+IR  N +    PIVALT +  D+   +      D  
Sbjct: 1481 GVKFDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVYYHDAKESKVF----DDV 1536

Query: 1148 LSKPIKRPQLKTILLEYC 1165
            L KP+   QL+ ++ +Y 
Sbjct: 1537 LEKPVSVEQLRKLVSKYA 1554

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 17/80 (21%)

Query: 852 IEVIDTGPGIDSSLQESVFE----------------PFVQGDQTLSRQYGGTGLGLSICR 895
           I + D G GID  +++ VF+                 +V   Q + +   G G GL +C+
Sbjct: 327 IRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEV-QNVAGMGFGLPMCK 385

Query: 896 QLATMMNGTMTLESTVGSGS 915
               + NGT+ ++S  G G+
Sbjct: 386 AYLELFNGTLDIQSLWGWGT 405

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 61/131 (46%), Gaps = 11/131 (8%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            +G  ++VLV E   +++  + + L   G   + +      A D + S    G  +D+I  
Sbjct: 1631 IGYHMDVLVCEPIPIHRYRVTKDLENLGCTVVSVG-----AGDELVSRATSGVSFDLIMT 1685

Query: 1099 DVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQ 1156
             +++PK+  +   ++++  N      PIVA+T +  ++      D      L KP+K  +
Sbjct: 1686 ALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVFD----DVLEKPVKLDE 1741

Query: 1157 LKTILLEYCPK 1167
            LK ++ +Y  K
Sbjct: 1742 LKKLVAKYALK 1752

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 61/134 (45%), Gaps = 16/134 (11%)

Query: 1036 VATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDM 1095
            ++ +G  ++VL+ E   +++  + R L L G   + +        D +      G  +D+
Sbjct: 1555 ISDVGYNMDVLLCEPIPIHRYRLARDLELLGCSVVAVGTG-----DEIVRRATSGVRFDL 1609

Query: 1096 IFMDVQMPKVDGLSATKMIRN--DLKYEHPIVALTAFADD--SNIKECLDAGMDGFLSKP 1151
            I   +++PK+  +   +++R+   +    PIVA+     D  SNI        D  L +P
Sbjct: 1610 IITTLKLPKIGAIDIARLLRHTTSINCNTPIVAVAVNYHDVGSNI-------FDDVLERP 1662

Query: 1152 IKRPQLKTILLEYC 1165
            I   QL+ ++ +Y 
Sbjct: 1663 IGVEQLRKMVSKYA 1676

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 23/104 (22%)

Query: 827 TPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGID-------------SSLQESVFEPF 873
            P + +   GN GE LS        I V D G GI              S + +   +P 
Sbjct: 286 VPIMVQITKGNCGETLS--------IRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPA 337

Query: 874 VQGDQTLSR--QYGGTGLGLSICRQLATMMNGTMTLESTVGSGS 915
            Q +Q  +   +  G G GL +CR  A +  G+++++S  G G+
Sbjct: 338 TQVNQVNADVPRVAGLGFGLPLCRMYAELFGGSLSIQSLWGLGT 381

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            +G  ++VLV E   +++  + + L   G   + +      A D + S    G  +D+I  
Sbjct: 1621 IGYHMDVLVCEPIPIHRYRVTKDLENLGCTVVSVG-----AGDELVSRATSGVSFDLIMT 1675

Query: 1099 DVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGM-DGFLSKPIKRP 1155
             +++PK+  +   ++++  N      PIVA+T +      +E + + + D  L KP+   
Sbjct: 1676 ALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLD 1730

Query: 1156 QLKTILLEYCPK 1167
            +LK ++ +Y  K
Sbjct: 1731 ELKKLVAKYALK 1742

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            +G  ++VLV E   +++  + + L   G   + +      A D + S    G  +D+I  
Sbjct: 1614 IGYHMDVLVCEPIPIHRYRVAKDLENLGCTVVSVG-----AGDELVSRATSGVSFDLIMT 1668

Query: 1099 DVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDA-GMDGFLSKPIKRP 1155
             +++PK+  +   ++++  N +    PIV++T +      +E + +   D  L KP+   
Sbjct: 1669 ALKLPKLGAIDIVQLLKQTNGVNSTTPIVSITNY-----FQEAIASKAFDDVLEKPVNLD 1723

Query: 1156 QLKTILLEYCPK 1167
            +LK ++ +Y  K
Sbjct: 1724 ELKRLVAKYALK 1735

>Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {ON}
            YFL033C (RIM15) - Trehalose-associated protein kinase
            related to S. pombe cek1+ [contig 244] FULL
          Length = 1521

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 1093 YDMIFMDVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGM-DGFLS 1149
            +D+IF  +++PK+  +   K++R  N +     I+A+TA+      +E   AG+ +  L 
Sbjct: 1431 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAY-----YQEAQQAGVFEDVLE 1485

Query: 1150 KPIKRPQLKTILLEY 1164
            +P    QL+++LL++
Sbjct: 1486 RPATVQQLRSLLLKH 1500

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 62/132 (46%), Gaps = 13/132 (9%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            +G  ++ LV E   +++  + + L   G   + +      A D + S    G  +D+I  
Sbjct: 1619 IGYHMDALVCEPIPIHRYRVAKDLENLGCTVVSVG-----AGDELVSRATSGVSFDLIMT 1673

Query: 1099 DVQMPKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGM-DGFLSKPIKRP 1155
             +++PK+  +   +++R  N      PIVA+T +      +E + + + D  L KP+   
Sbjct: 1674 ALKLPKLGAIDIVQLLRQTNGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLD 1728

Query: 1156 QLKTILLEYCPK 1167
            +LK ++ +Y  K
Sbjct: 1729 ELKKLVAKYALK 1740

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query: 1043 LNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQM 1102
            ++VLV E   +++  + + L   G   I +      A D + S    G  +D+I   +++
Sbjct: 1468 MDVLVCEPIPIHRYRVTKDLESLGCTVISVG-----AGDELVSRATSGVKFDLIITALKL 1522

Query: 1103 PKVDGLSATKMIR--NDLKYEHPIVALTAFADDSNIKECLDAGM-DGFLSKPIKRPQLKT 1159
            PK+  +   ++++  N +    P+VA+T +      +E +   + D  L KP+   QL+ 
Sbjct: 1523 PKLGAVDIVRLLKHTNSINATTPVVAVTNY-----YQEAVSGNVFDDVLEKPVAYDQLRK 1577

Query: 1160 ILLEY 1164
            I  +Y
Sbjct: 1578 IAAKY 1582

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 1039 LGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098
            +G  ++VL+ E   +++  + R L   G   + +        D +      G  +D+I  
Sbjct: 1434 VGYNMDVLLCEPIPIHRYRLTRDLESLGCSVVAVGTG-----DEIVRRATSGVRFDLIIT 1488

Query: 1099 DVQMPKVDGLSATKMIRN--DLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQ 1156
             +++PK+  +  T+++R    +    PIVA+T    D+          D  L +PI   Q
Sbjct: 1489 TLKLPKIGAVDITRLLRQTTSINCTTPIVAVTVNYHDAGTHI-----FDDVLERPIGTEQ 1543

Query: 1157 LKTILLEY 1164
            L+ ++ +Y
Sbjct: 1544 LRKLVSKY 1551

>TBLA0C04870 Chr3 (1182058..1187010) [4953 bp, 1650 aa] {ON} Anc_3.515
            YGL206C
          Length = 1650

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 18/135 (13%)

Query: 1016 LDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACD 1075
            LD P  ++    +SS N+P +      +NVL    + VNQ     ++  E  K++ +A D
Sbjct: 1437 LDIP--RTINIFLSSDNLPLIKPF--LINVLPKNISVVNQAYHDLLIEEEDYKSLQVAVD 1492

Query: 1076 GQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGL---------SATKMIRNDLKYEHPIVA 1126
              D FD +  L  R E +D++F      ++  L          A  +++ D  ++  I  
Sbjct: 1493 SYDKFDQI-GLATRLESHDLLF----FRRIAALLFRRNKKWAKALSILKQDKLWKEAIET 1547

Query: 1127 LTAFADDSNIKECLD 1141
             +   DD  +KE L+
Sbjct: 1548 ASISQDDKVVKELLE 1562

>KLTH0G01892g Chr7 complement(142143..147116) [4974 bp, 1657 aa] {ON}
            highly similar to uniprot|P22137 Saccharomyces cerevisiae
            YGL206C CHC1 vesicle coat protein presumed vesicle coat
            protein
          Length = 1657

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 1030 SANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKER 1089
            S N+P +      +NVL   ++ VNQ     M+  E  K + +A D  D FD +  L  R
Sbjct: 1446 SDNLPLIKPF--LVNVLPKNNSVVNQAYHDLMIEEEDYKALQVAVDSYDKFDQL-DLAAR 1502

Query: 1090 GEFYDMIFM 1098
             E +D+IF 
Sbjct: 1503 LEKHDLIFF 1511

>KNAG0C04580 Chr3 (900175..901701) [1527 bp, 508 aa] {ON} Anc_5.487
           YOR149C
          Length = 508

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 194 GTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAI----V 249
           G  Y + + +    +P++I+  +R+Y YI+ I+ +   +++ N+   ++KS + I    V
Sbjct: 69  GPLYFVLLKIVRIRDPAVIIFVTRLYNYISYILVSSWAITLINNHGEVQKSLLLIATSYV 128

Query: 250 SAVYNNQS 257
           ++V+ + S
Sbjct: 129 TSVFQSHS 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 110,463,309
Number of extensions: 4577196
Number of successful extensions: 16928
Number of sequences better than 10.0: 148
Number of HSP's gapped: 17354
Number of HSP's successfully gapped: 174
Length of query: 1187
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1066
Effective length of database: 39,606,813
Effective search space: 42220862658
Effective search space used: 42220862658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)