Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D022205.702ON1674167481610.0
TDEL0B021905.702ON1810169712521e-143
ZYRO0G06600g5.702ON1820161111201e-125
SAKL0E14916g5.702ON1779161710531e-117
Smik_11.3585.702ON1878159410411e-115
NCAS0A032005.702ON1788154110171e-112
Suva_11.3315.702ON189816259981e-109
CAGL0G02497g5.702ON178016539941e-109
Skud_11.3345.702ON188516779831e-108
YKR095W (MLP1)5.702ON187516139117e-99
AFR286W5.702ON175815438465e-91
NDAI0E050405.702ON197313168153e-87
NCAS0G002305.702ON173515317983e-85
KLTH0E01056g5.702ON177115477876e-84
Kwal_55.196975.702ON176013937644e-81
TBLA0E017305.702ON182014037135e-75
KNAG0L021405.702ON16087886769e-71
Smik_9.205.702ON168216045151e-51
KNAG0C065905.702ON165113804667e-46
Ecym_40185.702ON17696664632e-45
Kpol_1043.705.702ON13216244336e-42
NDAI0F002905.702ON15544924292e-41
YIL149C (MLP2)5.702ON16795203916e-37
KLLA0A00594g5.702ON17484623834e-36
Suva_9.395.702ON16824423764e-35
Skud_9.195.702ON16806853649e-34
KAFR0H002105.702ON14545532636e-22
TPHA0D046105.702ON11831972143e-16
TPHA0E002305.702ON12845321803e-12
Kpol_2001.755.702ON10064291123e-04
YBR128C (ATG14)3.389ON34493870.15
NCAS0B004408.718ON84193811.1
Kwal_23.50608.71ON83593801.6
TDEL0F015904.38ON51244791.7
TDEL0A064908.704ON721122782.6
KLLA0C17204g4.46ON768160773.6
NCAS0E003803.546ON624132764.8
Skud_16.246.291ON419106755.4
NDAI0D018305.267ON1890141756.2
KAFR0G019208.636ON47398746.9
NCAS0C018008.601ON375108747.0
Smik_11.1652.618ON88149747.2
TBLA0A104705.267ON1999148747.8
Skud_12.3954.41ON403240738.0
CAGL0E03564g4.38ON545112738.4
NCAS0E011803.425ON947184739.4
KAFR0E017505.267ON1891617310.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02220
         (1674 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...  3148   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   486   e-143
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   436   e-125
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   410   e-117
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   405   e-115
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   396   e-112
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   389   e-109
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   387   e-109
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   383   e-108
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   355   7e-99
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   330   5e-91
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   318   3e-87
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   311   3e-85
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   307   6e-84
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   298   4e-81
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   279   5e-75
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   265   9e-71
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   202   1e-51
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   184   7e-46
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   182   2e-45
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   171   6e-42
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   169   2e-41
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   155   6e-37
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   152   4e-36
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   149   4e-35
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   144   9e-34
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   105   6e-22
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    87   3e-16
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    74   3e-12
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    48   3e-04
YBR128C Chr2 complement(493081..494115) [1035 bp, 344 aa] {ON}  ...    38   0.15 
NCAS0B00440 Chr2 complement(59467..61992) [2526 bp, 841 aa] {ON}...    36   1.1  
Kwal_23.5060 s23 (991233..993740) [2508 bp, 835 aa] {ON} YFL004W...    35   1.6  
TDEL0F01590 Chr6 complement(291940..293478) [1539 bp, 512 aa] {O...    35   1.7  
TDEL0A06490 Chr1 complement(1135618..1137783) [2166 bp, 721 aa] ...    35   2.6  
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    34   3.6  
NCAS0E00380 Chr5 (63083..64957) [1875 bp, 624 aa] {ON} Anc_3.546...    34   4.8  
Skud_16.24 Chr16 (41954..43213) [1260 bp, 419 aa] {ON} YPL255W (...    33   5.4  
NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {...    33   6.2  
KAFR0G01920 Chr7 (408397..409818) [1422 bp, 473 aa] {ON} Anc_8.6...    33   6.9  
NCAS0C01800 Chr3 complement(333093..334220) [1128 bp, 375 aa] {O...    33   7.0  
Smik_11.165 Chr11 (282628..285273) [2646 bp, 881 aa] {ON} YKL073...    33   7.2  
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    33   7.8  
Skud_12.395 Chr12 complement(698568..699779) [1212 bp, 403 aa] {...    33   8.0  
CAGL0E03564g Chr5 complement(329297..330934) [1638 bp, 545 aa] {...    33   8.4  
NCAS0E01180 Chr5 complement(225933..228776) [2844 bp, 947 aa] {O...    33   9.4  
KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5....    33   10.0 

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score = 3148 bits (8161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1594/1674 (95%), Positives = 1594/1674 (95%)

Query: 1    MADTDSTELAKFLGISDIELSNINTELRSKLESSVDNLIKEKLNLKSTIEETESTYKNKI 60
            MADTDSTELAKFLGISDIELSNINTELRSKLESSVDNLIKEKLNLKSTIEETESTYKNKI
Sbjct: 1    MADTDSTELAKFLGISDIELSNINTELRSKLESSVDNLIKEKLNLKSTIEETESTYKNKI 60

Query: 61   KNLEDEINILAKTRDISGPIRITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLIS 120
            KNLEDEINILAKTRDISGPIRITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLIS
Sbjct: 61   KNLEDEINILAKTRDISGPIRITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLIS 120

Query: 121  QSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILKMEEKDQEIDNLRHEVSIXX 180
            QSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILKMEEKDQEIDNLRHEVSI  
Sbjct: 121  QSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILKMEEKDQEIDNLRHEVSILK 180

Query: 181  XXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQ 240
                      QELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQ
Sbjct: 181  KNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQ 240

Query: 241  QEKSIQNEDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYXXXXX 300
            QEKSIQNEDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEY     
Sbjct: 241  QEKSIQNEDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYSSSSS 300

Query: 301  XXXXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISI 360
                       QKDYLETQVENFITELEIKVPVI                VTSLVDRISI
Sbjct: 301  LLKKELLKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISI 360

Query: 361  ERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETD 420
            ERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETD
Sbjct: 361  ERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETD 420

Query: 421  FIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQ 480
            FIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQ
Sbjct: 421  FIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQ 480

Query: 481  ADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECN 540
            ADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVY               ECN
Sbjct: 481  ADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECN 540

Query: 541  DIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA 600
            DIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA
Sbjct: 541  DIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA 600

Query: 601  ELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQ 660
            ELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQ
Sbjct: 601  ELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQ 660

Query: 661  SQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQ 720
            SQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQ
Sbjct: 661  SQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQ 720

Query: 721  LHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKKEGETGRQSN 780
            LHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKKEGETGRQSN
Sbjct: 721  LHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKKEGETGRQSN 780

Query: 781  RDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLP 840
            RDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLP
Sbjct: 781  RDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLP 840

Query: 841  ENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNEL 900
            ENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNEL
Sbjct: 841  ENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNEL 900

Query: 901  DKIMENNSLTEVAKKSLEDDLHDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYR 960
            DKIMENNSLTEVAKKSLEDDLHDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYR
Sbjct: 901  DKIMENNSLTEVAKKSLEDDLHDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYR 960

Query: 961  EELSKSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIK 1020
            EELSKSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIK
Sbjct: 961  EELSKSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIK 1020

Query: 1021 DIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHE 1080
            DIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHE
Sbjct: 1021 DIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHE 1080

Query: 1081 KILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKE 1140
            KILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKE
Sbjct: 1081 KILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKE 1140

Query: 1141 KDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEK 1200
            KDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEK
Sbjct: 1141 KDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEK 1200

Query: 1201 FQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEK 1260
            FQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEK
Sbjct: 1201 FQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEK 1260

Query: 1261 FDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLIS 1320
            FDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLIS
Sbjct: 1261 FDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLIS 1320

Query: 1321 TMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDW 1380
            TMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDW
Sbjct: 1321 TMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDW 1380

Query: 1381 EEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKAD 1440
            EEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKAD
Sbjct: 1381 EEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKAD 1440

Query: 1441 MSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVA 1500
            MSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVA
Sbjct: 1441 MSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVA 1500

Query: 1501 KDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPF 1560
            KDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPF
Sbjct: 1501 KDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPF 1560

Query: 1561 TSPTQELSKSNSPAALPIVHMAPTFSFTPGKSTGTVNKELNKTAQATFGAPXXXXXXXXX 1620
            TSPTQELSKSNSPAALPIVHMAPTFSFTPGKSTGTVNKELNKTAQATFGAP         
Sbjct: 1561 TSPTQELSKSNSPAALPIVHMAPTFSFTPGKSTGTVNKELNKTAQATFGAPTFSNFGTST 1620

Query: 1621 XXXXXXXXXXXXNDQSGFKPFEALKEIDNESIKRPVSDEKEDDFSESKKPKKTE 1674
                        NDQSGFKPFEALKEIDNESIKRPVSDEKEDDFSESKKPKKTE
Sbjct: 1621 AFGGFSGFGKTTNDQSGFKPFEALKEIDNESIKRPVSDEKEDDFSESKKPKKTE 1674

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  486 bits (1252), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 478/1697 (28%), Positives = 858/1697 (50%), Gaps = 163/1697 (9%)

Query: 28   RSKLESSVDNLIKEK-----------LNLKSTIEETESTYKNK---IKNLEDEINILAKT 73
            R++LE  V  L KEK             L++TIE+      NK   +K LE++I+ L  +
Sbjct: 97   RNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEAS 156

Query: 74   RDISGPIRITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSEL 133
            +          VE+Q   N     N+  +++  Q E++  K   L  +SE E   +Q  +
Sbjct: 157  K----------VESQELVNDNK--NLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGM 204

Query: 134  VREHNQWLEEHLVKTTEELMTQKQ-SILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQE 192
            + + N+WLE+ +   TE+L+  +Q +  ++++  QE+  L+++  +            QE
Sbjct: 205  LTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQE 264

Query: 193  LSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNE---- 248
            +S+++Q KL EIK+ SD+ +T++QEF  E+ LK ++    + QL+  ++E  +  E    
Sbjct: 265  ISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTEEKHNS 324

Query: 249  ---DNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYXXXXXXXXXX 305
               DN    +  + M+ L   R+QL++S +E  RL++ VNE + D + E+          
Sbjct: 325  TEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGD-SEEFDLDSTANVSI 383

Query: 306  XX-------------XXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVT 352
                               QK+ L+ Q+E+F+ ELE KVPVI                + 
Sbjct: 384  PKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIA 443

Query: 353  SLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNA 412
             L++  S E+E   +E +S   K +  +    TL  QRSDLA Q+QFLL     Q  +  
Sbjct: 444  LLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRG 503

Query: 413  LLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQL 472
             L+ DE  FI+++ EN+  +  +DSQSII+ERL++F DI  LQ++N ++L T R LA +L
Sbjct: 504  PLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRL 563

Query: 473  EEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXX 532
            EE+EK       ++ERKT++EAK+A++ LQE  + +E K+ T  KERD Y          
Sbjct: 564  EEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQS 623

Query: 533  XXXXXECNDI-DKHTTGKLQNELQQTREYLTKEIEK----LTRTNKDILNKKKELEYSMK 587
                 + + + D     +L   L+     LT E  K    L +  +++   K +L  S +
Sbjct: 624  FDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHE 683

Query: 588  KMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTS 647
            K  S++  AE + +L+++ L M +     ++ ++  LQ +LS++EA+  E         S
Sbjct: 684  KERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQS 743

Query: 648  QYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQAT 707
            + ++L+ R  +  ++ + L++   + ++E+ ++  E+N+L + + +L+  ++E + +   
Sbjct: 744  KLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKE 803

Query: 708  VELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNF------------ 755
             +      + + ++   +L   I  ++++I+  E  +  +  W+Q+              
Sbjct: 804  SQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRD 863

Query: 756  ----PTQTETEIGLPV-DMKK--EGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTS 808
                 T T  ++ L V D+KK  E    R ++  TL    +G        T   +RK   
Sbjct: 864  ELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGET------TQGQLRKDLE 917

Query: 809  LPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSL 868
              ++++     +++E K+  +  + + +  L     ++ + L +  E+  ++K +L+  +
Sbjct: 918  KTMIELKHAYSQNEEFKQISSTAEET-LKNLSNEFEERTEALKSNAEKYLAEKVQLEQCV 976

Query: 869  QAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMEN-NSLTEVAKK------SLEDDL 921
              ++     L+++  L+KN  + EK  +  +L  +  + +SL +V K+       L+ DL
Sbjct: 977  SNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDL 1036

Query: 922  HD-------VEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYREELS--KSAEMQVD 972
                      +   EEE QKH E +  +S+       +  E+   R E+   K++E Q  
Sbjct: 1037 EQQTAYANIAQKNYEEELQKHAEVSKIISQ-------LRSEVQSGRSEIQQLKASEQQAK 1089

Query: 973  ----------IQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLE-DTQNK--DDI 1019
                           EL+  +D   +++D++ +QN LL  Q+      E + +NK     
Sbjct: 1090 EVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGS 1149

Query: 1020 KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSK---GQQWHNLPLSNLL 1076
             ++++ ++RERD L+ KL + +RE ++L ++   L+ EL    K     Q ++   S++ 
Sbjct: 1150 SELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIA 1209

Query: 1077 TGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTER 1136
              HE I+++L +++LLRE+NV+L   VN  +  N  L  EL+ ++    PL  + +   +
Sbjct: 1210 KQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQ 1269

Query: 1137 YFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEAN-FKNEIDSLKGLIEERTKEKE 1195
              +EKDQ I L  DE +RWK+R   ++ R +     E    + EI +LK  +E ++KE  
Sbjct: 1270 SIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENT 1329

Query: 1196 KLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLK 1255
             L+++F  LKKQAHEKL+A+KI    L+ +++E++ +  ++EE++KE   K+  +E  L 
Sbjct: 1330 DLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLT 1389

Query: 1256 ENLEKFDKDEKLVSE-----KTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRK 1310
            E   +   +E L  E     +  KE E KL +T+   + L   LN+E+ SL+E++ + ++
Sbjct: 1390 ERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKE 1449

Query: 1311 KDDET--------NQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTN 1362
            K++++        + ++ +MK  FE EK + I+EK  E N+KFE  + + LS ++ +   
Sbjct: 1450 KENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAK-LSSENGSPAE 1508

Query: 1363 DNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDF 1422
              +  +V+ LK++  +++E  + QRI+EA+ENLK+ IR+P+EE+I+++++KR+ ELE +F
Sbjct: 1509 PVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEF 1568

Query: 1423 DKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAK----LETIRTKAFEEGK 1478
             +R++E           ++ P+    K R EL+  +E + +AK    L + + KAFEEGK
Sbjct: 1569 QRRLKEN----------NLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGK 1618

Query: 1479 RQAEMKTTLLERKLSKLESQV-AKDNESGSKVRKSISGL-TKIDVNSPQLYKDNTGTRTE 1536
            +QA MK+TLLERK+SKLESQ+ + +N +  K   +  GL TKID +  +     T    E
Sbjct: 1619 QQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGE 1678

Query: 1537 AVLKL--RPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHMAPTFSFTPGKSTG 1594
             VLKL  +P          S+ SNPFTS          P    +  M PTFSFTPG S  
Sbjct: 1679 KVLKLSDKPAFSFQP----SSKSNPFTSAL--------PGNNNVFGMKPTFSFTPGSSQP 1726

Query: 1595 TVNKELNKTAQATFGAP 1611
                    T   T   P
Sbjct: 1727 ESRPTFGSTGFNTTAEP 1743

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  436 bits (1120), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 449/1611 (27%), Positives = 826/1611 (51%), Gaps = 154/1611 (9%)

Query: 102  EILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILK 161
            ++L L+  ++  KS+ L  QSE +   ++  ++++++QWLEE +   TE+L++ ++    
Sbjct: 177  QVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRR---- 232

Query: 162  MEEKDQEIDNL-------RHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTK 214
              + D E+D L       ++E+ +            +EL++++QEKL+E+K  SD    +
Sbjct: 233  --KNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYRE 290

Query: 215  QQEFLHEIGLKDRINSSLETQLKEIQQEKSIQ-NEDNTS-------RAESQKIMEQLIDT 266
            +QEF HE+ +K ++   LE Q+K +Q E +   ++DN           E++K++++LI  
Sbjct: 291  KQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITL 350

Query: 267  RKQLKDSRNECTRLKSYVNEFI------NDVNGEYXXXXXXXXXXX-----------XXX 309
            ++  ++S  E  RL++ V E I      +D+N                            
Sbjct: 351  KENFEESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKE 410

Query: 310  XXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEF 369
              QK+ L+ QVE+FI ELE K+PVI                V  L+D  S E+E  E+EF
Sbjct: 411  RHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREF 470

Query: 370  QSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEND 429
            ++  +K + ++  I TLT QR+DLAHQ+QFLL+ +  Q  +  LLS +E  FI+R+  ND
Sbjct: 471  EALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNND 530

Query: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489
                 +DSQ +ISERL++F +I  LQ++NM++L TVR LA +LE +EK       T E  
Sbjct: 531  DPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFEND 590

Query: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTG- 548
            T++EAK+A++ LQ+Y  +LE K+E   KE D +                 N    +  G 
Sbjct: 591  TIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGS 650

Query: 549  --------------KLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKE 594
                           L  E  Q  + L  EI +L R+       K ++   ++K  S+K 
Sbjct: 651  SDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRS-------KTQISIELEKERSSKT 703

Query: 595  YAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQI 654
              E + +LI++ L + +   + +++++ +LQ +  +++++ AE   +L    S+  +L+ 
Sbjct: 704  LTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLET 763

Query: 655  RFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNE 714
            +  + +++   L++  +T+++   ++ EE+N+L++ + +L+  ++E +     ++    E
Sbjct: 764  KVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKE 823

Query: 715  RLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQ----------KNFPTQTETEIG 764
             L   +  + D    ++ +  +  DME  +  ++ WYQ          ++   + +T+  
Sbjct: 824  NLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTF 883

Query: 765  LPVDMKKEG---ETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEES 821
            L  D++ E    E   + +   ++S +  S    +   +SS+RK      + +  T  E 
Sbjct: 884  LVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEI 943

Query: 822  KEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQ 881
             + K   + T+ S +  L ++    +++L  Q+E L ++K +L+  +  +      L + 
Sbjct: 944  DQYKNLLSTTEES-LSQLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEES 1002

Query: 882  LQLEKNSFDTEKASLNNELDKIMENNSLTEVAKK-------SLEDDL-------HDVEMK 927
            LQ    + + EK +L  ++  +   +  +   K+        L+ DL       +  +  
Sbjct: 1003 LQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRN 1062

Query: 928  LEEERQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQVDIQHTR-------ELE 980
             EEE QK    + T+S  EL  +   + I+  R + S+    QV  Q+ +       E E
Sbjct: 1063 YEEELQKDSNVSKTIS--ELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYE 1120

Query: 981  DLLDLANKRIDDLCTQNNLLHEQLNA-TLDLEDTQNKD--DIKDIIVCMKRERDTLQKKL 1037
              L+ + + ++DL TQN+LL++Q+   + D  D  N +  ++++I+  ++RERD L  KL
Sbjct: 1121 RQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKL 1180

Query: 1038 AIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPL---SNLLTGHEKILDELKEVHLLRE 1094
             + +RE + LR   A +++ELD   +        +   S L+  HEKI+++L +++LLRE
Sbjct: 1181 TVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRE 1240

Query: 1095 NNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIER 1154
            +N++L     +    N  L +EL+Q+R+   PL+ + N       EKDQ+++LYK+E  R
Sbjct: 1241 SNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANR 1300

Query: 1155 WKKRWQQMVHRQDDTLGLEAN--FKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKL 1212
            WK+R Q+++H+  D +  E +   K ++  L+  ++E  KE ++L ++F  LKKQAHEKL
Sbjct: 1301 WKERSQEILHKH-DRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKL 1359

Query: 1213 DANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLK------ENLEKFDKDEK 1266
            +++KI   TL+N L+E++ +  +LE   + +++K+ E++  L       E +E   K+  
Sbjct: 1360 NSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELS 1419

Query: 1267 LVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDET---------NQ 1317
               E + +E E  L+ T+   +++ + LN E+ SL+ E++ L+++   T         + 
Sbjct: 1420 DALEHS-RELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSN 1478

Query: 1318 LISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNT---GSNVDKLKQ 1374
            ++ +M+  FE       EEK+  L EK E  +     K +  V  +       N +++K+
Sbjct: 1479 VVESMRRSFE-------EEKINFLKEKTEELKKLEEEKHTLQVNGNEPQQQPVNYEEIKR 1531

Query: 1375 ELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIA 1434
            +   + EE  L+RI EA+ENLK+ IRLP+EE+I++++EK++A LE  + K++EE     +
Sbjct: 1532 QWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESK---S 1588

Query: 1435 LADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSK 1494
              + +D +  +LK+++ ++L+   E ++QA    ++ KAFEEGK+QA MK+TLLERK+SK
Sbjct: 1589 SLESSDGNNSDLKKQLEKDLQEKFEAEVQA----VKKKAFEEGKQQAAMKSTLLERKISK 1644

Query: 1495 LESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRT--------EAVLKLRPTAK 1546
            LESQ+    +S  K     S + K ++ S    K  T  ++        E VLKL P+  
Sbjct: 1645 LESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKP 1704

Query: 1547 VDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHMAPTFSFT--PGKSTGT 1595
              +    S   NPFTS  Q    +N           PTF+ +    KS+GT
Sbjct: 1705 TFNFSSFSG-GNPFTSSPQ----NNDTMGTSAFGFKPTFTLSNNSNKSSGT 1750

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  410 bits (1053), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 444/1617 (27%), Positives = 814/1617 (50%), Gaps = 162/1617 (10%)

Query: 102  EILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSI-L 160
            ++L L+ E++  KS  L  ++E +R  ++  L++ +NQWLE+ L   +EE  + +Q +  
Sbjct: 172  QVLELENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNS 231

Query: 161  KMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQEFLH 220
            +++    E++++R E+ I             +LS+ +Q+K+ E+K   D  S ++QEF  
Sbjct: 232  ELQTALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTR 291

Query: 221  EIGLKDRINSSLETQLKEIQQE------KSIQNEDNTSRAESQKIMEQLIDTRKQLKDSR 274
            E+ LK R+   LE Q++  + E      KS+ N D+   AE +KI+E+LI+T+K+L+ S 
Sbjct: 292  EMTLKQRLIDLLEKQIESFKTELESARNKSVSNSDHVD-AEREKIIEELIETKKKLEISE 350

Query: 275  NECTRLKSYVNEFINDVNGEYXXXXXXXXXXXXXXX--------------------XQKD 314
            ++  +L+  V+E ++  +GE                                     QK+
Sbjct: 351  SKAVKLEETVDELLS-TDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKE 409

Query: 315  YLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQSFKR 374
             L+ QVE F+ ELE KVPV+                V  +++  S ++E  E E  S K 
Sbjct: 410  QLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKS 469

Query: 375  KSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARN 434
            K    +  I +L  QRSDLAHQ+Q LL+ +  +  +N  L+ +ET+FI+++  +      
Sbjct: 470  KIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVE 529

Query: 435  NDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEA 494
             D+Q IISERL++F  + ELQ++NM++L ++R+LA +LE +EK  ++    +E +T++EA
Sbjct: 530  QDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEA 589

Query: 495  KKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTT------G 548
            K+A+L LQEY  SLE +LE   KERD +                 +  ++H         
Sbjct: 590  KEAILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIK 649

Query: 549  KLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLL 608
            +L+N L    E   K I+ L      +   + +   +++K  S++  AE +++LI N L 
Sbjct: 650  ELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLE 709

Query: 609  MLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRT 668
            M +     + ++   LQ+ + ++++K  +  + L    SQ + LQ +  ++QS+ + LR+
Sbjct: 710  MTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRS 769

Query: 669  QHQTTQKELFEVVEEKNALKVKIHELEISRNECKGI----QATVELKLNERLTEYQLHEQ 724
              +  +KE   + EE+N +++ I +L+  + E + +    Q   + K N+  TE      
Sbjct: 770  IQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETEL----S 825

Query: 725  DLLKIIEKQEDQIRDMEVKRAEELNWYQKNFP------TQTETEIGLPVDMKKEGETGRQ 778
            D L+ ++ +  +I D    +  +  WYQ+ F         +  ++   +   +  E   +
Sbjct: 826  DTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVE 885

Query: 779  SNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDA--------- 829
            S  + LE  ++    F  L    SV   T     +  R E E    K  DA         
Sbjct: 886  SLNNKLEESEARIQAFNALNYSESVESQT-----ETLRQELEKTRIKLADAYSQVEQYKS 940

Query: 830  LTDSSQ--VVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKN 887
            + DSS+     + + + + + +   +IE L  ++   K  +  ++ +  +L+++L  +K+
Sbjct: 941  MADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKS 1000

Query: 888  SFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL--------------EEERQ 933
             F+++ +     L+ +    S  +  K   E  +  ++  L              E+E Q
Sbjct: 1001 QFESQISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQ 1060

Query: 934  KHEETNATLSEKELLCEKMIEEISGYR--EELSKSAEMQVDI---QHTRELEDLLDLANK 988
            KH + +  +S      +K   E    R   E +K A  Q ++   + + + ED L LA++
Sbjct: 1061 KHADVSKKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQ 1120

Query: 989  RIDDLCTQNNLLHEQLNATLDLEDTQNKD------DIKDIIVCMKRERDTLQKKLAIVER 1042
            RI+DL  Q+ +L++Q++     + T ++D      + ++++  ++RE+D L+ KL +  R
Sbjct: 1121 RIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTR 1180

Query: 1043 EGEVLRERCAGLKSELDA----VSKGQQWHNLPLSNLLTGHEKILDELKEVHLLRENNVS 1098
            E +VLR++   ++S+L+     +SK Q+  +   S  L   E+I+ +L +++LLRE+N++
Sbjct: 1181 EEKVLRQKLKLIESDLEGSRIELSKLQRAAS-GNSATLKDQEEIMTQLNQLNLLRESNIT 1239

Query: 1099 LLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKR 1158
            L  E  +    +  L  EL  +     PL+ +    +   +EKD +ISL  +E ERWK+R
Sbjct: 1240 LRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQR 1299

Query: 1159 WQQMVHRQDDTLGLE-ANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKI 1217
             Q ++H+ +     E     +++  L+  I+ ++ E E+L  +F+ LK+QAHEKL+A K 
Sbjct: 1300 SQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKT 1359

Query: 1218 HIQTLNNDLSEIKASNLQLE-------EVMKEKDKKIREIELTLKENLEKFDKDEKL-VS 1269
               TL + L+++KA+  +LE       E +K  + KI +IE    ++ EK D  E+L  S
Sbjct: 1360 AQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKN--KSSEKNDLQEQLENS 1417

Query: 1270 EKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDE--------------- 1314
            +    E E KL +  +    L + LN+ + SL  +I +L +  ++               
Sbjct: 1418 QAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSEL 1477

Query: 1315 ---TNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTND------NT 1365
               T++++  +K++FE EK ++I +K  EL E+FE  +  +L  + + +         + 
Sbjct: 1478 VENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDP 1537

Query: 1366 GSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKR 1425
              N+D++K++  +++E++T QRI E+ E LK+ IRLP+EEKI +I+EK+R ELE++F+  
Sbjct: 1538 PVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEAN 1597

Query: 1426 VEEKANLIALADKADMSPD-ELKQKVRRELEHAIEQDLQAKLE----TIRTKAFEEGKRQ 1480
            V++KA  IA +  A  S   E+ +K +++LE+ ++Q++Q K +     I+ +AFEEGK+Q
Sbjct: 1598 VQKKAEEIAKSKSASNSNSTEVLEKHKQDLEN-LKQEMQKKFDEDIAQIKKRAFEEGKQQ 1656

Query: 1481 AEMKTTLLERKLSKLESQVAK--------DNESGSKVRKSISGLTKIDVNSPQLYKDNTG 1532
            A MK+T LE+K++KLE+Q+          DN S +      SG T  DV       +N  
Sbjct: 1657 ASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAE---SGPTTQDVKQLTPILNNQA 1713

Query: 1533 TRTEAVLKLRP--------TAKVDSGKDVSND-SNPFTS--PTQELSKSNSPAALPI 1578
                A+L  +P           +  G+  SN   NPF S  P Q  +    P+  P+
Sbjct: 1714 ----AILPGKPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPV 1766

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  405 bits (1041), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 423/1594 (26%), Positives = 795/1594 (49%), Gaps = 141/1594 (8%)

Query: 118  LISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILKM-EEKDQEIDNLRHEV 176
            L S++E ER  ++  +++  N WLE+ L    E+ ++ ++   K+  E   E+++LR + 
Sbjct: 191  LNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDF 250

Query: 177  SIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQL 236
             +             ELS+++QEKL+EIK  SD  S+++QEF  EI LK R+   LE+QL
Sbjct: 251  QVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQL 310

Query: 237  KEIQQE----KSIQNEDNTSRAESQK--IMEQLIDTRKQLKDSRNECTRLKSYVNEFIND 290
              +++E    + ++  +++ +  S+K  ++++L  T+++L   ++EC RL S + E   +
Sbjct: 311  NAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEE 370

Query: 291  VNGEYXXXXXXX---XXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXX 347
                                     K++L+ Q+E+FI ELE KVP+I             
Sbjct: 371  SGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLENE 430

Query: 348  XXXVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQ 407
                  L++  S E+ +  +E  +   K +  +  IQTL  QR DL  Q+Q+LL+     
Sbjct: 431  LNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVS 490

Query: 408  ATTNALLSKDETDFIRRLTENDT-YARNNDSQSIISERLLKFADITELQKQNMDILATVR 466
              +   L K+E  FI+ + +ND+  A   DSQ I++ERL++F  I ELQ++N ++L  VR
Sbjct: 491  KDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVR 550

Query: 467  HLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXX-- 524
            +LA +LE  E   +     IE +T+ EAK+A+L L+     LE K+E   KE +      
Sbjct: 551  NLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENSKALL 610

Query: 525  XXXXXXXXXXXXXECNDIDKHTTGKLQNELQQTREYLTKE-IEKLTRTNK---DILNKKK 580
                         + N+  ++   ++Q+ LQ     +T+E  E ++  NK   D+ + K 
Sbjct: 611  SNEETSHLNSTIQQLNETKRNLECQIQD-LQSNISQITRESTENMSLLNKEIQDLYDSKS 669

Query: 581  ELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQ 640
            ++   + K +S++  AE + +L+ N L + +     + ++ D LQ  + ++++K  E   
Sbjct: 670  DISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLN 729

Query: 641  DLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNE 700
            +     S+ N+ +    + + +        Q  ++E+ ++  EK  L++ + +L+  + E
Sbjct: 730  EYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKE 789

Query: 701  CKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQ-IRDMEVKRAEELNWYQKNFPTQT 759
             + +          ++ E + H  + LK     +DQ I+ +E      + WYQ       
Sbjct: 790  RENLLDETRKSYQNKIDELE-HAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLK 848

Query: 760  ETEIGLPVDMK-KEGETGR-QSNRDTLESQ------KSGSPGFTDLGT--DSSVRKSTSL 809
            +    +   M  K+ E  + Q    +LE +      +  +    D GT  D S+RK    
Sbjct: 849  KDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVID-GTINDDSLRKELEK 907

Query: 810  PVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQ 869
              + +     + +E K+    T++  +  +     +  KD   +I+ L ++K  L+  + 
Sbjct: 908  SKISLTDAYSQIQEYKELYE-TNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKIS 966

Query: 870  AIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL- 928
             ++ +  +L+++L L+      EKA    ++  +  NN   E  K   E  L  ++  L 
Sbjct: 967  LLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLD 1026

Query: 929  -------------EEERQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQVDIQH 975
                         E+E QKH + + T+SE       + E++  YR +++     +  ++ 
Sbjct: 1027 QQTIYANTAQNNYEQELQKHADVSKTISE-------LREQLHTYRVQVNTLTLSRNQLES 1079

Query: 976  T------------RELEDLLDLANKRIDDLCTQNNLLHEQ--LNATLD--LEDTQNKDDI 1019
            T            + L + L+ +N RI+DL +QN LL++Q  L  T D  + DT +K  +
Sbjct: 1080 TLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPAL 1139

Query: 1020 KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSEL-DAVSK--GQQWHNLPLSNLL 1076
              I++ ++RERD L  K+ + ER+ ++LR++ + +  EL +A +K    +        ++
Sbjct: 1140 NSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII 1199

Query: 1077 TGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTER 1136
              HE I+++L +++LLRE+N++L  E+     +  +L  EL ++++   P++ +    + 
Sbjct: 1200 QQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKY 1259

Query: 1137 YFKEKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDSLKGLIEERTKEK 1194
              +EK+QE+ L K+E+ RWKKR Q ++  HRQ  +   E   ++EIDSLK  ++E+T++ 
Sbjct: 1260 SMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEK-LEHEIDSLKVKLDEKTRQG 1318

Query: 1195 EKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIE-LT 1253
             +  E+F  L++QA E+L  +K+ + TL   ++++K + ++LE+ + + + KI E+E   
Sbjct: 1319 AEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAK 1378

Query: 1254 LKENLEKFDKDEKLV--SEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRK- 1310
             +++  + D  ++L   +E + KE + KL +  T      + LN+E+++LREEI   R+ 
Sbjct: 1379 AEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRI 1438

Query: 1311 ----------KDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENV 1360
                      + ++ ++++ +MK  FE +K   I EK +E+NEK    +  +        
Sbjct: 1439 QQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERL-------- 1490

Query: 1361 TNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELES 1420
             N  +  N+D+LK + + + EE+ + RI EA+E LK+ IRLP+EEKI +IIE++R +LE 
Sbjct: 1491 -NQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEK 1549

Query: 1421 DFDKRVEEKANLIALADKAD----------------------------------MSPDEL 1446
            +FD++VEE+  L++ + + D                                  +S DE 
Sbjct: 1550 EFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDER 1609

Query: 1447 KQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESG 1506
             Q +R E+E  + ++L  +L+ I+ K+FEEGK+QA MKTTLLERKL+K+ESQ+++  +  
Sbjct: 1610 DQ-LRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKIT 1668

Query: 1507 SKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPTQE 1566
                K ++      +  P+  ++N+ +    +L      K++S    S   NPFTSP+  
Sbjct: 1669 ESPSKHVNHTQNQLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPN 1728

Query: 1567 LSKS--------NSPAALPIVHMAPTFSFTPGKS 1592
             S           +  A P  H+ P+F+   G+ 
Sbjct: 1729 KSSQKVDDQRELTTNKADPPTHLTPSFNIPAGRG 1762

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  396 bits (1017), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 415/1541 (26%), Positives = 788/1541 (51%), Gaps = 196/1541 (12%)

Query: 193  LSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKS-------- 244
            +S N+ EK  ++++ ++ Y+T+++E   E+ LK  +   L+TQ++++Q + +        
Sbjct: 259  VSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYTRILNTKQP 318

Query: 245  -IQNEDNTSRAESQKIMEQLIDT----RKQLKDSRN-----ECTRLKSYVNEFINDVNGE 294
             +QN D     E +++ ++LI+T     K+L++ RN     E + L +   E ++ +  E
Sbjct: 319  IVQN-DEERNLEVEELKQKLIETETQLNKELEERRNITMQTESSTLSNQQQEDLDTIKKE 377

Query: 295  YXXXXXXXXXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSL 354
                             QK+ L+ QVE FI ELE KVP I                 T L
Sbjct: 378  LIQERY-----------QKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLL 426

Query: 355  VDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALL 414
            ++ +  E+  +  E  + ++  +      ++LT QR+DLAHQ+Q++L+    Q  +N  L
Sbjct: 427  LENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPL 486

Query: 415  SKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEE 474
            S +E  FI+ + +N++   ++DSQ +ISERL+ F +I ELQ++N+D+L +VR LA +LE 
Sbjct: 487  SAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLEL 546

Query: 475  QEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXX 534
            QE+ +Q+    +E++ ++EAK+A++ LQ Y   LE K++T   E D Y            
Sbjct: 547  QEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTKVET 606

Query: 535  XXXECNDIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKE 594
                 N+ +     +L+  L  +RE   K    L     DI     +     +   +++E
Sbjct: 607  EHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRE 666

Query: 595  YAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDL--------HELT 646
             AE + +LI+N+L +      S +E N+ LQ+ L        E+ QD+         E  
Sbjct: 667  LAEQRLKLIQNSLSL------SKVE-NEQLQKRL--------EILQDITLKQDQRTQETL 711

Query: 647  SQYNLLQIRFTDTQSQSNSLRTQ---HQTTQKELFE----VVEEKNALKVKIHELEISRN 699
             +Y   ++  +++Q++ N +++Q    +T +K L +    V +E+N LK  + +L+  + 
Sbjct: 712  KEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQT 771

Query: 700  ECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQT 759
            E + I  + +L    RL   +    D+ + ++ ++ +I+++E  R  E+ WYQ       
Sbjct: 772  EREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIK 831

Query: 760  ETEIGLPVD-MKKEGETG------RQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVM 812
            E       + ++K  E G      ++  +D L++ +S    +  L    +V   T +  +
Sbjct: 832  EKRDAYQDELLEKTNEIGELNYEIKKLQKD-LQASESRVTAYKVLNNSDNV--GTKMETL 888

Query: 813  Q-------VGRTEEESKEAKKCDALTDSSQVVGLPEN-VTKKEKDLIAQIEQLASDKKEL 864
            Q       +  +E  ++  +   + ++  + +   +N V + +K+ I +IE L  D+ EL
Sbjct: 889  QNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDEL 948

Query: 865  KTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIM-ENNSLTEVAKK------SL 917
              +   +  +   L+++L  +  +   EK+ ++ +L++++ +N+++ EV+ +      +L
Sbjct: 949  LDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTL 1008

Query: 918  EDDLHD-------VEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQ 970
            ++DL          +   E+E QKH E   T+S+       + E+   YR+++     MQ
Sbjct: 1009 QNDLEQQASYANIAQNNYEQELQKHAELAKTISQ-------LREDAHTYRKKMDS---MQ 1058

Query: 971  VDIQHTREL---------------EDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQN 1015
             +     EL               ED +    KRI+DL +QN LL +Q++     E++ N
Sbjct: 1059 ANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYN 1118

Query: 1016 KDDI----KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKG-----QQ 1066
            +       +D+++ ++ +RD LQ +L++ E EG+ LR + + + +EL           QQ
Sbjct: 1119 QQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQ 1178

Query: 1067 WHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGP 1126
            + N  +S  +  H+ I+++L +++LLRE+N++L  E N  +     L ++L  +R+   P
Sbjct: 1179 YENTKIS--VEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLP 1236

Query: 1127 LQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDSLK 1184
            L+ ++N  +   KE +Q+++ YK+E  RWK+R Q ++  H++ D +  E   + EI +LK
Sbjct: 1237 LEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEK-LEAEIATLK 1295

Query: 1185 GLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKD 1244
              + ++ KE E+L+++F  +KKQAHE+L+++K   QTL + + +++  N  ++ +++ + 
Sbjct: 1296 QNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETER 1355

Query: 1245 KKIREIELTLKENLEKFDKD---------EKLVSEKTFKENEAKLNKTITMLQKLNETLN 1295
              I+  E   ++ + K  +D         E L+S K F   E K N ++    +++  LN
Sbjct: 1356 GNIQNTEEKFRQ-MNKQSEDVTALRSQLEEALLSSKEF---ENKFNASVKSSDEISSHLN 1411

Query: 1296 QEVVSLREEINVLRK-KDDET--------NQLISTMKLDFEREKDRLIEEKVRELNEKF- 1345
              + SL  E+  L++ K++E         + ++  MK  FE EK + ++++  E  EK  
Sbjct: 1412 DVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLA 1471

Query: 1346 -ESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSE 1404
             E  R E  +  ++N  N     ++   +++  K++EE  L+RIE+A+ENLKR IRLP+E
Sbjct: 1472 EEVKRIEAQATDTQN-KNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTE 1530

Query: 1405 EKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQA 1464
            EKI  +I+K++ ELE ++D++V ++A  +  +++     ++LK  +++ELE  I+Q+L+ 
Sbjct: 1531 EKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELK- 1589

Query: 1465 KLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESG------------------ 1506
                 + KAFEEGK+QA MKTT LE+K+SKLESQ+   N +                   
Sbjct: 1590 ---NAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENN 1646

Query: 1507 --SKVRKSISG--LTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTS 1562
              SK  +++S   L+KI + +P L   +TG  T A+ + R  + + +G D    SNPFTS
Sbjct: 1647 VPSKQEETLSKPQLSKIQIANPLL---STGGTTLALNQSRAPSSLQNGSD---SSNPFTS 1700

Query: 1563 PTQELSKSNSPAALPIVHMAPTFSFT----PGKSTGTVNKE 1599
            P Q+   + + A +P V   P F       P  S  T++++
Sbjct: 1701 PFQQ---TKNDANIPAV-TQPAFLLREPSEPNMSVSTISRQ 1737

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  389 bits (998), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 437/1625 (26%), Positives = 802/1625 (49%), Gaps = 132/1625 (8%)

Query: 85   VEAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEH 144
            V+A + ++ +    +   IL L+ + +   S  L S+S+ ER  ++  L++ +  WLE+ 
Sbjct: 158  VKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKE 217

Query: 145  LVKTTEELMTQKQSI-LKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIE 203
            L    ++ ++ +Q     + E   +++ +R++  +             ELS+++QEKL++
Sbjct: 218  LSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQ 277

Query: 204  IKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNTSR---------- 253
            IK  SD  ++++++F  EI LK R+   LE+QL  +++E +   E N S           
Sbjct: 278  IKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLI 337

Query: 254  AESQKIMEQLIDTRKQLKDSRNECTRLKSYVNE-------FINDVNGEYXXXXXXXXXXX 306
            +E++K+++ L  T+ +L    NEC RL S   E         +  NG++           
Sbjct: 338  SENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEK 397

Query: 307  XXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLE 366
                  K++L+ Q+E+FI ELE KVP+I                   L++  S E+ +  
Sbjct: 398  RA----KEHLQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKI 453

Query: 367  KEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLT 426
            KE +    K       I  L+ QR DL  QIQ+LL+       +   L K+E  FI+ + 
Sbjct: 454  KELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNIL 513

Query: 427  ENDTYARN-NDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHT 485
            +ND  A   +DSQ I++ERL++F DI +LQ++N ++L   R+LA +LE  E   +     
Sbjct: 514  QNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKN 573

Query: 486  IERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXX-----XECN 540
            IE +T+ EAK+A+L LQ     LE K+    KER+ +                    E  
Sbjct: 574  IENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETK 633

Query: 541  DIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA 600
               +  T  LQ  + Q     T+ +  L +  +D+ + K  L   + + +S++  AE + 
Sbjct: 634  RELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERF 693

Query: 601  ELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQ 660
            +L+ N L + +     + +++ +LQ  +S++++K  E   D     S+ + ++   ++ +
Sbjct: 694  KLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLK 753

Query: 661  SQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQ 720
             +        +  ++EL E+  EK +L + + +L+  + E + +    +     ++   Q
Sbjct: 754  LERTLKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQ 813

Query: 721  LHEQDLLKIIEKQEDQ-IRDMEVKRAEELNWYQKNFPT-QTETEIGLPVDMKKEGETGR- 777
             + Q+ LK    ++DQ I+ +E     ++ WYQ    T + + E  +    +K+ E  R 
Sbjct: 814  -NAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERF 872

Query: 778  ----QSNRDTLESQKSGSPGFTDLG---TDSSVRKSTSLPVMQVGRTEEESKEAKKCDAL 830
                +S    +E  K     +  L     D S+R+      + +     + +E KK    
Sbjct: 873  QYEIKSLEKEIEENKIRLHTYNVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYET 932

Query: 831  TDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFD 890
            TD S +  +   + +  K    QI+ L  +K  L+  +  +R +  +L+++L L+  + +
Sbjct: 933  TDKS-LQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAME 991

Query: 891  TEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL--------------EEERQKHE 936
             EKA    ++  +  NN   E  K   E  L  ++  L              E+E QKH 
Sbjct: 992  KEKAEFKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHA 1051

Query: 937  ETNATLSE-KELL--CEKMIEEISGYREELSKS-AEMQVDIQHTRE-LEDLLDLANKRID 991
            + + T+SE +E L   +  +E ++  R +  K+  E + +    +E L + LDL+N RI+
Sbjct: 1052 DVSKTISELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIE 1111

Query: 992  DLCTQNNLLHEQ--LNATLDLEDTQNKDDI---KDIIVCMKRERDTLQKKLAIVEREGEV 1046
            DL +QN LL++Q  L  T   + T  K       DI++ ++RERD L  K+A+ ER+ ++
Sbjct: 1112 DLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKM 1171

Query: 1047 LRERCAGLKSEL-DAVSK--GQQWHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEV 1103
            LR++ + +  EL +A +K    +  N   S ++  H++++++L +++LLRE+N +L  E+
Sbjct: 1172 LRQKISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNEL 1231

Query: 1104 NQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMV 1163
            +     N  L  EL ++R    P++ +    +   +EK+QEI L K+E+ RWKKR Q ++
Sbjct: 1232 DSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIM 1291

Query: 1164 --HRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQT 1221
              H+Q  +   E   + EI+SLK  +E++T++     EKF  L++QA EKL A+K+   +
Sbjct: 1292 EKHQQLSSTDYEK-LETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDS 1350

Query: 1222 LNNDLSEIKASNLQLEEVMKEKDKKIREIE-LTLKENLEKFDKDEKLV--SEKTFKENEA 1278
                L+E+K + L LE+ +   + +I+E+E   + EN  +    +KL   +E+  KE E 
Sbjct: 1351 FIEQLNELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEENSKELET 1410

Query: 1279 KLNKTITMLQKLNETLNQEVVSLREEI-----------NVLRKKDDETNQLISTMKLDFE 1327
            KL +         + LN+E+  L+EE+                + D+ ++++ +MK  FE
Sbjct: 1411 KLEENAISYDSTVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKRSFE 1470

Query: 1328 REKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQTLQR 1387
             +K + IEEK RE+N+K    R    ++++E      +  N+D++K++   +  E+  ++
Sbjct: 1471 EDKIKFIEEKTREVNQKI---REFQEAQEAEETGLKPSNINIDEIKKQWEAEHNEEVSKK 1527

Query: 1388 IEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADK--------- 1438
            I EA+E LK+ IRLP+EEKI +IIE+++ +LE +FD++VEE+   I+ + K         
Sbjct: 1528 IREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMEDIFQKQL 1587

Query: 1439 ----------------------------ADMSPDELKQKVRRELEHAIEQDLQAKLETIR 1470
                                        +D+   + K K+R ++E  + ++   +L+TI+
Sbjct: 1588 ESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHELQTIK 1647

Query: 1471 TKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDN 1530
             K+FEEGK+QA MKTTLLERKL+K+ESQ+++  +S     K +S +    +  P+  ++N
Sbjct: 1648 KKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSPPKHLSKMPNPLLGLPRKIEEN 1707

Query: 1531 TGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPT-----QELSKSNSPAAL---PIVHMA 1582
            +      +L      K++S    S   NPFTSP+     Q       P++    P  H+A
Sbjct: 1708 SNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKPLQGDEAEREPSSNETEPPTHLA 1767

Query: 1583 PTFSF 1587
            P+F+ 
Sbjct: 1768 PSFNI 1772

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  387 bits (994), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 451/1653 (27%), Positives = 807/1653 (48%), Gaps = 228/1653 (13%)

Query: 94   TSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELM 153
            T I  +ND+IL L+ + +  +S  L  +SE ER+ ++  L+R++ +WLE+ L    +  M
Sbjct: 152  TQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILLLRKNQEWLEQELTNKNQHFM 211

Query: 154  -TQKQSILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYS 212
              +K++ L + +    ++ L+ ++ I             E +E +Q  LIE K   D  +
Sbjct: 212  FYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILSKKLDETTEQLQNNLIENKDLKDVLA 271

Query: 213  TKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQ--------NEDNTSRAESQKIMEQLI 264
             ++QEF  E+ +KD++    E Q+K +  E ++Q        NE+N+S    + + E+L 
Sbjct: 272  VEKQEFDKELSIKDKLIKLYENQIKSL--ESTLQQKFKTAEANEENSSEV-VKSLKEELS 328

Query: 265  DTRKQLKDSRNECTRLKSYVNEFINDVN----------------------GEYXXXXXXX 302
               ++L+D   +C RL+S ++   NDV+                      G +       
Sbjct: 329  LAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISL 388

Query: 303  XXXX----------XXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVT 352
                               QK+ L+ QVE+F+ ELE K+PVI                  
Sbjct: 389  SRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTA 448

Query: 353  SLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNA 412
             L++  + E E    E QS K+K   ++  ++ L  QR+DLAHQ+Q+LL+ +      + 
Sbjct: 449  LLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDH 508

Query: 413  LLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQL 472
            LL++DE  FI+ L  ND  A  NDSQ +ISE L+KF DI +LQ++NM+++ TVR LA QL
Sbjct: 509  LLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQL 568

Query: 473  EE-QEKLRQADHHTI--ERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXX 529
            EE +EK +   ++T+  + +   EAK+A+L L++   +LE+ L+   KERD +       
Sbjct: 569  EENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSED 628

Query: 530  XXXXXXXXECNDIDKHTTGKLQNELQQTREYLTKEIE-KLTRTNKD-------------I 575
                      N + K+      +EL+   E + K++E +LT+   D             +
Sbjct: 629  RERNFKS--SNSVHKY------HELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNL 680

Query: 576  LNKK-KELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAK 634
            L+K+  +L   ++K  SAK  AE + ++ +N++ +L +  + +  ++  L+  L Q++ +
Sbjct: 681  LHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKE 740

Query: 635  LAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHEL 694
              +      E  S+ + L+    + +++   L+ +  + + EL    EEK  L++ + +L
Sbjct: 741  TQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQL 800

Query: 695  EISRNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKN 754
            +  ++E + +   V+    +R++E     + L K + ++  +I  +E +R  +  WYQK 
Sbjct: 801  QSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKK 860

Query: 755  FPTQTETEIGLPVDMK-KEGETGR-QSNRDTLESQKSGSP----GFTDLGTDSSVRKSTS 808
                ++ +  +   ++ K  E  R      TLE +  G+      +  +  ++S  +  +
Sbjct: 861  IDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEEN 920

Query: 809  LPVMQVGRTEEESKEAKKCDALTDSSQVVGLPEN-----------VTKKEKDLIAQIEQL 857
              + ++ +T+ E       DA +   +   L +N              K++D    I+ L
Sbjct: 921  DVIKELEKTKIEL-----ADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKTL 975

Query: 858  ASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSL 917
              +K E++   + ++ + +++ ++L ++    ++E+  L   + ++       E  KK  
Sbjct: 976  TEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMF 1035

Query: 918  EDDLHDVEMKLEE--------------ERQKHEETNATLSEKELLCEKMIEEISGYREEL 963
            E+ L  +E  LEE              E Q+H + + T+SE     +++  +      EL
Sbjct: 1036 EEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAEL 1095

Query: 964  -SKSAEMQVDIQHTRELED----LLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDD 1018
             S   +M  + +H +   D     +DLA +RIDD+  QN LL+ Q++  L+  ++ N++ 
Sbjct: 1096 QSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDL-LNRAESVNENS 1154

Query: 1019 IKD-------IIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLP 1071
              D       +++ ++RERD L  K+ ++E E   L+++   +++EL+   +        
Sbjct: 1155 SDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESE 1214

Query: 1072 L---SNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQ 1128
                S+L+  ++ I  +L++++LLRE+NV+L  E+ Q   +   +  +L   R    PLQ
Sbjct: 1215 YSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQ 1274

Query: 1129 DQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHRQ-----DDTLGLEANFKNEIDSL 1183
                +     KEKD +I+   DE +RWK R ++M+ +      DD   LE      ++  
Sbjct: 1275 SNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEET----LNET 1330

Query: 1184 KGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEK 1243
            K L++ + +E  +L+++F  LKKQAHEKL+ +K     L + L E      Q+  ++ EK
Sbjct: 1331 KQLLDNKVQETNELNDRFNRLKKQAHEKLNTSK----ELQSSLQE------QISNLISEK 1380

Query: 1244 DKKIREIELTLKENLEKFDKDEKLVSE-KTFKENE-------AKLNKTITMLQKLNETL- 1294
            D   +++++  +EN E       L+SE   F+E +        +LNK I+  ++L   L 
Sbjct: 1381 DDIRKQLDVKTEENSE-------LLSELNNFREKQNDLETLREELNKEISKSEELEVKLQ 1433

Query: 1295 -------------NQEVVSLREEINVLRKK--------DDETNQLISTMKLDFEREKDRL 1333
                         N+E+  L++ I+ L+ +        D++TN+ +  +K +FE +K + 
Sbjct: 1434 NEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKF 1493

Query: 1334 IEEKVRELNEKF----ESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQT----L 1385
            I EK  E N++     E  RNE      EN   D T  NVD   + LRK WEE +     
Sbjct: 1494 IAEKTEEFNKRLIEETEKIRNEF----QENEKPD-TELNVD--VEALRKQWEEDSEELIQ 1546

Query: 1386 QRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDE 1445
            +RI EA++NLK+ IRLPSEEKI +IIEKRR+ELES+FD+++ +KA  + + D ++   +E
Sbjct: 1547 KRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNE 1606

Query: 1446 LKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVA---KD 1502
            LK+ + +EL+   E +LQA     R KAFEEGK+QA MKTTLLERK+ KLESQ+    KD
Sbjct: 1607 LKEALEKELKERFEDELQA----ARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKD 1662

Query: 1503 NESGSKVR---KSISGLTKID--VNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDS 1557
            +E    V+    S   + KI   +NS     D +   +  V  L+P             S
Sbjct: 1663 SEETQDVKPEENSTPSVKKIPETLNSS----DTSFGNSNNVKVLKP-------------S 1705

Query: 1558 NPFTSPT-----QELSKSNSPAALPIVHMAPTF 1585
            +PF + +        + + +P A      APTF
Sbjct: 1706 SPFGATSAFNNPFTFNNNGNPPAFASA-FAPTF 1737

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  383 bits (983), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 440/1677 (26%), Positives = 803/1677 (47%), Gaps = 223/1677 (13%)

Query: 81   RITGVE-AQAPNNATS--ISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREH 137
            R+  VE A+  NN T+    N+   ++ L+ + +   +  L S+SE ER  ++  L++ +
Sbjct: 151  RLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELNLLQSN 210

Query: 138  NQWLEEHLVKTTEELMTQKQSI-LKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSEN 196
              WLE+ L   +E+ ++ +Q     + E   E++ L+++  +             ELS +
Sbjct: 211  KDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNS 270

Query: 197  VQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE-KSIQNEDNT---- 251
            +QEK++++K  SD  +T++QEF  EI LK R+   LETQL  +++E KSI+  D++    
Sbjct: 271  LQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTS 330

Query: 252  --SR---AESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYXXXXXXX---- 302
              SR   +E++ +++ L  T+++L    +EC RL S + E   + +G             
Sbjct: 331  DDSRKLISENESLLKDLRLTKEKLAQCESECLRLSS-ITEETGEESGTLTSRSSTDFILL 389

Query: 303  XXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIER 362
                      K+ L+ Q+E+FI ELE KVPVI                   L++  S E+
Sbjct: 390  KKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEK 449

Query: 363  ESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFI 422
             +  +E      K    +  I  LT QR DL  Q+Q+LL+       +   L K+E  FI
Sbjct: 450  NAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFI 509

Query: 423  RRLTENDTYARN-NDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQA 481
            + + +ND      +DSQ I++ RL++F ++ ELQ++N ++L   R+LA +LE  E   + 
Sbjct: 510  QNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQ 569

Query: 482  DHHTIERKTLEEAKKALLDLQEYTNSLERKLE-----------TFRKERDVYXXXXXXXX 530
            +   IE KT+ EAK+A+L LQ    SLE K+E           +  K+   +        
Sbjct: 570  NLLKIENKTINEAKEAILSLQSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQL 629

Query: 531  XXXXXXXECNDIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKME 590
                   E    D      LQ  + Q     T+ +  L +  +DI + K ++   + K +
Sbjct: 630  TKTKRELESQVQD------LQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEK 683

Query: 591  SAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYN 650
            S++  AE + +L+ N L + +     + +++D LQ  +S++++K        HE  ++Y 
Sbjct: 684  SSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKT-------HETLNEYI 736

Query: 651  LLQIRFTDTQSQSNSLRTQHQ-------TTQKELFEVVEEKNALKVKIHELEI------- 696
              + + + T++  ++L+ + +       + ++EL ++  EK +L++ + +L+        
Sbjct: 737  SCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKERED 796

Query: 697  ----SRNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQ 752
                +R  C+     VE   NE   E    +Q ++++   +ED    +E        WYQ
Sbjct: 797  LLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQL---EEDNTSKIE--------WYQ 845

Query: 753  K-------------NFPTQTETEIGLPVDMKKEGETGRQSNRDTLESQKSGSPGFTDLGT 799
                          N   + +TEI       K  E   + N+  L +         D   
Sbjct: 846  NKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETIND--- 902

Query: 800  DSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLAS 859
              S+RK   +  + +     + +E KK    T  S +  +   + +  +    QI+ L  
Sbjct: 903  -DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQS-LREMNSKLDESNEAFSNQIQSLTD 960

Query: 860  DKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLED 919
            +K  L+  +  ++ +  +L+++L L+KN  + +K      +  +  NN   E  K   E 
Sbjct: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020

Query: 920  DLHDVEMKL--------------EEERQKHEETNATLSEKELLCEKMIEEISGYR----- 960
             L  ++  L              E+E QKH + + T+SE       + E++  YR     
Sbjct: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISE-------LREQLHTYRGQVKT 1073

Query: 961  --------EELSKSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLN----ATL 1008
                    E + K  E     Q    LE L DL+N RI+DL +QN LL+ Q+     A  
Sbjct: 1074 LTLSRSELENILKENEKSWTSQKQSLLEQL-DLSNSRIEDLSSQNKLLYNQIELYTAAGN 1132

Query: 1009 DLEDTQNKDDIK-DIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSEL-DAVSK--G 1064
             + D +N   +  DI+V ++RERD L  K+ + ER+ ++LR++   +  EL DA +K   
Sbjct: 1133 GVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNN 1192

Query: 1065 QQWHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLS 1124
             +  N   S+++  H+ I+++L +++LLRE+N++L  E+      N  L  EL +++++ 
Sbjct: 1193 SRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEII 1252

Query: 1125 GPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDS 1182
             P++ + +  +   +EK+QEI L K+E+ RWKKR Q ++  H+Q  +   E   ++E++S
Sbjct: 1253 APIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEK-LESEVES 1311

Query: 1183 LKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKE 1242
            LK  +E++ ++  +  E+F  L++QA EKL  +K+  +TL   L+E+K + + LE  + +
Sbjct: 1312 LKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLND 1371

Query: 1243 KDKKIREIE---LTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVV 1299
             + +I+E+E   +    N  +  K  +  +EK+ +E E KL +           LN+E+ 
Sbjct: 1372 ANTRIQELEGEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIA 1431

Query: 1300 SLREEI-----------NVLRKKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESG 1348
            +L+EEI                +D++ + ++ +MK  FE +K + IEEK RE+N+K +  
Sbjct: 1432 TLKEEIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEA 1491

Query: 1349 RNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQ 1408
            +  +         N  +  N+D++K++   + EE+  +R+ EA+E LK+ IRLP+EEKI 
Sbjct: 1492 QERL---------NQPSSVNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKIS 1542

Query: 1409 RIIEKRRAELESDFDKRVEEKANLIA---------------------------------- 1434
            +IIE+++ +LE +F++++EEK   I+                                  
Sbjct: 1543 KIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQE 1602

Query: 1435 ----LADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLER 1490
                ++  + +S +E K ++R E+E  + ++L  +L+ ++ K+FEEGK+QA MKTTLLER
Sbjct: 1603 KLKEVSHSSSISVNE-KDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLER 1661

Query: 1491 KLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSG 1550
            KL+K+ESQ+++  +S     K  + +    +  P+  ++N+ +    +L      K +S 
Sbjct: 1662 KLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSK 1721

Query: 1551 KDVSNDSNPFTSPTQELSKSNSPAAL----------------PIVHMAPTFSFTPGK 1591
               S   NPFTSP        SP  L                P  H+AP+F+    +
Sbjct: 1722 SSSSGAFNPFTSP--------SPKKLLQKDDVQKETSNNKTDPPTHLAPSFNIPATR 1770

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  355 bits (911), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 418/1613 (25%), Positives = 795/1613 (49%), Gaps = 172/1613 (10%)

Query: 118  LISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQS----ILKMEEKDQEIDNLR 173
            L S++E ER  ++  L++ +N WLE+ L    E+ ++ +Q     IL +     E++ LR
Sbjct: 191  LNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR---NELNRLR 247

Query: 174  HEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLE 233
            ++  +             ELS+++QEKL+EIK  SD  ++++QEF  E+ LK R+   LE
Sbjct: 248  NDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLE 307

Query: 234  TQLKEIQQEKSIQNEDNTSRA----------ESQKIMEQLIDTRKQLKDSRNECTRLKSY 283
            +QL  +++E +   E NT++           E++ ++++L  T+++L     EC RL S 
Sbjct: 308  SQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSI 367

Query: 284  VNEFIND---VNGEYXXXXXXXXXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXX 340
             +E   D   ++ +                  K++L+ Q+E FI ELE KVP+I      
Sbjct: 368  TDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKER 427

Query: 341  XXXXXXXXXXVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFL 400
                         L++  S E+ +  KE  +  +K    +  +QTLT QR DL  QIQ+L
Sbjct: 428  TDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYL 487

Query: 401  LLILGEQATTNALLSKDETDFIRRLT-ENDTYARNNDSQSIISERLLKFADITELQKQNM 459
            L+       +   L K+E  FI+ +  E+D+    +DSQ +++ERL++F +I +LQ++N 
Sbjct: 488  LITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNA 547

Query: 460  DILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLE------ 513
            ++L  VR+LA +LE +EK  +     IE +T+ EAK+A++ L+     LE ++E      
Sbjct: 548  ELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKEL 607

Query: 514  -----TFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTGKLQNELQQTREYLTKEIEKL 568
                 +   E   Y               E    D      LQ  + Q     T+ +  L
Sbjct: 608  EELKTSVPNEDASYSNVTIKQLTETKRDLESQVQD------LQTRISQITRESTENMSLL 661

Query: 569  TRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLL 628
             +  +D+ + K ++   + K +S++  AE + +L+ N L + +     + ++ D+LQ  +
Sbjct: 662  NKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTI 721

Query: 629  SQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRTQ-HQTTQKELFEVVEEKNAL 687
             ++++K  E   +     S+ ++++    + + +   LR    +  ++EL ++  EK++L
Sbjct: 722  LKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQ-KLRVHLEKNLKQELNKLSPEKDSL 780

Query: 688  KVKIHELEISRNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEE 747
            ++ + +L+  + E + +         +++ E +    +L K   +++  I+ +E      
Sbjct: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840

Query: 748  LNWYQKNFPT--QTETEIGLPVDMKKEGETGRQSNRDTLESQ------KSGSPGFTD-LG 798
            + WYQ       +    +   VD K+      Q    +LE +      +  +    D   
Sbjct: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900

Query: 799  TDSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKE---KDLIAQIE 855
             D S+RK   L   ++  T+  S+  +  D    +SQ   L +  +K +   KD   QI+
Sbjct: 901  NDDSLRKE--LEKSKINLTDAYSQIKEYKDLYETTSQ--SLQQTNSKLDESFKDFTNQIK 956

Query: 856  QLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKK 915
             L  +K  L+  +  ++ +  +L+++L L+K   + EKA     +  +  NN   E  K 
Sbjct: 957  NLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKS 1016

Query: 916  SLEDDLHDVEMKL--------------EEERQKHEETNATLSE-KELL--CEKMIEEISG 958
              E  L  ++  L              E+E QKH + + T+SE +E L   +  ++ ++ 
Sbjct: 1017 EYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNL 1076

Query: 959  YREELS---KSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLN----ATLDLE 1011
             R++L    K  E     Q    LE L DL+N RI+DL +QN LL++Q+     A  ++ 
Sbjct: 1077 SRDQLENALKENEKSWSSQKESLLEQL-DLSNSRIEDLSSQNKLLYDQIQIYTAADKEVN 1135

Query: 1012 DTQNKDDIKDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSEL-DAVSK--GQQWH 1068
            ++ N   + +I++ ++RERD L  K+ + ER+ ++LR++ + +  EL DA +K    +  
Sbjct: 1136 NSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVE 1195

Query: 1069 NLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQ 1128
                S+++  H+ I+++L +++LLRE+N++L  E+    +    L  EL ++++   P++
Sbjct: 1196 KENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIE 1255

Query: 1129 DQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDSLKGL 1186
             +    +   +EK+QE+ L K+E+ RWKKR Q ++  H Q  +   E   ++EI++LK  
Sbjct: 1256 SELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEK-LESEIENLKEE 1314

Query: 1187 IEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKK 1246
            +E + ++  +  EKF  L++QA E+L  +K+   +L   ++ ++ +   LE  + E + +
Sbjct: 1315 LENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANAR 1374

Query: 1247 IREIE-LTLKENLEKFDKDEKLV--SEKTFKENEAKLNKTITMLQKLNETLNQEVVSLRE 1303
            I E++   + +   + +   KL   +EK  +E +AKL ++ T  +     LN+E+ +L+E
Sbjct: 1375 IEELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKE 1434

Query: 1304 EI------------NVLRKKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNE 1351
            EI                +++D +N ++ +MK  FE +K + I+EK +E+NEK    +  
Sbjct: 1435 EIEKQRQIQQQLQATSANEQNDLSN-IVESMKKSFEEDKIKFIKEKTQEVNEKILEAQER 1493

Query: 1352 VLSKQSENVTNDNTGSNVDKLKQELRKDWE----EQTLQRIEEAKENLKRHIRLPSEEKI 1407
            +           N  SN++   +E++K WE    ++  Q+I EA+E LK+ IRLP+EEKI
Sbjct: 1494 L-----------NQPSNINM--EEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKI 1540

Query: 1408 QRII----------------------------------------EKRRAELESDFDKRVE 1427
             +II                                        ++++ ELE++++K+++
Sbjct: 1541 NKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQ 1600

Query: 1428 EKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTL 1487
            E+  L  +   + +S DE + K+R E+E  + ++   +L+ I+ K+F+EGK+QA MKTTL
Sbjct: 1601 EE--LKDVPHSSHISDDE-RDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTL 1657

Query: 1488 LERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKV 1547
            LERKL+K+ESQ+++  +S     KS++ +    +  P+  ++N+ +    +L      K+
Sbjct: 1658 LERKLAKMESQLSETKQSAESPPKSVNNVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKL 1717

Query: 1548 DSGKDVSNDSNPFTSPT--QELSKSN------SPAALPIVHMAPTFSFTPGKS 1592
            +S K  S   NPFTSP+  + L   N      +    P  H+ P+F+    + 
Sbjct: 1718 NS-KSSSGGFNPFTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASRG 1769

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  330 bits (846), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 390/1543 (25%), Positives = 731/1543 (47%), Gaps = 170/1543 (11%)

Query: 96   ISNINDEILTLQRELE----RAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEE 151
            +  +N E+   + ELE      +S+ L  Q+E +R  ++  LVR + +W    L +  ++
Sbjct: 156  VLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQ 215

Query: 152  LMTQKQSI-LKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDD 210
            L + ++    +++    E++ +++E+ +             ELS+ +Q+ L E K+ +D 
Sbjct: 216  LNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDS 275

Query: 211  YSTKQQEFLHEIGLKDRI----NSSLETQLKEIQQEKSIQNEDNTSRAESQKIMEQLIDT 266
              +++QEF  E+ LK R+    N  + T  +++++   +      S +E ++++  L DT
Sbjct: 276  LHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDT 335

Query: 267  RKQLKDSRNECTRLKSYVNEF---------------------------INDVNGEYXXXX 299
            +K+L+ S+   +RL+  + E                            I+ V G+     
Sbjct: 336  KKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALR 395

Query: 300  XXXXXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRIS 359
                         K+ L+ QVE+F+ ELE K+PV+                VT L++  +
Sbjct: 396  KQLVQERR----HKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATA 451

Query: 360  IERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDET 419
             ER+    + + +K K    +  +  L  QRSDLA Q+Q LL+ +  +  ++  L+ +E 
Sbjct: 452  RERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEV 511

Query: 420  DFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLR 479
            +F+++L      A  +D+Q+IIS RL++F  + ELQ++N ++L  +R LA +LE++E   
Sbjct: 512  EFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKT 571

Query: 480  QADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXX--------- 530
            Q+   ++E+ T+ EAK+A+L LQE+   LE +LET   ERD +                 
Sbjct: 572  QSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVG 631

Query: 531  XXXXXXXECNDIDKHTTGKLQ---NELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMK 587
                   E  D   H   +L+    E +Q  + L +EI+ L ++N        +L   ++
Sbjct: 632  AAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSN-------SQLAIELE 684

Query: 588  KMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTS 647
            +  S++E A+ K  LI+ +L +++     +  +   LQ LL +++ +     ++     S
Sbjct: 685  RERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKS 744

Query: 648  QYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQAT 707
            +   +  + T  QS+ + LR      +KE   + ++ N  ++ I +L+ ++ E   +   
Sbjct: 745  ELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEE 804

Query: 708  VELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPV 767
               +   R+ E         + +E+++ +  ++    + +  W+Q    +  E E+G   
Sbjct: 805  TRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKE-ELG--- 860

Query: 768  DMKKEGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESK----- 822
               K     + S  D L+++ + S    +  +    + S  L      R +  SK     
Sbjct: 861  -SSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEA 919

Query: 823  ---------EAKKCDALTDSSQVVGLPENVTKKEKDLIAQIE-QLASDKKELKTSLQAIR 872
                     E ++  A +++++   L  N  +  KD   Q    L ++  +L + +    
Sbjct: 920  NRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMAN 979

Query: 873  AEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKK-------SLEDDL---- 921
               + L D+L   + ++ TE++ L  +++ ++ +    E AK         L+ DL    
Sbjct: 980  DRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQI 1039

Query: 922  ---HDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYR---EELSKSAEM--QVDI 973
               ++ E K +   QK  E +  +       E    EI+ ++   EE  K  E   Q   
Sbjct: 1040 SSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWD 1099

Query: 974  QHTRELEDLLDLANKRIDDLCTQNNLLHEQL------NATLDLEDTQNKDDIKDIIVCMK 1027
            Q   ++E  LDLA++RI++L TQN LL++Q+       ++    DT+   D +++IV ++
Sbjct: 1100 QQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLR 1159

Query: 1028 RERDTLQKKLAIVEREGEVLRERCAGLKSELDAV------SKGQQWHNLPLSNLLTGHEK 1081
            RERD L+ K+ + +RE ++LR+R    KSELD +      SKG        S      E+
Sbjct: 1160 RERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQ---NQEE 1216

Query: 1082 ILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEK 1141
            + ++L +++LLRE+N+SL  E  ++   N  L +E+  +++   P+++Q  +      EK
Sbjct: 1217 LFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEK 1276

Query: 1142 DQEISLYKDEIERWKKRWQQMVHRQDDTLGLEAN-FKNEIDSLKGLIEERTKEKEKLSEK 1200
            +Q+++L K+E +RWK+R Q ++H+ +     E     +EI+ LK  +E ++ E     E+
Sbjct: 1277 EQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQER 1336

Query: 1201 FQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEK 1260
            F+ L+KQA+E+LD  K     + ++L    +   QLE  + E  +KI  +E  L E    
Sbjct: 1337 FRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLTERPAS 1396

Query: 1261 FD-------------------------KDEKLVSEKTFKENEAKLNKTITMLQKLNETLN 1295
             D                         K E  +SE++FK+   +LNK +  +QK     N
Sbjct: 1397 EDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQK-----N 1451

Query: 1296 QEVVSLREEINVLRKKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSK 1355
                S   + +      ++   ++   K   E E+  LIE   +EL  + E+ R   L++
Sbjct: 1452 SAPSSGHSDPSSYH---EQPTAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFLAE 1508

Query: 1356 QSE----------NVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEE 1405
            + +          NV+ +    N++ LK++  +++E+QTLQRI EA+E LK+ IRLPSEE
Sbjct: 1509 KEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEE 1568

Query: 1406 KIQRIIEKRRAELESDFDKRVEEKANLIAL---------ADKADMSPDELKQKVRRELEH 1456
            +I ++IE+++  LE +F  +V   A  +AL         +DKAD+  D  K+ V  +L+ 
Sbjct: 1569 RINQVIERKQKALEQEFTTKV--NATALALLKENPDSIASDKADLIKDHQKEIV--QLKK 1624

Query: 1457 AIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQV 1499
             +    + +L  ++ KAFEEG++Q  MK  LLE K+SKLESQ 
Sbjct: 1625 DLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQA 1667

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  318 bits (815), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 363/1316 (27%), Positives = 669/1316 (50%), Gaps = 166/1316 (12%)

Query: 312  QKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQS 371
            Q++  E  +E F+ +LE ++P +                 T L+++ + E+  +  E   
Sbjct: 405  QRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQ 464

Query: 372  FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEND-- 429
             + + +  +  I+ +  QRSDLA+Q+QF L+       +   L+ +E  FIR + + D  
Sbjct: 465  AQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDE 524

Query: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489
             + +  D+Q +ISERL KF DI ELQ++NM++L T R LA +LEE++K++QA+   IE +
Sbjct: 525  MHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEE 584

Query: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTGK 549
            T+ EAK+A+L LQ Y +SL  K+    KE + Y                  D DK    +
Sbjct: 585  TIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSNTEDSSTPA-----DFDKQ---R 636

Query: 550  LQNELQQTREYLTKEIE-------KLTRTNKDILN--------KKKELEYSMKKMESAKE 594
             Q E++ T+  L KE+E       + ++ N +ILN        K   +   + + +SAK+
Sbjct: 637  EQREIEHTQ--LVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQ 694

Query: 595  YAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQI 654
             AE + +L++ ++ M     + + ++ + L+ ++ +++ +  E    L +  S+   ++ 
Sbjct: 695  LAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVEN 754

Query: 655  RFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNE 714
            ++  +Q++   L +  +  + EL  + EEKN++K+ +  L+  ++E + + +T + K N+
Sbjct: 755  KWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNK 814

Query: 715  RLTEYQLHEQDLLKIIEKQE--------------DQIRDMEVKRAEELNWYQKNFPTQTE 760
             L + +    DL K +++ E              D  R  +    EE++  +K +     
Sbjct: 815  ELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRY----- 869

Query: 761  TEIGLPVDMKKEGETGRQSNRDT---------LESQKSGSPGFTDLGTDSSVRKSTSLPV 811
            +EI     ++KE ET  ++ R T         +E  K+ S     L   SS++K   L V
Sbjct: 870  SEI-----VEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQK--ELQV 922

Query: 812  MQVGRTEEESK-EAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQA 870
            ++   TE  S+ E+ + D    +  +  + + V  KE     +I ++   K  +  S   
Sbjct: 923  LKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTV 982

Query: 871  IRAEYQHLHDQLQLEKNSFDTEKASLN---NELDKIMENNSLTEVAKKSLEDDLHDVEMK 927
            ++ +   L+++L+++K  ++ EK +     NEL+++ +     E +K+  ED L  +   
Sbjct: 983  LKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKG---LEQSKRDYEDKLKSLMKD 1039

Query: 928  LEE--------------ERQKHEETNATLSEKELLCEKMIEEISGYREELSK---SA--- 967
            LEE              E Q H   + T+S+       + E+   YR E+++   SA   
Sbjct: 1040 LEEQVKYANKAQNNYEQELQNHANVSKTISQ-------LREQTQHYRTEIAELTISATDA 1092

Query: 968  -----EMQVDIQHTR-ELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDI-- 1019
                 E Q+  Q  R E E  ++   KRI++   QN +L EQ   T    D  N +    
Sbjct: 1093 KRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGV 1152

Query: 1020 ------KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVS-----KGQQWH 1068
                    +++ ++ ERD LQ++L + E E ++LRER   ++ +  A         ++ H
Sbjct: 1153 NSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETH 1212

Query: 1069 NLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQ 1128
            N P  +LL  H+ ++ +L ++ LLRE+N++L  E  +L+  N  L  E+  +     PL+
Sbjct: 1213 NYP--DLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLE 1270

Query: 1129 DQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLE-ANFKNEIDSLKGLI 1187
             +        +EKD+++S+  +E ERWK+R Q ++ +      +E  N   E + L+  +
Sbjct: 1271 TELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQL 1330

Query: 1188 EERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQ-LEEVMKEKDKK 1246
            EE++KE E+L  +F+ LKKQAHEKL+A+KI   +L   +++++A   + L ++  EK+ K
Sbjct: 1331 EEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGK 1390

Query: 1247 I---REIELTLKENLE----KFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVV 1299
            +   + +E+T+K + +    +   +E L+  K F   E K   ++   +++ E LN E+ 
Sbjct: 1391 LSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDF---ETKFINSVESSKQIEENLNSEIK 1447

Query: 1300 SLREEINVLRKK----------------DDET------NQLISTMKLDFEREKDRLIEEK 1337
             L+EE + L+++                D +T      N ++ +MK  FE EK + IEE+
Sbjct: 1448 KLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIEEQ 1507

Query: 1338 VRELNEKFESGRN----EVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKE 1393
              E  +K ++  N    E  +KQ E V+ D        +++++ +++E+ T QRI+EA+E
Sbjct: 1508 TTEFKKKLQAEINKLKAEYETKQIEPVSIDENA-----IRKQIEEEYEQATSQRIKEAEE 1562

Query: 1394 NLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRE 1453
            NLKR IRLP+EEKI ++I+KRR +LE++F  +VE +A  +   D+ +   D +K++++ E
Sbjct: 1563 NLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEE 1622

Query: 1454 LEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLES--QVAKDNESGS 1507
            L    E++LQ     ++ KAF+EG++Q  MKT+ LE+K++KLES  Q AK N   +
Sbjct: 1623 LARKYEEELQV----VKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGAT 1674

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  311 bits (798), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 424/1531 (27%), Positives = 736/1531 (48%), Gaps = 192/1531 (12%)

Query: 192  ELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNT 251
            EL+  V ++L + K   +D +  ++ F  E+ L    N  L+  + E  +  + +    T
Sbjct: 252  ELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHI-EYLKNTTKETTGGT 310

Query: 252  SRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYXXXXXXX--XXXXXXX 309
            S  E  +++ +L+D +K L+ S  E   L  ++ +++ + N E                 
Sbjct: 311  STLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTE-NEESTSDNELVLLKEQLIKE 369

Query: 310  XXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEF 369
              QKDYL+ QVE F+ ELE ++P +                +T L++    E +   KE 
Sbjct: 370  KRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKEL 429

Query: 370  QSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEND 429
             +  R+ +     I  L +QR DLAHQ+QFLLL L  +     LL+ DE  F+R++ ++ 
Sbjct: 430  TTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSR 489

Query: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489
                ++DSQ IISERL+KF DI+ LQKQNM++L T R+LA QLE       +D  ++++ 
Sbjct: 490  NSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLE------SSDTKSVQKI 543

Query: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTGK 549
            T  E+K+ +  LQE  N L  KLE  +KE+D Y                 N  ++  T +
Sbjct: 544  TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQ-----------NTGEQTPTEE 592

Query: 550  LQNELQQTREYLTKEIEKLTR------------TNKDILNKKKE---LEYSMKKMESAKE 594
            L+++LQ+  E LTK +E+++              N+ I+  KKE   L  ++ K  S + 
Sbjct: 593  LRSQLQKKEEQLTK-LERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRA 651

Query: 595  YAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQI 654
             AE K++++E++L +L +     +++ +H + LL+   A+  + +++     ++ ++LQ 
Sbjct: 652  IAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQK 711

Query: 655  RFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNE 714
                 +         ++ T  +L    +EK  L  +   L   +NE   ++  + L + E
Sbjct: 712  EIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSR---LSTVKNE---LEQKINL-MQE 764

Query: 715  RLTEYQLHEQDLLKIIEKQEDQ-------IRDMEVKRAEELNWYQKNFPTQTETEIGLPV 767
            R T Y+ H+    ++++K + Q       ++D E K+  ++NWYQK   + T T   L V
Sbjct: 765  RETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQV 824

Query: 768  DMKKEGETGRQSNRDTLESQKSGSPGFTDL--GTDSSVRKSTSLPVMQVGRTEEESKEAK 825
            ++ KE           L          +DL      +   S+SLP +     + +++  +
Sbjct: 825  ELNKE-----------LTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQDFEKLKNELKE 873

Query: 826  KCDALTDSSQVVGLPENVTKK-EKDLIAQ---IEQLASDKKELKTSLQAIRAEYQHLHDQ 881
            K   +     ++ L E    + +KDL  Q   ++     K++L   L  +  E   ++  
Sbjct: 874  KQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSL 933

Query: 882  LQLEKNSFDTEKASLNNELDKIMEN----NSLTEVAKK--SLEDDLHDVEMKLEEERQKH 935
            LQ +K   + ++  +    DK  E     NSL+ +  K  +LE+++ +     EE+   +
Sbjct: 934  LQKQKAKCEDDQKIIQ---DKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTY 990

Query: 936  EETNATLSEKELLCEKMIEE---------------------ISGYREEL---SKSAEMQV 971
            +E    LSE   L EKM  E                     IS YR++L     + E+QV
Sbjct: 991  KEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQV 1050

Query: 972  DIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKD---IIVCMKR 1028
            D     E ++ +D  N +I     + + +  + + T +  D    +D  D   +I+ ++R
Sbjct: 1051 D-----EFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRR 1105

Query: 1029 ERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTG---HEKILDE 1085
            ERD L  KL I +RE   LRE+   LK+ LD   +  +     +S  +T    H++ + +
Sbjct: 1106 ERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQ 1165

Query: 1086 LKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEI 1145
            L E++ L+E N  L  ++ +   +N I++ +L  ++    PL+D+    +    EKDQ++
Sbjct: 1166 LNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQL 1225

Query: 1146 SLYKDEIERWKKRWQQ-MVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLL 1204
            +L  +E ERWK R ++ ++ RQ   L        E+ +LK  ++ +TK+ E L+++F  L
Sbjct: 1226 TLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRL 1285

Query: 1205 KKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKE---NLEKF 1261
            KKQAHEKLDA K    +L  +++++  +  +LE  + E+ K+I+E+E  LK+   N +  
Sbjct: 1286 KKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVI 1345

Query: 1262 DKDEKLVSEKT--FKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLI 1319
               EK +S+     K+ E  L +T+    +LN+ L +EV SL+ ++  L+ +    N +I
Sbjct: 1346 TALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQ----NGVI 1401

Query: 1320 STMKLDFEREKDRLIEEKVRELNEKFESGRNEVLS--------------------KQSEN 1359
            S        +   +  E +  L E FE  + E+++                    K+ E 
Sbjct: 1402 SVA------DGSAINSETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEEKEKEY 1455

Query: 1360 VTNDNTGS----NVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRR 1415
              +  TG     +++K+K E  +  EE  +QRI +A+ENLK+ IRLPSEEKI R+IEKRR
Sbjct: 1456 YDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRR 1515

Query: 1416 AELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFE 1475
             ELE +++K+++ +      A         +++++R+E+E  +      +L  ++ KAF 
Sbjct: 1516 KELEEEYEKKLKRQGLTTETA---------IEEELRKEVERELRVKFDNELAEVKKKAFL 1566

Query: 1476 EGKRQAEMKTTLLERKLSKLESQVA----KDNESGSK-----VRKSISGLTKIDVNSPQL 1526
            EGK+Q++MKTTLLERKLSKLESQ +     D ES  K       K+  G +KI++    +
Sbjct: 1567 EGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSM 1626

Query: 1527 YKDNTG-----TRTEAVLKL-RPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVH 1580
               +        + E VL++ R + +   G      SNPFT PTQ     N PA L    
Sbjct: 1627 SNTDDSIEKQVPQGEKVLQINRRSLEPSFG-----SSNPFTLPTQ-----NKPAFL---F 1673

Query: 1581 MAPTFSFTPGKSTGTVNKELNKTAQATFGAP 1611
             +   S T  +    +NK      Q T  AP
Sbjct: 1674 ASNNHSQTKKQDGLPINK---SPFQTTLFAP 1701

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  307 bits (787), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 399/1547 (25%), Positives = 744/1547 (48%), Gaps = 200/1547 (12%)

Query: 99   INDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQS 158
            +  + L L+ E   +KSE L  ++E  R  ++  L R +++WLE  L +   E    + +
Sbjct: 167  LRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHT 226

Query: 159  I-LKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQE 217
               ++    Q+++ L  E+                ++ +++ +L  +K+ +D+ ++++QE
Sbjct: 227  TQSQLAALTQKLETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQE 286

Query: 218  FLHEIGLKDRINSSLETQLKEIQQEKSI-----QNEDNTSRAESQKIMEQLIDTRKQLKD 272
            F  E+ LK+R+   LE Q++ ++ +  +     + +D +       + E+L    +QL++
Sbjct: 287  FTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEE 346

Query: 273  SRNEC----------------TRLKSYVNEFINDVNGEYXXXXXXXXXXXXXXXXQKDYL 316
            S  +                 +RLKS  +E+   V   Y                QK++L
Sbjct: 347  SEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKR-QKEHL 405

Query: 317  ETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQSFKRKS 376
            + QVE F+ ELE KVP++                   +++ IS ++ES+  + +  K + 
Sbjct: 406  QNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQI 465

Query: 377  EHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNND 436
               +  I  LT QRSDLA Q+Q+LL+    ++ +   L+ +E  F+RR+ E    +   D
Sbjct: 466  HDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERD 525

Query: 437  SQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKK 496
            +Q +ISERL++F DI ELQ +N D+L T+R+LA +LE +E+  +    T+E   + EAK+
Sbjct: 526  TQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKE 585

Query: 497  ALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKH----TTGK--- 549
            A++ LQE+   LE ++E   KERD Y                 N I +H    + GK   
Sbjct: 586  AIITLQEHAQELESRIEVLTKERDAYKAIQPSTNN-------GNKITEHALANSKGKMSA 638

Query: 550  ----LQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIEN 605
                L+  L   RE   K ++ L    +++L +K +L   ++K  ++K  AE + ++ + 
Sbjct: 639  RVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQG 698

Query: 606  NL-LMLQENRKSVLEQNDHLQQ--LLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQ 662
            +L L  QEN +  L +  H+ Q  LL Q + K  E    L E  S+   L+     + ++
Sbjct: 699  SLKLTKQENEE--LNKRYHIIQDNLLKQ-DTKTQETLSCLIECQSKLATLESELKSSVAK 755

Query: 663  SNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQLH 722
              SL +  +   + + ++  E+N L + + +L+  + E   + A  E    E++   ++ 
Sbjct: 756  IESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVE 815

Query: 723  EQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKKEGETGRQSNRD 782
               L   + +++++  D          WYQ+   +  ET   L V +  + E+  Q+ RD
Sbjct: 816  ASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNET---LKV-VTSQLESQAQTTRD 871

Query: 783  TLESQK-----------SGSPGFTDLGTDSSVRKSTSLPVMQVGRT-----------EEE 820
             LESQK           + +  +  L     V   T    M++ ++           EE 
Sbjct: 872  -LESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEH 930

Query: 821  SKEAKKCD----ALTDS--------SQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSL 868
                K  +    A+T++        S+  G   N+ KKE +L+ Q+E             
Sbjct: 931  RSRYKSAEEALSAITNAFERFKNEHSKDFG---NMKKKEDELVGQVE------------- 974

Query: 869  QAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMEN----NSLTEVAKKSLEDDLHDV 924
             A++ +  +L+++L  +K  FD+EK  L N+L  +       NS+ E  ++ L     D+
Sbjct: 975  -ALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDL 1033

Query: 925  EMK----------LEEERQKHEETNATLSEKELLCEKMIEEISGYREELS--KSAEMQVD 972
              +           E+E Q+H + + T+S+       + EE   Y+ + S  +S+  Q++
Sbjct: 1034 NQQAAFANKAQENYEQELQRHADVSKTISQ-------LREESQKYKNQASVLQSSIEQLE 1086

Query: 973  ----------IQHTRELEDLLDLANKRIDDLCTQNNLLHEQL-----NATLDLEDTQNKD 1017
                      +    E E  L   N+RI+DL  QN LL +QL     +   +L  ++ ++
Sbjct: 1087 KTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQE 1146

Query: 1018 DIKDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELD-AVSKGQQWHNLPLSNLL 1076
             ++++I  ++RERD LQ KL + +R   V   +   ++ EL  A  +      L   N +
Sbjct: 1147 KVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSI 1206

Query: 1077 TG--HEKILDELKEVHLLRENNVSLLTEVNQLKHDNCI-LNDELSQVRKLSGPLQDQKNN 1133
                H K+L++L +++LLRE+N++L +EV Q K   C  L  ++  +++   PL+ +  +
Sbjct: 1207 MADEHNKLLEQLNQLNLLRESNITLRSEV-QKKTQRCQELEGQIDNLQQSLQPLESELAS 1265

Query: 1134 TERYFKEKDQEISLYKDEIERWKKRWQQMVHR-------QDDTLGLEANFKNEIDSLKGL 1186
             +R  + KD +ISL  +E  RWK+R Q ++ +       +   LG       E+   K  
Sbjct: 1266 LKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLG------EELSQAKAE 1319

Query: 1187 IEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIK--ASNLQLEEVMKEKD 1244
            +  +  +  +L ++FQ LKKQA E+LDA K     L+ +L++ +   SN++L ++ KE+D
Sbjct: 1320 LAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMEL-QLRKEQD 1378

Query: 1245 KKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQK----------LNETL 1294
                 +   L+E+L++ + + K  S  T  E E+ L K     +K          + + L
Sbjct: 1379 -----VNKALQESLQRVESEAKADS-TTQPELESALQKLSQAEKKAQDIESDRAQIEKAL 1432

Query: 1295 NQEVVSLREEINVLRKKDDETNQLIST-----------------MKLDFEREKDRLIEEK 1337
              E+  ++     L ++ DE  + + +                 MK D E   + LI EK
Sbjct: 1433 QSELEKVKSHAEELERRLDEARREVESLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEK 1492

Query: 1338 VRELNEKFESGR-NEVLSKQSENVTND-NTGSNVDKLKQELRKDWEEQTLQRIEEAKENL 1395
              E+   +E  R  E  + + E   N  +T  +++ LK++  +D+E++T++RIEE+ E L
Sbjct: 1493 EAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEIL 1552

Query: 1396 KRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELE 1455
            ++ IRLP+EEKI +I+E R++ELE +F+ +++++A+ +A       S  E+ ++ ++E+E
Sbjct: 1553 RKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEME 1612

Query: 1456 HA---IEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQV 1499
                 + +++  ++  +R KAF+EGK+QA MK+  LE+K++KLE+QV
Sbjct: 1613 KLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQV 1659

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  298 bits (764), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 346/1393 (24%), Positives = 692/1393 (49%), Gaps = 122/1393 (8%)

Query: 204  IKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE----KSIQNEDNTSRAESQ-K 258
            +K+ +D+ ++ +QEF  E+ LK R+   LE Q+  ++ E     S Q   + +  ESQ +
Sbjct: 275  VKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKNSPQASTDAATTESQSQ 334

Query: 259  IMEQLIDTRKQLKDSRNECTRLKSYVNEFIN----DVNG-----EYXXXXXXXXXXXXXX 309
            I ++L+   +QL++S  +  +L+  V + ++     ++G     +               
Sbjct: 335  IEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISGSQSLPDLYADIGILKKQVIHE 394

Query: 310  XXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEF 369
              QK++L+ QVE F+ ELE KVP++                   ++D IS +++    + 
Sbjct: 395  RRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADL 454

Query: 370  QSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEND 429
            +  K +    +  I  LT QRSDLA Q+Q+LL+ +  +  ++  LS +ET F++++   +
Sbjct: 455  KRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNME 514

Query: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489
                + D+Q IISERL++F +I ELQ +N D+L TVR+LA QLE +E+  ++    IE  
Sbjct: 515  NTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIEND 574

Query: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTGK 549
            T+ EAK+A++ LQ++   LE +++   +ERD Y                  D++   +  
Sbjct: 575  TITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGG-LRDVNAKASEN 633

Query: 550  LQNELQQTREYLTKE-------IEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAEL 602
               ++++  E L+         ++ L   N+++   K EL  +++K +S++  AE + ++
Sbjct: 634  SDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKI 693

Query: 603  IENNLLML-QEN-----RKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRF 656
             +++LL+  QEN     R  VLE N      L++++ +  E   +L +  SQ   L    
Sbjct: 694  SKSSLLLTKQENEELNKRGLVLENN------LAKQDTRTQETISELIDCKSQLATLSAEL 747

Query: 657  TDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERL 716
             ++ ++ N L T HQ  ++   ++ +E+N L + + +L+  + E   +    +     ++
Sbjct: 748  KNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKI 807

Query: 717  TEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPT------QTETEIGLPVDMK 770
               +     L  ++ ++  ++ D          WYQ+           T +++     M 
Sbjct: 808  DSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMI 867

Query: 771  KEGETGRQSNRDTLESQKSGSPGFTDLG-TDSSVRKSTSLPVMQVGRTEEESKEAKKCDA 829
            +E ++ +      L   ++ S  ++ L  TD  + ++ +L      R+E E       DA
Sbjct: 868  QELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDAL------RSELEKTRINLKDA 921

Query: 830  LTDSSQVVGL----PENVTK-------KEKDLIAQIEQLASDKKELKTSLQAIRAEYQHL 878
             +   +  GL     E +T         ++D   ++E L  ++  L      ++ +  +L
Sbjct: 922  FSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANL 981

Query: 879  HDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAK-------KSLEDDLHDVEM----- 926
            + +L  +KN  +T K   N   +++  N +     K         L +DL+   M     
Sbjct: 982  NSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKA 1041

Query: 927  --KLEEERQKHEETNATLSEKELLCEKM---IEEISGYREELSKSAEMQVDI--QHTREL 979
                E+E Q+H + + T+S+     +K    +  +     EL KS E          +E 
Sbjct: 1042 QENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEY 1101

Query: 980  EDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQN-------KDDIKDIIVCMKRERDT 1032
            E    L+++RI+DL TQN LL +Q++    L+DT +       K + +++I  +KRE D 
Sbjct: 1102 ETQASLSSQRIEDLSTQNRLLFDQIS----LKDTDSIPINDELKSEARELISTLKRECDI 1157

Query: 1033 LQKKLAIVEREGEVLRERCAGLKSELDAVSKGQ----QWHNLPLSNLLTGHEKILDELKE 1088
            LQ KL + +R+   L+++    + EL +V+K +    Q  +   S ++  + KIL++L +
Sbjct: 1158 LQTKLELAKRDESNLKQKLEFTEQEL-SVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQ 1216

Query: 1089 VHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLY 1148
            V+LLRE+N++L  E+ +    N  L   + ++++   PL++     +R    KD++ISL 
Sbjct: 1217 VNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLI 1276

Query: 1149 KDEIERWKKRWQQMVHRQDDTLGLE-ANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQ 1207
             +E+ RWK+R Q ++ + +     E      E+   +       +++ +L ++FQ LKKQ
Sbjct: 1277 TEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQ 1336

Query: 1208 AHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLE------KF 1261
            A E+LD  +    TLN +L+E + S   LE+ + ++ +K R ++ ++K   E        
Sbjct: 1337 ARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSA 1396

Query: 1262 DKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEI-----------NVLRK 1310
             +D+   + +  ++ +A++N+  T   +  +TL +E+   R+ +           N +R 
Sbjct: 1397 TRDQLQDALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRV 1456

Query: 1311 KDDETNQL------ISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDN 1364
             ++  NQ+      I+ +K +     ++L+ EK  E+ EK+E  R E  ++  +++ +  
Sbjct: 1457 LEEAKNQVSGTEAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSE 1516

Query: 1365 T--GSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDF 1422
            +   S+++ LK+E  +++E++T++RIEEA E L++ IRLP+EEKI +IIE R+ EL+ +F
Sbjct: 1517 SLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEF 1576

Query: 1423 DKRVEEKANLIALADKADMSPDELKQKVRRELEHA---IEQDLQAKLETIRTKAFEEGKR 1479
            + +++++ + +A       +  E+ ++ ++E+E     +++++  ++   + KAF+EGK+
Sbjct: 1577 EAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQ 1636

Query: 1480 QAEMKTTLLERKL 1492
            QA MK+  LE+K+
Sbjct: 1637 QASMKSMFLEKKI 1649

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  279 bits (713), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 381/1403 (27%), Positives = 681/1403 (48%), Gaps = 149/1403 (10%)

Query: 312  QKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQS 371
            +K +L+TQ+E+FI ELE K+P+I                +T L+++ S E+ +++ +  +
Sbjct: 378  EKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNN 437

Query: 372  FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEN--D 429
            +  K       I+ L  QR DLA+Q++ LLL +  +  +   L+++E +FI +++ N  D
Sbjct: 438  YDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSED 497

Query: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489
                   SQ +ISERL+ F++I ELQ +NM++L ++R L+  LE  E      H   + K
Sbjct: 498  LNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANS--HKEFQNK 555

Query: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTGK 549
            T+ +AK+A+L LQ + + LE K++    ERD +               + +D+   T+ +
Sbjct: 556  TIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSI-KNDDLSSSTSPE 614

Query: 550  LQNELQQTREYLTKEIEKLTRTNKDILNK--------KKELEYSMKKMESAKEYAEGKAE 601
               +  +  + L +E++   + NKD L          K  L  S++K +S+      K  
Sbjct: 615  TNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKIS 674

Query: 602  LIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQS 661
            L E+   ML+   K + ++ ++LQ ++ ++E+KL ++        ++ + L+ + +  +S
Sbjct: 675  LTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKS 734

Query: 662  QSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQL 721
            + + L     +   EL +  EEKN L++ + +L+  +NE   +    + K   ++ E + 
Sbjct: 735  EKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELEN 794

Query: 722  HEQDLLKIIEKQEDQIRDMEVKRAEELNWYQ------KNFPTQTETEI----GLPVDMKK 771
            +  DL+K +  +  +I+ + +    +  WYQ      K   +  +TE+     L  D+  
Sbjct: 795  NNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNT 854

Query: 772  EGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDALT 831
            + E   +S   T+++    S    D    S + K   +  + +     + +E K+    T
Sbjct: 855  KIEL-LESQSYTIDTNTRCSSSGNDF---SQISKDLDITKLHLSEAYTQVEEYKQLYTST 910

Query: 832  DSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDT 891
            + S +  L  N    +  +  +I +L S+ + LK S          L   L+ EKN +  
Sbjct: 911  EES-LKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSE 969

Query: 892  EKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKLE-------EERQKHE----ETNA 940
            E A LN ++ ++ +    +       E+ +  ++ +LE         ++K+E    + NA
Sbjct: 970  EIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNA 1029

Query: 941  TLSEKELL---CEKMIEEISGYREELSKSAEMQVD---IQHTRELEDLLDL--ANKRIDD 992
             L   E      EK+ + I     +L K   +  +   +   ++   + DL  + K+ID+
Sbjct: 1030 NLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDN 1089

Query: 993  LCTQNNLLHEQLNATLDLEDTQNKD-----------DIKDIIVCMKRERDTLQKKLAIVE 1041
            L  QN L  +QL       +  NKD           + K +   ++ +RD L+ KL+I E
Sbjct: 1090 LTNQNKLYVDQL-------ELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAE 1142

Query: 1042 REG-------EVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDELKEVHLLRE 1094
            R+        E LR+  A ++ +L +       H    S+L+  HEKI+ EL ++ L +E
Sbjct: 1143 RDSKNNASKLESLRDELANVQMKLISSENKLLRH----SDLIENHEKIVSELNQITLFKE 1198

Query: 1095 NNVSLLTEVNQLKHDN----CILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKD 1150
            +N +L  +V++L   N      LN+E S++  LS  L+  K        +K+ +I L K+
Sbjct: 1199 SNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVK----ESLGDKETDIMLIKE 1254

Query: 1151 EIERWKKRWQQMVHRQDDTLGLEA--NFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQA 1208
            E  +W+ R +++   Q D + L++      E+D+LK   E + K+  +L E+F LLKKQA
Sbjct: 1255 ESNKWRLRAEEL-SVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQA 1313

Query: 1209 HEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLV 1268
            HE+L+A+K    +LN  ++E+KASN  +E  +  + KK  +++ TL       D + K  
Sbjct: 1314 HERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLS------DNEVKYT 1367

Query: 1269 SEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKK----------------D 1312
             + +  E+E K  KT     KL+    +E + L +E++ L+K                 D
Sbjct: 1368 QKLSNIESELKALKTENNSFKLSS--EKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTD 1425

Query: 1313 DETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDK- 1371
               N +I +MK +FE EK +L+E+K  EL  +++  ++++L K+ E    D   +  D+ 
Sbjct: 1426 STMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLL-KEYEEKIEDLQSARTDQS 1484

Query: 1372 --------LKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFD 1423
                    LK+E  +++E+ TL+RIEEAKE LK+ IRLPSE KI R+IEKR+ ELE++++
Sbjct: 1485 IKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYE 1544

Query: 1424 KRVEEKANLIALADKA--DMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQA 1481
             +++EK N I     +   + P +L+++++ E++  +    +  L   + K+FEEGK+Q+
Sbjct: 1545 VKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQS 1604

Query: 1482 EMKTTLLERKLSKLESQV--AKDNESGSKVRKSISGL----TKIDVNSPQLYKD------ 1529
             MKTTLLERK+SKLESQ+  A +N+  S     IS L    T   +  P   K       
Sbjct: 1605 SMKTTLLERKISKLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGG 1664

Query: 1530 -NTGTRTEA--VLKLRPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHMAPTFS 1586
             NT     A             S KD     NPF+    +   S+SP     +H  P   
Sbjct: 1665 FNTTNSLNANKGFSSSSNNTSQSSKDTEIVQNPFSLGVSQ--TSSSP-----MHFNP--- 1714

Query: 1587 FTPGKSTGTVNKELNKTAQATFG 1609
            F+   +T  V  + N T++  FG
Sbjct: 1715 FSSSATTSNVFNQ-NGTSKNIFG 1736

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  265 bits (676), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 244/788 (30%), Positives = 427/788 (54%), Gaps = 108/788 (13%)

Query: 869  QAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL 928
            + I+ E+Q + D+L  EK + + +  SL++  +KI E     +   + +E +L     K+
Sbjct: 841  KGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNL-----KI 895

Query: 929  EEERQKHEETNATLSEKELLC-----EKMIEEISGYREE---LSKSAEMQVDIQHTRE-L 979
            + + + + E+  T  EKEL       E++  EI+    +   L++ AE +  +   R+ L
Sbjct: 896  QSDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSL 955

Query: 980  EDLLDLANKRIDDLCTQNNLLHEQLNATLDLE-DTQNKDDIKDIIVCMKRERDTLQKKLA 1038
               L LAN+RI+ L  QN++L++  +    ++ D +  +D++++++ ++ ERD  Q +  
Sbjct: 956  GQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQET 1015

Query: 1039 IVEREGEVLR-------ERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDELKEVHL 1091
              +R+ ++L+       E+ A    E+D  +  ++       +L   HEKI+ EL+ +  
Sbjct: 1016 TAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDD----FSLTVTHEKIMRELEGLTN 1071

Query: 1092 LRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDE 1151
             +E N+ L   +  L  D   L +E+S++R+ S  L  +KN++    +E  Q+I  Y+ E
Sbjct: 1072 TKEENLYLDESIKSLNEDKRTLQEEVSRLRE-SEELA-KKNSSAISEQEWQQKIETYQQE 1129

Query: 1152 IERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEK 1211
             E+WK   QQM    ++T     N + ++++ K  I+ +T+E + L+++F  LKKQAHEK
Sbjct: 1130 SEKWKLMCQQM---SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEK 1186

Query: 1212 LDANKIHIQTLNNDLSEIKASNLQLEE--------------------VMKEKDKKIREIE 1251
            L+A+K    +L  +LSE+K  N  L+E                     +KE++K+ + +E
Sbjct: 1187 LNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLE 1246

Query: 1252 LTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKK 1311
            L L+ ++   D  EKL+         A + K +T L++           ++  +NV    
Sbjct: 1247 LELRHSV---DSSEKLI---------ADMTKELTTLKE---------NPIQGSVNV---- 1281

Query: 1312 DDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDK 1371
            +D T++L   +K +FE EK  LIE+   EL E+FE  + E++          N  +N+++
Sbjct: 1282 EDYTHRL-EQLKSEFEDEKRVLIEKTTSELTERFEREKKELM----------NNNANLEE 1330

Query: 1372 LKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKAN 1431
            L++ L ++WE +TLQRIEEAKENLK+HIRLP+EEKI+R+I KR+A+LE  F  +V E+AN
Sbjct: 1331 LRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQAN 1390

Query: 1432 LIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERK 1491
            L+ L++ ++ + DEL+++VR E++  +E+D     E ++ KAFEEG++QA MKTTLLERK
Sbjct: 1391 LLKLSELSNKTADELEKEVREEIKTRLEED----FELLKKKAFEEGRQQASMKTTLLERK 1446

Query: 1492 LSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRT-EAVLKLRPTAKVDSG 1550
            ++KLE+++    + G+   KS +GL KI+++SP +     G  T E VL  +P A   +G
Sbjct: 1447 IAKLEARL----QGGTGPLKSANGLNKINIDSPLMV---AGPLTNEPVLDEKPNAF--AG 1497

Query: 1551 KDVSNDSNPFTSPTQELSKSNS------PAALPIVHMA-PTFSFTPGKSTGTVNKELNKT 1603
               +  S P ++  ++ + + S      PA       A P FSF     T   +     +
Sbjct: 1498 ATTTTISQPTSTTAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNS 1557

Query: 1604 AQATFGAP 1611
              A  G P
Sbjct: 1558 VGAASGTP 1565

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  202 bits (515), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 394/1604 (24%), Positives = 740/1604 (46%), Gaps = 233/1604 (14%)

Query: 92   NATSISNINDE--------ILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEE 143
            N  S+ N+ D+        ++ ++  L+  KS  +  Q + +  +++ EL+ ++ +W EE
Sbjct: 134  NVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQEKELMLQNKKWTEE 193

Query: 144  HLV----KTTEELMTQKQSILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQE 199
             L     KT  +  T+   I  +EEK  +    R                 ++LS +V+E
Sbjct: 194  KLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESA---LSYSQLLLDQNKQLSHSVEE 250

Query: 200  KLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSI----QNEDNTSR-A 254
            K++EIK   D    ++ EF  E+ L+  +N  L +QL   +++ S     +++DN  +  
Sbjct: 251  KILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDP 310

Query: 255  ESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFIN------DVNG------EYXXXXXXX 302
            +   + ++L++T+ Q + S++EC RL++ +++F+       D NG      +        
Sbjct: 311  DHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVL 370

Query: 303  XXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIER 362
                     QK  L+ Q+E+FI ELE K P +                 T L++ IS+ +
Sbjct: 371  RKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAK 430

Query: 363  ESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFI 422
               E+E  S ++K    +  I  L  QR DLA Q++ LLL       T   LSKD+   +
Sbjct: 431  RKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISL 490

Query: 423  RRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQAD 482
            R++ E+ +    ND+Q+IISERL++F +I ELQ++N+++L  +R LA +LE  E  +   
Sbjct: 491  RKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTT 550

Query: 483  HHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDI 542
               +E++T++EAK A+++L+     +E ++    +ERD Y                 N++
Sbjct: 551  LAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKE---------NNV 601

Query: 543  DKHTTGKLQNELQQTREYLTKEIE-KLTRTNKD----ILNKKKELEYSMKKMESAKEYAE 597
            + +     +N  + + E   KE+E +L+ T  +    I N +KEL  + KK+   K+ A 
Sbjct: 602  NVNA----KNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKEL-TTYKKLLCDKKIAS 656

Query: 598  GKAELIENNLLMLQENRKSVLEQN-DHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRF 656
               E    N  ML + ++S+LE   ++L+  L +++  +    QD +++     LLQ R 
Sbjct: 657  QDFE----NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQD-NKVRDSTELLQSR- 710

Query: 657  TDTQ-----------SQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNE----- 700
            T T+             +NS+  +   T ++L    +EK  L++K+ E EIS NE     
Sbjct: 711  TKTEILMHEISSLKKETANSMVLKESLT-RDLERCCKEKIQLQMKLKESEISLNEQKVNF 769

Query: 701  -CKGIQATVELK-LNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQ 758
              KGI+    +K L E L   ++        ++ +  +I+ ++  +  +L W Q      
Sbjct: 770  DSKGIKYDARIKQLEESLERLRIE-------LKSKAQEIKSLQSSKDSQLKWAQNTIDDT 822

Query: 759  TETEIGLPVDMKKEGET-----GRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVM- 812
             E    +  ++ ++ +T      +  N D    +      F +  +D+    ST  P + 
Sbjct: 823  EEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDA----STLQPALR 878

Query: 813  -QVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAI 871
             ++ +T+ E K+A         SQV    E ++  EK L           KEL + L ++
Sbjct: 879  KELEQTQLELKDA--------HSQVRTYEEIISTNEKAL-----------KELNSQLASM 919

Query: 872  RAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKLEEE 931
            + +Y    +    EK + + E + L  ELD+I           +SL+  L +  + L ++
Sbjct: 920  KEDYDARIELECKEKLANEEELSLLRRELDEI-----------RSLQPKLKEGTVCLVKQ 968

Query: 932  RQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQVDIQHTRELEDLLDLANKRID 991
             +K       + E +   +KM   +  Y++E  K+++ Q  ++  +EL +L+    K   
Sbjct: 969  SEKLRNQAEKIQEMKAKIDKMNWNVQVYKKE--KTSQFQSIMKANKELSELVTRLEKEAT 1026

Query: 992  DLCTQNNLLHEQLNATLDLEDTQNKDDIKDIIVCMKRERDTLQKKLAIVEREGEVLRERC 1051
            D   +   L   L+ T DL DT  K         M+ + D  ++ ++ +E + E LR   
Sbjct: 1027 DSQMELKKLKSSLHKTQDLLDTHEKK-------WMEEKADYERELISNIE-QTESLRVEN 1078

Query: 1052 AGLKSELDAVSKGQQWHN--LPLSNLLTG--HE------KILDELKEVHLLRENNVSLLT 1101
            + L  ++ +V++G   +   L L +  +   HE      K+    +++ L+++ N SL  
Sbjct: 1079 SVLIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEK 1138

Query: 1102 EVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTER------YFKEKDQEI--SLYKDEIE 1153
             +N L+ D      EL    + S  + D+ N+  +        KE +  +  SL K+  E
Sbjct: 1139 NINDLQIDQPASQTEL----QCSAVIIDEFNDITKEIAQVNLLKENNAILQKSL-KNVTE 1193

Query: 1154 RWKKRWQQMVHRQDDTLGLEANF-----KNEIDSLKGLIEERTKEKEKLSEKFQLLKKQA 1208
            + ++ ++++  RQ++   L+++      +  +++ K LI E   E ++  +++  L  Q 
Sbjct: 1194 KNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYE--SEMDQCKQRYHDLSTQQ 1251

Query: 1209 HEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDE--- 1265
             E     K  I+ LN+++S+ KA  L  E    E + K   ++    E L+   K +   
Sbjct: 1252 RE---VQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTAL 1308

Query: 1266 -------KLVSEKTFKENEAKLNKTITM--------LQKLNETLNQEVVS---LREEINV 1307
                   K V +K  ++  +K  KT+ +        +Q  +   +QE V+   L EEI  
Sbjct: 1309 TNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIES 1368

Query: 1308 LR------KKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVT 1361
            L+      K  + ++     ++ + E EK+++I E+ +E  +K E    E++SK      
Sbjct: 1369 LKRELQVFKNANNSSDAFEKLRDNMEEEKNKIINERTKEFEKKLE----EIVSKSKSTGK 1424

Query: 1362 NDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESD 1421
              +   N++ LK+E  K++EE+T++RI EA+ENLK+ IRLPSEE+IQ+II KR+ ELE +
Sbjct: 1425 VADNSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEE 1484

Query: 1422 FDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDL---QAKLETIRTKAFEEGK 1478
            F ++++E A+ +        S D      R+E     ++DL    +K  + R     +  
Sbjct: 1485 FQRKLKENASSLTF------SCD------RKETNDDPDEDLWNSPSKGNSERPSVITDFM 1532

Query: 1479 RQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAV 1538
            +Q  +K   ++ +L K ++ V   +   S + K  S L K++        D+    T + 
Sbjct: 1533 KQKNIK---VQEQLKKAKNGVFFGDSRSSSMNKENSALVKVN--------DDKAASTFSF 1581

Query: 1539 LK-LRPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHM 1581
             K L P+    +     +  NPFT  T +   SN+  +LP  ++
Sbjct: 1582 GKPLFPS----TTTSFQSFQNPFTQSTID---SNTGVSLPTFNI 1618

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  184 bits (466), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 334/1380 (24%), Positives = 623/1380 (45%), Gaps = 171/1380 (12%)

Query: 313  KDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQSF 372
            K  LE QV  F+TELE   P+I                +   ++ ++ ++E++ +E + +
Sbjct: 306  KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQY 365

Query: 373  KRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYA 432
            K++ E   G  + L  +R DLA Q+Q+LLL  G    ++  L+  E  +I+ +   D   
Sbjct: 366  KKQLEQISGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEFSYIKEILNTDPEE 424

Query: 433  RNN---DSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQE-KLRQADHHTIER 488
             N    DSQ IIS+R+LKF  I ELQ+QN+++L+ VR L+ + E  E KL   D  +IE 
Sbjct: 425  GNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGD--SIE- 481

Query: 489  KTLEEAKKALLDLQEYTNSLERKLETF--RKERDVYXXXXXXXXXXXXXXXECNDI---- 542
              + EAK+ LLDLQ+Y +SLE K+E+   + + + +               + N+I    
Sbjct: 482  -AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALK 540

Query: 543  ---------DKHTTGKLQ---NELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKME 590
                        T G L    N LQQ++  L KE E L       +N K  +E  +K   
Sbjct: 541  NKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESL-------INSKHLIEDRLK--- 590

Query: 591  SAKEYAEGKAELIENNLLMLQENRKSVLEQN-DHLQQLLSQKEAKLAELTQDLHELTSQY 649
                        I  ++L L +N  S L     +  Q L ++E + ++  +   +  ++ 
Sbjct: 591  ------------ITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKL 638

Query: 650  NLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELE-ISRNECKGIQATV 708
            +++Q +  +T  + + L+    + + +L + ++E+N  +  I +L  + +N+ + ++  +
Sbjct: 639  DVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLK-DI 697

Query: 709  ELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVD 768
            ++ L  ++ + +L   +L   I+ +E            EL WYQ  F + + +   L   
Sbjct: 698  QVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEK 757

Query: 769  MKKEGETGRQSNRDT------LESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESK 822
            M +   T       T      L+   S +       T   V K T       G  E E  
Sbjct: 758  MIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLT-------GALETELA 810

Query: 823  EAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQL 882
             ++    LTD+S+ + +  N  ++ +   ++I+ L   + EL+   + +R E   L D+L
Sbjct: 811  TSRT--RLTDTSRELEISSNTIRQYQ---SEIKVLNERQSELENENKHLRDEIAILRDEL 865

Query: 883  QLEKNSFDTEKASLNNELDKI-MENNSLTEVAKKSLEDDLHDVE-MKLEEERQKHEETNA 940
                  F+ EK +L  +L  + +    LT++     ED   ++E +KL+ ++Q       
Sbjct: 866  THNGGEFEREKEALMKKLSNLEIRQAELTKLE----EDYTAEIEKLKLDLDKQAMLGKEI 921

Query: 941  TLSEKELLCEKMIEEISGYREELS--KSAEMQVDIQHTRELEDLLDLAN-------KRID 991
             L+  E + E        YR EL   +  + +V ++  +ELE  + + N       +R+ 
Sbjct: 922  KLAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEKELESRIKILNEQIELDKERMK 981

Query: 992  DLCTQNNLLHEQLN-----ATLDLEDTQNKDDIKDIIVCMKRERDTLQKKLAIVEREGEV 1046
                + +LL EQ+         DL D     +  D++  +  E+  L+ KL   + E   
Sbjct: 982  QFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNR 1041

Query: 1047 LRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDE-LKEVHLLRENNVSLLTEVNQ 1105
            LRE+    +SE+  ++   +     ++  +       +E + ++  L+E+N+SL  EV  
Sbjct: 1042 LREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKL 1101

Query: 1106 LKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVH- 1164
             +  N  +  EL++++     ++ Q +        KD ++   + E  R K     M   
Sbjct: 1102 AQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQN 1161

Query: 1165 -RQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLN 1223
              +D +  L    ++ + +L   ++       +L ++F  LK+QA E+LDA+K+ I +L 
Sbjct: 1162 GNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLR 1221

Query: 1224 NDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLVSEKTF-----KENEA 1278
            +++  +      L++V++    ++ E+   ++E++E     ++L +E        K+ EA
Sbjct: 1222 DNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEA 1281

Query: 1279 KLNKTITMLQKLNETLNQEVVSLREEINVLR-------KKDDETNQLISTMKLDFEREK- 1330
            +LN+T     +L   LN+E+ SL+ E+  L+       + ++E + ++ +M+  FE EK 
Sbjct: 1282 ELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDEKI 1341

Query: 1331 -----------DRLIEEKV---RELNEKFESGRNEVLSKQS----ENVTNDNTGSNVDKL 1372
                        RL EE+    RE+ E  E  ++ ++ +++    EN       S+V  +
Sbjct: 1342 AFMKATSEDSEARLAEERGKLKREM-EALEKEKDSLVMEKTRLGEENTALMKARSDVPDI 1400

Query: 1373 KQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEK-AN 1431
             + L+K WE    +R           + L  +EK  +++  +  ELE  F  RV  K   
Sbjct: 1401 -ETLQKQWEASNKER-----------LVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKE 1448

Query: 1432 LIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERK 1491
            L AL D               E+E   +   +  L  ++ +AFEEGK+QA MK ++LERK
Sbjct: 1449 LNALKD---------------EIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERK 1493

Query: 1492 LSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGK 1551
            ++KLE++        SK  KS S ++ +  ++P+    N     +A      TA   SG 
Sbjct: 1494 IAKLEAE--------SKATKSGSDMS-VSEDAPRFVTPNNNKVQQANQPFLATA--GSGF 1542

Query: 1552 DV-SNDSNPFTSPTQELSKSNSPAALPIVHMAPTF---SFTPGKSTGTVNKELNKTAQAT 1607
             V S++SNPFT+P    +   + ++      APTF   S  P   +G+ +++ N T + T
Sbjct: 1543 SVQSSESNPFTTPVSRGAAHTNASSQS--KFAPTFLLNSQPPVLVSGSSDED-NDTMRGT 1599

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  182 bits (463), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 179/666 (26%), Positives = 339/666 (50%), Gaps = 67/666 (10%)

Query: 41  EKLNLKSTIEETE-------STYKNKIKNLEDEINILAKTRDISGPIRITGVEAQAPNNA 93
           E L L+S +EE +       S  ++  K LE++I+ LA +++ S  +        A N  
Sbjct: 113 EVLKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLL-------AANKE 165

Query: 94  TSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELM 153
              S+I+ E +     ++  KS+ L  +SE +R  ++  LV+ +  WL + L    E+L 
Sbjct: 166 LRKSSIDLEFI-----IQGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLN 220

Query: 154 T-QKQSILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYS 212
           + ++++  +++   +++++L+ ++               ELS  +QEKL+E K+ +D  +
Sbjct: 221 SFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLN 280

Query: 213 TKQQEFLHEIGLKDRINSSLETQLKEIQQ--EKSIQ--NEDNTSRAESQKIMEQLIDTRK 268
           T+++EF  E+ LK R+   LE+Q+  ++   E + Q  N++  S  E  +++++LIDT+K
Sbjct: 281 TEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKK 340

Query: 269 QLKDSRNECTRLKSYVNEFINDVNGEYXXXXXXXXXXXXX-------------------- 308
            L+ ++ E  +L++ VNE ++ VNG+                                  
Sbjct: 341 NLEATQAENIKLEATVNELLS-VNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKK 399

Query: 309 ----XXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERES 364
                  QK+ L+ QVE+F+ ELE K+P++                VT L++  + +R+ 
Sbjct: 400 QLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQ 459

Query: 365 LEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRR 424
              E   +K K  + +  + +L  QRSDLAHQ+Q+LL+ L  +   +  L++ E +F++R
Sbjct: 460 KTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKR 519

Query: 425 LTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHH 484
           +  ++  A  +D+Q IISERL++F  + ELQ +N ++L T+R LA +LE++EK  +    
Sbjct: 520 IISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLK 579

Query: 485 TIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXX---XXXXXXXECND 541
           ++E +T++EAK+A+L LQE+   LE +L+   KERD +                  +   
Sbjct: 580 SVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKK 639

Query: 542 IDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAE 601
           +D+H   +L+  L+   E     I+ L    K +   K E+   +++  S+K  AE + +
Sbjct: 640 LDEHIM-ELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLK 698

Query: 602 LIENNLLMLQENRKSVLEQNDHLQQLLSQKEAK--------------LAELTQDLHELTS 647
           LI++ L + +E    + +++D LQ++L +++ K              L+ LT  L  LTS
Sbjct: 699 LIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTS 758

Query: 648 QYNLLQ 653
           + + L+
Sbjct: 759 ERDFLR 764

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  171 bits (433), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 187/624 (29%), Positives = 321/624 (51%), Gaps = 94/624 (15%)

Query: 976  TRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKDIIVCMKRERDTLQK 1035
            T+ELED       R+ +L TQN LL E+L  + +LE       + DI V ++ ERDTL  
Sbjct: 725  TKELED----TKVRVQNLATQNRLLLEKLERSANLE-------VDDIFVSLRYERDTLSD 773

Query: 1036 KLAIVEREGEVLRERCAGLKSELDAV-SKGQQWHNLPLSNLLTGHEK-------ILDELK 1087
            ++   E++ +V+      ++SEL+A  S+   + N     ++  H+K       ++++L 
Sbjct: 774  QVVNYEKDMQVILADLESVQSELNAANSQILNFENQRA--MVQDHKKGNVNEETLIEKLT 831

Query: 1088 EVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISL 1147
            E+  L+E N+ L  E++ L  +N  L  +L +  +   PL+ + +      ++KD  I++
Sbjct: 832  ELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINV 891

Query: 1148 YKDEIERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQ 1207
              ++ E WK R+ ++      TL  + N   ++ +L+  +EE++KE E+LS++F  LKKQ
Sbjct: 892  SNEKAENWKTRFNEL------TLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQ 945

Query: 1208 AHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKL 1267
            A+E+L A+K+    L    +E+KA N  LE  + E+ ++ +E+E ++        KD++L
Sbjct: 946  ANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISL------KDQEL 999

Query: 1268 VSEKTFKENEAK-LNKTITMLQKLNETLNQE---VVSLREEINVLRKKDDETNQLISTMK 1323
             S    KE  A  L+K+    ++L +T+++    V  L+ EI  L +K       +   +
Sbjct: 1000 GSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQE 1059

Query: 1324 LDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQ 1383
             + E  K  LI     EL EK    ++E+  K  E +             + L+ ++E  
Sbjct: 1060 SEIENAKKILI----AELEEKLNKTKSELDLKHKEEL-------------KVLKTEYEGD 1102

Query: 1384 TLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSP 1443
              +R+ EA+E LKR IRLPSEEKI  IIE + A+LE D+ K++E  +     A+  D+  
Sbjct: 1103 IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVS-----AESTDI-- 1155

Query: 1444 DELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDN 1503
                +K+++E E          L   + KAFEEGK+QA MKT  LE K++KLESQ+ ++N
Sbjct: 1156 ----EKIKQEFED--------NLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQL-QNN 1202

Query: 1504 ESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSP 1563
            ES    +++    T  + ++P+L K       +      P            +SNPFT+ 
Sbjct: 1203 ESDVTDKEAEVKTTDNEKSNPELDK----QEAKPSFTFSPPP----------NSNPFTT- 1247

Query: 1564 TQELSKSNSPAALPIVHMAPTFSF 1587
            TQ+   ++SP +  +  + PTFS 
Sbjct: 1248 TQD---TDSPVS--VFGIKPTFSL 1266

 Score =  115 bits (287), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 227/469 (48%), Gaps = 23/469 (4%)

Query: 312 QKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQS 371
           Q + L++ ++N++ ELE ++P+I                   +++ +  +++   K   S
Sbjct: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269

Query: 372 FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTY 431
            K+        I+ L  QR+DLAHQ+Q+LL+    Q   N  LSK E  F++ L   D  
Sbjct: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329

Query: 432 ARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTL 491
             ++D QS+IS+RL+KF DI  LQ++NM++  ++R+LA  LE +E   +      +  T+
Sbjct: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTI 389

Query: 492 EEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHT--TGK 549
            EAK+ +L LQEY N L+ ++ T + +                   E    + H+     
Sbjct: 390 NEAKETILSLQEYNNVLKLEIGTLQSK-----ISELQSSIPNSKESEKQHFNYHSNLVKD 444

Query: 550 LQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLM 609
           L+++L +   Y    IE L +  +++ N++ ++  +++K +S+   A  K  L++N+  +
Sbjct: 445 LESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDL 504

Query: 610 LQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQI--RFTDTQSQSNSLR 667
           L    + +  +N  L+Q L+++E  L  +  D   +  + NLL    R T   +    L 
Sbjct: 505 LTLENEELSSKNSMLEQQLNEEEKNLNSVLNDY--IKCKTNLLDFTNRLTLLNNNKLGLE 562

Query: 668 TQHQTTQKELFEVVEEKNALKVKIHELEIS-RNECKGIQATV-ELKLNERLTEYQLHEQD 725
            ++ + ++E+    E+   L  K   LE S  NE       V EL+LN      +L+EQ 
Sbjct: 563 EENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNIS----KLNEQK 618

Query: 726 LL--KIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTET----EIGLPVD 768
           L+  + ++ +  +I D+     ++++WYQK      +T    E  LP D
Sbjct: 619 LILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPAD 667

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  169 bits (429), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 162/492 (32%), Positives = 273/492 (55%), Gaps = 37/492 (7%)

Query: 1080 EKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFK 1139
            E++++   ++  L E+N  L+ EV      N  L+ +L+ ++    PL+ + N  +    
Sbjct: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119

Query: 1140 EKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEANFKN--EIDSLKGLIEERTKEKEKL 1197
            EK+Q +++ ++E+ERWK R Q ++ +Q   +  EA+ K+  +I +L+  +E    E  +L
Sbjct: 1120 EKEQHLNICQEELERWKLRSQTIL-QQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQL 1178

Query: 1198 SEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKEN 1257
            +++F  LKKQAHEKLDA K     L   ++E+  + + LE+ +++      EIE   +  
Sbjct: 1179 TDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ------EIEKNNQSG 1232

Query: 1258 LEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNET--LNQEVVSLREEINVLRKKDDET 1315
                D+ E+++  +   E E   N +  + +K+ +      E+ SL+ E+  ++  ++ T
Sbjct: 1233 NGAADESEEIIRLRA--ELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENST 1290

Query: 1316 --NQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENV-TNDNTGSNVDKL 1372
              +++I  +K  F+REKD LIE+  +E   K E  +  +L+++  N+  N    +N+++L
Sbjct: 1291 VNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEEL 1350

Query: 1373 KQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANL 1432
            K++  ++ E   L+RI EA+ENLK+ +RLPSEEKI  +IEKRR  LE +F+ ++ E   L
Sbjct: 1351 KKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE---L 1407

Query: 1433 IALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKL 1492
               AD   +  D      R ++E  + +    +L  I+ KAFEEGK+Q+ MK+TLLERKL
Sbjct: 1408 GLNADGNGVVTD-----TRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKL 1462

Query: 1493 SKLESQV---AKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDS 1549
            SKLESQ     K+N+S      S   L+ I+ +SP L         E VL+L   A V +
Sbjct: 1463 SKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPL--------GEKVLQLNYGANVVA 1514

Query: 1550 GKDVSNDSNPFT 1561
              D  ND NPFT
Sbjct: 1515 ETD--NDDNPFT 1524

 Score =  149 bits (377), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 180/342 (52%), Gaps = 21/342 (6%)

Query: 193 LSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNTS 252
           LS ++Q KL  IK   D+ ++ +QEF  EI LK R+N  L  ++   +++       N  
Sbjct: 255 LSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLE 314

Query: 253 RAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFIN-------DVNGEYXXXXXXXXXX 305
             E +KI+++L+D +++L +S  EC  LKS V+++IN          G            
Sbjct: 315 TPE-KKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQ 373

Query: 306 XXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESL 365
                  KD L+ QVE+F+ ELE K+P+I                +TS ++  + ER+  
Sbjct: 374 LVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIK 433

Query: 366 EKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRL 425
           ++E  + ++K  +N+     L  QRSDLAHQ+Q+LLL +  ++      ++ E   ++++
Sbjct: 434 DRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSP----FTEKEATLVKKI 489

Query: 426 TENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEK-----LRQ 480
             N+    + DS  IIS+RLL F ++ ELQ++NM++L T R L   LE QE+     LR 
Sbjct: 490 VSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRI 549

Query: 481 ADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVY 522
            D++ I    +E AK   +DL+++  +LE K+    +ERD Y
Sbjct: 550 TDNNKI----VESAKSTSVDLEKHIKTLESKINIISQERDSY 587

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
           MLP2Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved in the Tel1p pathway that
           controls telomere length
          Length = 1679

 Score =  155 bits (391), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 144/520 (27%), Positives = 269/520 (51%), Gaps = 37/520 (7%)

Query: 37  NLIKEKLN-LKSTIEETESTYKNKIKNLEDEINILAKT-RDISGPIRITG----VEAQAP 90
           N  KE+LN LK  + E  S Y+ +I  L+ ++++  +  R+++   R+       +++  
Sbjct: 74  NTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEEYDIWQSRDQ 133

Query: 91  NNATSISNINDEILTLQREL-------ERAKSEHLISQSEAERSLKQSELVREHNQWLEE 143
            N +   ++N E   L+R+L       +R KS  +  Q + + S+++ EL+ +  + +EE
Sbjct: 134 GNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEE 193

Query: 144 HLV----KTTEELMTQKQSILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQE 199
            L     KT  E +T+   +  +EEK  ++ +    V              ++LS++V+E
Sbjct: 194 KLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESV---FTYNKFLLNQNKQLSQSVEE 250

Query: 200 KLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSI----QNEDNTSR-A 254
           K++E+K   D  S ++ EF  E+ L+  +N  L +QL  ++++ S+    +N+DN+ R  
Sbjct: 251 KVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNP 310

Query: 255 ESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEF------------INDVNGEYXXXXXXX 302
           E   ++++LIDT+ +L+ S+NEC RL++ V +             ++   G+        
Sbjct: 311 EHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVL 370

Query: 303 XXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIER 362
                    QK  L+ Q+E+FI ELE K P +                 T L++ +S+ +
Sbjct: 371 KRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTK 430

Query: 363 ESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFI 422
              E+E  S ++K    +  I +L  QR DLA Q++ LLL       T + LS+DE   +
Sbjct: 431 RKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISL 490

Query: 423 RRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQAD 482
           R++ E+      NDSQ+II+ERL++F+++ ELQ++N+++L  +R LA +LE  E  +   
Sbjct: 491 RKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKT 550

Query: 483 HHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVY 522
              +E +T++EAK A+++L+     +E ++    +ERD Y
Sbjct: 551 LQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSY 590

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score =  152 bits (383), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 126/462 (27%), Positives = 231/462 (50%), Gaps = 30/462 (6%)

Query: 86  EAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHL 145
           EAQ  N       +  +++  + EL+  ++  L S+SE  R  ++  L+RE+N WL   L
Sbjct: 150 EAQGANK-----ELRQKVVNTETELQTQQALELRSKSEILRMEQEITLLRENNDWLTNQL 204

Query: 146 VKTTEELMTQKQS-ILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEI 204
              T +L   ++S I ++++   ++ N+  E+ I              L E +++KL E 
Sbjct: 205 NTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSEN 264

Query: 205 KQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE--KSIQNEDNTSRAESQK--IM 260
           K+  D+Y+  +QE   E+ LK R+  +LE  ++ +++E   +  N D++   E ++  ++
Sbjct: 265 KEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELI 324

Query: 261 EQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYXXXXXXXXXXXXXXX---------- 310
           E+L   + +L  S + C +LK  ++E  +++  E                          
Sbjct: 325 EELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLG 384

Query: 311 ----------XQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISI 360
                      QKD L+ QVE F+ ELE K+PV+                VT L++    
Sbjct: 385 MLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGK 444

Query: 361 ERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETD 420
           +R+    +    K   +  +  I +L+ QR DLAHQIQ+LL+    ++     LS +E  
Sbjct: 445 DRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQ 504

Query: 421 FIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQ 480
           F++ LT +    + +D+Q II++RL++F  + ELQ++N ++L+T+R+LA +LE +E   +
Sbjct: 505 FVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENK 564

Query: 481 ADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVY 522
           +    +E +T+ EAK+ +L L ++  +LE +L    KERD Y
Sbjct: 565 SQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAY 606

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score =  149 bits (376), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 123/442 (27%), Positives = 223/442 (50%), Gaps = 25/442 (5%)

Query: 103 ILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLV----KTTEELMTQKQS 158
           +L ++  L+  KS  L  + + +  +++ EL+ E+ +W+EE L     KT  + +T+   
Sbjct: 153 LLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSH 212

Query: 159 ILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQEF 218
           +  +EE+     N    VS             ++LS ++++K++EIK   D  + ++ +F
Sbjct: 213 VQNLEEQLNRTQNDYESVSTNNQFLLAQN---KQLSHSMEQKILEIKNLKDTVNIEKADF 269

Query: 219 LHEIGLKDRINSSLETQLKEIQQEKSIQ-----NEDNTSRAESQKIMEQLIDTRKQLKDS 273
             E+ L+  +N  L +QL   ++  S+      N+D    ++   ++++LIDT+ QL+ S
Sbjct: 270 SKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKS 329

Query: 274 RNECTRLKSYVNEFINDVNGEYXXXXXXXXXXXX-------------XXXXQKDYLETQV 320
           ++EC RL++ V + I +    +                             QK  L+ Q+
Sbjct: 330 KDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQM 389

Query: 321 ENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQSFKRKSEHND 380
           E+FI ELE K P +                 T L++ IS+ +   EKE  S ++K  + +
Sbjct: 390 ESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCE 449

Query: 381 GMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSI 440
             I +L  QR DLA Q++ LLL +       + LS DE   +++L E+       DSQ I
Sbjct: 450 ANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQII 509

Query: 441 ISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLD 500
           I+ERL++F +  ELQ++NM++L  VR LA +LE  E  +      +E +T++EAK A+++
Sbjct: 510 ITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIE 569

Query: 501 LQEYTNSLERKLETFRKERDVY 522
           L+   ++LE +++   +ERD Y
Sbjct: 570 LEHVNSTLESRIDILSRERDSY 591

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
           YIL149C (REAL)
          Length = 1680

 Score =  144 bits (364), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 176/685 (25%), Positives = 320/685 (46%), Gaps = 56/685 (8%)

Query: 103 ILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELM----TQKQS 158
           +L ++  L+  KS  +  Q + + + ++ EL  ++ +W EE L    ++ +    T+   
Sbjct: 153 LLEMENILQVCKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSY 212

Query: 159 ILKMEEKDQEIDNLRHEVSIXXXXXXXXXXXXQELSENVQEKLIEIKQKSDDYSTKQQEF 218
           +  +EEK  +       VS             ++LS  V+EKL+EIK   D  +T++ EF
Sbjct: 213 LQNLEEKLNQTQTENESVSTYNKFLLDQN---KKLSHLVEEKLLEIKNLKDTANTEKSEF 269

Query: 219 LHEIGLKDRINSSLETQLKEIQQEKSIQNEDN-----TSRAESQKIMEQLIDTRKQLKDS 273
             E+ L+ ++N  L +QL   ++  S++ ++          E   + E+LID + +L+ S
Sbjct: 270 SKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKS 329

Query: 274 RNECTRLKSYVNEFIND----VN--------GEYXXXXXXXXXXXXXXXXQKDYLETQVE 321
           + EC  LK+ V++ I +    VN        G+                 QK  ++ Q++
Sbjct: 330 KEECQLLKNIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLK 389

Query: 322 NFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQSFKRKSEHNDG 381
           +F+ ELE K P +                 T L++ +S+ +   EK+  S ++K    + 
Sbjct: 390 DFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEA 449

Query: 382 MIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSII 441
            I +L  QR DLA Q++ LL  +    TT + LS DE   +R+L E++      DSQ II
Sbjct: 450 NIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIII 509

Query: 442 SERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDL 501
           +E+L++F +I ELQ++NM++L  +R LA +LE  E         IE +T++EAK+A++++
Sbjct: 510 TEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEM 569

Query: 502 QEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDKHTTGK----LQNELQQT 557
           +   + L  ++    +ERD Y               E   I + T  K    LQ++L  T
Sbjct: 570 ESINSKLALRVNILTRERDSYKLLASANDNKTHADTE--GITEATYEKKIRELQSKLSST 627

Query: 558 REYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAEL--IENNLLMLQENRK 615
           R   +  I+ L   N  +L  K             K   +GK  L   EN  +++ E   
Sbjct: 628 RVESSAIIQNL---NGQLLTYK-------------KSQTDGKIALQEFENFKVLVAEKEA 671

Query: 616 SVLEQNDHLQQLLSQKEAKLAELTQD-----LHELTSQYN---LLQIRFTDTQSQSNSLR 667
            + E+ +HL+  L ++    A   QD     L +L+   N    L+   ++ + ++  L 
Sbjct: 672 MLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLI 731

Query: 668 TQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQLHEQDLL 727
              ++  ++L    +EK  L VK+ E E S NE   I  + EL+ + R+   + + ++L 
Sbjct: 732 AMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELN 791

Query: 728 KIIEKQEDQIRDMEVKRAEELNWYQ 752
             +E +E +I+ ++  +  +L W Q
Sbjct: 792 VRLESKEQEIKTLQSSKNSQLKWAQ 816

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  105 bits (263), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 139/553 (25%), Positives = 264/553 (47%), Gaps = 57/553 (10%)

Query: 191 QELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE-KSIQNE- 248
           +ELS++++ K+ EIK   +   T   +FL E  L+D++ ++L+ Q+K +Q++ +S+ +E 
Sbjct: 198 EELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEK 257

Query: 249 ---DNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFIN---------------- 289
                T + +  +++ Q+ +  ++L+ S  E   L   + EF N                
Sbjct: 258 FDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSSHASGR 317

Query: 290 ---------DVNGEYXXXXXXXXXXXXXXXXQKDYLETQVENFITELEIKVPVIXXXXXX 340
                    DVN                   QK  LE Q+   + ELE  +P +      
Sbjct: 318 NNSALSLSGDVN--------ILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKER 369

Query: 341 XXXXXXXXXXVTSLVDRISIERESLEKEFQSFKRKSEHND--GMIQTLTTQRSDLAHQIQ 398
                        L++ I  ++E+L+K  +  K++SE ++    I +L  QR+ LA Q++
Sbjct: 370 STFLEKELNSSNILLEHI--KKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVK 427

Query: 399 FLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQN 458
           +LLLI+    T  + L + + + + +    +T    +DS+ I+ ERL +F ++ ELQ +N
Sbjct: 428 YLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRN 487

Query: 459 MDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKE 518
           M +L   R LA + E+ EK+      + E +T+ +AK+A+L LQEY+  LE +++    E
Sbjct: 488 MQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDE 547

Query: 519 RDVYXXXXXXXXXXXXXXXECNDIDKHTT--GK-LQNELQQTREY---LTKEIEKLTRTN 572
             V                  +D   HT   GK L   L+ +++    L  EIE L + N
Sbjct: 548 LAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQAN 607

Query: 573 KDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKE 632
            D+         S+ K +SA++ AE +  L+E N+ +L+  ++ + E+ + LQQ +  KE
Sbjct: 608 TDV-------NISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKE 660

Query: 633 AKLAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFE-VVEEKNALKVKI 691
            + +  ++D     S+ +  +   T  +++ N L  + QTT +   E ++ E+N L++ +
Sbjct: 661 KQFSYSSRDYISCKSKLSTAEAEITSLRAE-NELSIETQTTLRTKKEALLNERNNLRMTV 719

Query: 692 HELEISRNECKGI 704
            ++    NE + +
Sbjct: 720 TQMNSLNNELQTL 732

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 109/167 (65%), Gaps = 19/167 (11%)

Query: 1338 VRELNEKFESGRNEVLSKQSENV--TNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENL 1395
            V+E+ + FE  ++ +LS+Q + +    DN        +++LR+ +EE+  +++ +A+ENL
Sbjct: 1188 VQEMKDNFEKEKSSLLSQQEQEIEKLTDN--------ERKLREFYEEEIQKKVSQAEENL 1239

Query: 1396 KRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELE 1455
            K+ IRLP+EEKI  IIEKR++ELES F+++++E+A  + L      S D+  +K+ +E+E
Sbjct: 1240 KKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLL-----HSDDDKIKKIYKEIE 1294

Query: 1456 HA----IEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQ 1498
             +    ++Q+   +L  +R KAFEEGK+   MK+  LERK+S LE Q
Sbjct: 1295 ESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 108/197 (54%), Gaps = 11/197 (5%)

Query: 312 QKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEKEFQS 371
           +K  LE +  +F+ ++E K+P +                   ++     E +SL+ E QS
Sbjct: 296 EKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIH----EHDSLKLENQS 351

Query: 372 FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLL---ILGEQATTNALLSKDETDFIRRLTEN 428
            K K    +  ++TL  QRSDL HQI +LL+    L E    N +L+++E +FIR L   
Sbjct: 352 LKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNED--NNKILTENELNFIRNLVAQ 409

Query: 429 DTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIER 488
            T   + ++Q+IISERLLKF+++++L  +N+ +++ VR L  ++E  EK        +E 
Sbjct: 410 PTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEM 469

Query: 489 --KTLEEAKKALLDLQE 503
             K+++EAK+ ++ L+E
Sbjct: 470 DFKSIDEAKQRMIVLKE 486

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 120/532 (22%), Positives = 240/532 (45%), Gaps = 47/532 (8%)

Query: 253 RAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEF-----INDVNGEYXXXXXXXXXXXX 307
           + E Q+++ + +   +++ +   +  RL + VNEF     IN V+ +             
Sbjct: 247 KQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFIILKKEIQ 306

Query: 308 XXXXQKDYLETQVENFITELEIKVPVIXXXXXXXXXXXXXXXXVTSLVDRISIERESLEK 367
               Q+D L+ ++E  I ELE   P +                  +  +      + +E 
Sbjct: 307 KLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTSEHFKTTIKEIEN 366

Query: 368 EFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTE 427
           E ++   + + +D  I+TL  + +DL +QIQF+L+    Q      L+++E  FI+ L E
Sbjct: 367 EKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALRE 426

Query: 428 NDTYARNN---DSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHH 484
             T    N   +SQ IIS+RL++F  +  LQ++NM+++ T+R +  +L+ QE   +A   
Sbjct: 427 KGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWE 486

Query: 485 TIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYXXXXXXXXXXXXXXXECNDIDK 544
                 L EAK+ +L +   ++ L+ K+   +++ +                 E N +  
Sbjct: 487 AENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAE-NKL-- 543

Query: 545 HTTGK--LQNELQQTREYLTKEIEKLTRTNKD----ILNKKKELEYSMKKMESAKEYAEG 598
           +T G   + +EL+      TK+   +   N D    + NK  EL     K   +++  + 
Sbjct: 544 YTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQK 603

Query: 599 KAELIENNLLMLQENRKSVLEQNDHLQQLLSQKE--------------AKLAELTQDLHE 644
           K +L+++    L  + + + E  + ++  + +K+              A L  +T D++ 
Sbjct: 604 KLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNS 663

Query: 645 LTSQYNLLQIRFTDTQSQ-SNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKG 703
           L ++Y+ L+    D QS+ +N L+ + +  + EL         L +K  +++ S  E   
Sbjct: 664 LMTKYDELKY-LKDQQSRITNELKMEREQLKMEL---------LNIKTVQIQ-SDLESAE 712

Query: 704 IQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNF 755
            +A+V  K+N    + ++   +L K +  +E +++D    +  EL+WYQK F
Sbjct: 713 YKASVASKIN----DLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKF 760

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 105/429 (24%), Positives = 173/429 (40%), Gaps = 122/429 (28%)

Query: 1176 FKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQ 1235
             KN+ ++LK   EE++KE E+ ++KF  LK+QA+E+L+A+K   + L++++  ++     
Sbjct: 646  LKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTN 705

Query: 1236 LEEVMKEKDKKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLN 1295
             +E + + +  I  +   L E        EK +SE+  K                 ET  
Sbjct: 706  FKEHISKLEVDINNLNNALVE-------AEKKLSEENLKY----------------ETER 742

Query: 1296 QEVVSLREEINVLRKKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGR------ 1349
            Q   +LR +I+ L+  +D   + +  ++ +    KD++   K+ E NE    G+      
Sbjct: 743  QTGSTLRLKIDDLQLNEDNLKEKVKNLEENESTLKDKI---KMIEGNEDDLMGKISVLQS 799

Query: 1350 NEVLSKQSENVTNDNTGSNVDKLKQE-LRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQ 1408
            NE+L K   N  N  + +N + +  E L+KDWE++                         
Sbjct: 800  NEILLKDKLNDLNSKSSNNSELVDVEGLKKDWEKE-----------------------YS 836

Query: 1409 RIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLET 1468
             IIEKR    E   +KR                    LK ++ RE++         K++ 
Sbjct: 837  HIIEKRIEYAEMQLEKR--------------------LKSEMEREMDD--------KMKV 868

Query: 1469 IRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYK 1528
            +  K FE GK  +E    LLE KLS LE Q   +NE  +K+                L +
Sbjct: 869  VEMKGFESGKASSEKTLNLLEHKLSLLEKQ---NNEKSNKIN--------------TLIE 911

Query: 1529 DNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHM--APTFS 1586
                 +T+ +                   NPFT  + E   SN  +   I+    AP  S
Sbjct: 912  SENNNKTQKI-------------------NPFTFSSVEPKISNLVSNDTIIEFSKAPAVS 952

Query: 1587 FTPGKSTGT 1595
               GK T T
Sbjct: 953  NNEGKETIT 961

>YBR128C Chr2 complement(493081..494115) [1035 bp, 344 aa] {ON}
            ATG14Autophagy-specific subunit of phosphatidylinositol
            3-kinase complex I (with Vps34/15/30p); Atg14p targets
            complex I to the phagophore assembly site (PAS); required
            for localizing additional ATG proteins to the PAS;
            homolog of human Barkor
          Length = 344

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 10/93 (10%)

Query: 1288 QKLNETLNQEVVSLREEINVLRKKDDETNQLISTMKLDFEREK--DRLIEEKVRELNEKF 1345
            Q LNE +N + + ++    + +KKD   N L   MKLD  R K  + LI  ++ +LNE+ 
Sbjct: 49   QILNEAMNYDQLDIKR---MEKKKDPLMNSL---MKLDVLRMKKNNNLIRHRIEQLNERI 102

Query: 1346 ESGRNEV--LSKQSENVTNDNTGSNVDKLKQEL 1376
             S RN +  L  + +N      G+  DKL++++
Sbjct: 103  YSKRNHISELKVEIDNYKCYKVGTGTDKLREQV 135

>NCAS0B00440 Chr2 complement(59467..61992) [2526 bp, 841 aa] {ON}
            Anc_8.718
          Length = 841

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 1245 KKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREE 1304
            ++IR+I  +L   L + DK  +L S+K  + NE  L    T+LQ    TL  E++++ +E
Sbjct: 251  QRIRKIAESLDAKLYEVDKSAELRSQKLLRINE-NLGDLYTVLQTTTTTLESELIAISKE 309

Query: 1305 INVLRKKDDETNQLISTM-KLDFEREKDRLIEE 1336
            +NV  +       +  T+ K +F++ +  LI E
Sbjct: 310  LNVWYQDIAREKAIFETLNKFNFDKNRKTLIAE 342

>Kwal_23.5060 s23 (991233..993740) [2508 bp, 835 aa] {ON} YFL004W
           (VTC2) - polyphosphate synthetase (putative) [contig 7]
           FULL
          Length = 835

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 17/93 (18%)

Query: 97  SNINDEI---LTLQRELERAKSEHLI-------SQSEAERSLK---QSELVREHNQWLEE 143
           S+I+ +I   L   R  E AK  + +         SEA+ ++K   Q++L R+H QW+EE
Sbjct: 455 SDIDTDIPNPLKFLRPGEYAKFPYAVLDIRIRNPVSEAKGAIKDDIQAQLPRKHAQWVEE 514

Query: 144 ----HLVKTTEELMTQKQSILKMEEKDQEIDNL 172
               HLVK         Q +  +  +D+ +D L
Sbjct: 515 LTNSHLVKEVANFSKYAQGVASLFGEDENLDML 547

>TDEL0F01590 Chr6 complement(291940..293478) [1539 bp, 512 aa] {ON}
            Anc_4.38 YLR314C
          Length = 512

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 1418 LESDFDKRVEEKANLIALADKADMSPDE----LKQKVRRELEHA 1457
            L+ +F KRV +K NLI +  K+D+  +E     KQ++RR+L+ A
Sbjct: 262  LDVEFCKRVHQKCNLIPIIAKSDILTEEEITLFKQRIRRQLDEA 305

>TDEL0A06490 Chr1 complement(1135618..1137783) [2166 bp, 721 aa] {ON}
            Anc_8.704 YPL174C
          Length = 721

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 9/122 (7%)

Query: 1201 FQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKE-NLE 1259
            F L +KQ +  + A    I+ +++  + ++  N +L  V++  ++KIR+  +  ++ N E
Sbjct: 54   FDLQEKQGNYGIFAQSEDIRKIDDGWA-LREENRKLHSVVEALERKIRQWHMKWEQLNHE 112

Query: 1260 KFDKDEKLVSEKTFKENEAK---LNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETN 1316
            K   D    S++T KE ++K   L + ++ +Q+ N+ L  E+ SL+E+   L+ +D  TN
Sbjct: 113  KTASD----SQRTVKEWDSKYTALEEKLSTVQEENDVLKTEIKSLKEKFANLKVRDASTN 168

Query: 1317 QL 1318
            Q+
Sbjct: 169  QI 170

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
            similarities with uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 768

 Score = 34.3 bits (77), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 77/160 (48%), Gaps = 19/160 (11%)

Query: 1102 EVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQ 1161
            E+  LK +   L   ++Q  K+   L++Q        KE   + S YK+EIE  KK    
Sbjct: 372  EIASLKKNESSLRQTVAQKEKIIDYLENQ-------VKEYSSKESEYKNEIELQKKENSA 424

Query: 1162 MVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQT 1221
             V R ++     A +KNE     G +E   KE  KLSE+ ++L     EKL+     +Q 
Sbjct: 425  FVKRIENLNKETAKWKNESQKNNGNLESYIKENGKLSERLEVL----QEKLET----LQN 476

Query: 1222 L-NNDLSEIKASNLQLEEV---MKEKDKKIREIELTLKEN 1257
            L +N   +++    Q EE+   +K+ +KKI  +E  L EN
Sbjct: 477  LKSNSNDQVETIRKQCEELSFKLKDANKKILSLEDELNEN 516

>NCAS0E00380 Chr5 (63083..64957) [1875 bp, 624 aa] {ON} Anc_3.546
            YFR039C
          Length = 624

 Score = 33.9 bits (76), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 1261 FDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLIS 1320
            FDKD   + +K  K NE K    I  L + +E L Q++    ++IN     D +TN+ I 
Sbjct: 304  FDKDVAKLIKKEMKSNEQKFKDKIQNLNQESELLFQDLNKAIQDINCTESLDPQTNETIY 363

Query: 1321 TMKLDFEREKDRLIEEK-----VRELNEKFESGRNEVLS--KQSENVTNDNTGSNVDKLK 1373
                 F+R  +  +E+      +REL EK  +  NE+++  +  ENV  +     V+ ++
Sbjct: 364  -----FDRNGETQLEQYIERPLIRELFEKTRATLNELIADIQNDENVLIEKVNKKVESIR 418

Query: 1374 QE---LRKDWEE 1382
             E   + ++W E
Sbjct: 419  DEHLDVYEEWGE 430

>Skud_16.24 Chr16 (41954..43213) [1260 bp, 419 aa] {ON} YPL255W (REAL)
          Length = 419

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 42/106 (39%), Gaps = 17/106 (16%)

Query: 900  LDKIMENNSLTEVAKKSLEDDLHDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGY 959
            + K+ +     +V K + +  + D+  K     +K +E N      E  C+K IE    Y
Sbjct: 163  ISKLFQKGEANDVEKSAYKLSVKDIPGKFPSPFKKRDEINDNRGHNEDACQKNIEYKRAY 222

Query: 960  REELSKSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLN 1005
             E  ++                 +DL N+ +DDLC      HEQ +
Sbjct: 223  FELFAQ-----------------MDLNNRDLDDLCEDVREQHEQFH 251

>NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1890

 Score = 33.5 bits (75), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 70/141 (49%), Gaps = 16/141 (11%)

Query: 567  KLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQ 626
            KL  T  D  NK   L + +++ +S       + EL +  ++ L++N +S+  Q   L  
Sbjct: 1387 KLQETIADANNKISHLNHDIRQSQS-------REELHKEQIVRLKKNLESIEYQKGLLLT 1439

Query: 627  LLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQSNS-------LRTQHQTTQKELFE 679
             + Q++ +  E  QDLHE  +Q N  ++     +S  NS       L++Q++   K ++E
Sbjct: 1440 TIDQQKKRFDECVQDLHENETQLNEYKLALKQAESDVNSMSSIIEKLKSQNKQKDKTIWE 1499

Query: 680  VVEEKNALKVKIHE--LEISR 698
               EKN L +++ E  LE+ R
Sbjct: 1500 RETEKNELDMQLQESLLELKR 1520

>KAFR0G01920 Chr7 (408397..409818) [1422 bp, 473 aa] {ON} Anc_8.636
           YOR216C
          Length = 473

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 75  DISGPIRITGVEAQAPNNA--TSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSE 132
           ++S P+     E    N+   T ++++  +I  LQ EL+RAKSE  +++S+  R   +  
Sbjct: 55  EVSSPVVAAPQEGTNANDTIDTEVTDLRKQIAQLQAELDRAKSEKTVTESDTNRDSSEVA 114

Query: 133 LVREHNQWLEEHLVKTTEELMTQKQSILKMEEKDQEID 170
            ++E    ++         L + K    KM+E  QE++
Sbjct: 115 SLKEERDEIKSQYDTLLSRLSSMKTVFNKMKEAQQELE 152

>NCAS0C01800 Chr3 complement(333093..334220) [1128 bp, 375 aa] {ON} 
          Length = 375

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 12/108 (11%)

Query: 1115 DELSQVRKLSGPLQDQKNNTERY-FKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLE 1173
            DE+  + KL   L   K N + Y F  +++ IS   D I  WK+ W Q+   Q + + L+
Sbjct: 207  DEIDLLFKLK--LISSKRNPKFYNFVTRNETISWQYDIILSWKQNWVQLQSLQREIIQLQ 264

Query: 1174 ANFKNEIDSLKGLIEERTKEKE---------KLSEKFQLLKKQAHEKL 1212
               K + +SL    +    E E         +++EK+ LLK++ + KL
Sbjct: 265  VQLKIKSNSLNLSTQYHNNESEIGKQLLNDLQINEKWSLLKRETNAKL 312

>Smik_11.165 Chr11 (282628..285273) [2646 bp, 881 aa] {ON} YKL073W
           (REAL)
          Length = 881

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 6/49 (12%)

Query: 193 LSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQ 241
           + E+++E+L EIK K D Y TK +E LH I   D      E++LKEI++
Sbjct: 773 IGEDLRERLFEIKLKFDKYRTKLEEKLHLIKTSD------ESRLKEIKK 815

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 33.1 bits (74), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 76/148 (51%), Gaps = 22/148 (14%)

Query: 1246 KIREIELTLKENLEKFDKDEKLV-SEKTFKENEAKLNKTITMLQKL-NETL--NQEVVSL 1301
            KI+ +EL +K      D +EKL+ SE T KEN  KLN+++  +  L N  L  N E+  +
Sbjct: 872  KIKSLELQIK------DLNEKLIKSETTDKENVLKLNQSMDEINSLKNHILEKNDELDKI 925

Query: 1302 REEINVLRKKDDETNQLISTMKLDFEREKDRL------IEE------KVRELNEKFESGR 1349
            + E +   KK +  N+  +T+  D +   D++      IE       K+ E+N + +  +
Sbjct: 926  KLESDATLKKWESLNETNNTLTKDLKSMTDKMETREKEIETLKNDTTKIDEINTQLKEAK 985

Query: 1350 NEVLSKQSENVTNDNTGSNVDKLKQELR 1377
             ++L K  E +T  N  S  DKL+ +L+
Sbjct: 986  EKILQKDKEIITLKNDTSAADKLESQLK 1013

>Skud_12.395 Chr12 complement(698568..699779) [1212 bp, 403 aa] {ON}
            YLR312C (REAL)
          Length = 403

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 96/240 (40%), Gaps = 41/240 (17%)

Query: 1065 QQWHNLPLSNLL-------------TGHEKILDELKEVHLLRENNVSLLTE----VNQLK 1107
            + WH + LS+LL             TG   +    K   LLR+N   LL      VN+  
Sbjct: 149  KMWHVIMLSSLLSMTFSYLAVEYSLTG--DVFAGFKSQQLLRDNERKLLYSNIDFVNKRS 206

Query: 1108 HDNCILNDELSQVRK-----------LSGPLQDQKNNTERYFKEKDQEISLYKDEIERWK 1156
            +D+   +D LSQ              ++ PL+D  N+   + + K   +  +     R +
Sbjct: 207  YDST--SDSLSQWAPSGKYYVDFDNHIAYPLKD--NDLMGWKRYKTNLVIFWYTSKARMR 262

Query: 1157 KRWQ-QMVHRQDDTLGLEA----NFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEK 1211
              W  ++V      + L A     F++ +D+LK    E+ +  +KL   FQ   KQ   +
Sbjct: 263  DGWHKRIVKINGGRMKLHAFVKRAFRSTLDNLKLFHTEQKRHWQKLFALFQSKYKQISPR 322

Query: 1212 LDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLVSEK 1271
            L  +  H            +S LQL ++  +  K  R  +  ++E+   F K  KL + K
Sbjct: 323  LGKSFKHSCRKAKQFGS--SSKLQLRKLRFDSVKPFRAFKFKVREDTNWFIKQLKLFALK 380

>CAGL0E03564g Chr5 complement(329297..330934) [1638 bp, 545 aa] {ON}
            similar to uniprot|P32457 Saccharomyces cerevisiae
            YLR314c CDC3
          Length = 545

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 32/112 (28%)

Query: 1418 LESDFDKRVEEKANLIALADKADMSPDE----LKQKVRRELEHAIEQDLQAKLETIRTKA 1473
            L+ +F K++ EK NLI +  K+D+  DE     K ++RR+L+ A                
Sbjct: 295  LDIEFCKQIHEKCNLIPVIAKSDILTDEEIAIFKSRIRRQLDEA---------------- 338

Query: 1474 FEEGKRQAEMKTTLLERKLSKL--ESQVAKDNESGSKVRKSISGLTKIDVNS 1523
                        TL E     L  E  VA   E  +KV  ++ G T++  NS
Sbjct: 339  ----------GVTLFEPPTYALDDEETVAATKELANKVPYAVVGSTEMVTNS 380

>NCAS0E01180 Chr5 complement(225933..228776) [2844 bp, 947 aa] {ON}
            Anc_3.425 YGR089W
          Length = 947

 Score = 32.7 bits (73), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 88/184 (47%), Gaps = 41/184 (22%)

Query: 1179 EIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEE 1238
            EID  KG IE+     EK + K   LK    +   A K                  QLEE
Sbjct: 766  EIDHFKGKIEQNATNDEKNTSKVDNLKIALQQNEKALK------------------QLEE 807

Query: 1239 VMKEKDKKIREIELTLKEN-LEKFDKDEKLVSEKTFKENEAKLNKTITMLQ----KLNET 1293
             +K   +K    EL L+E+ L K  KD  L  E  F + E  LNK +++++    KL   
Sbjct: 808  DLKRASEK----ELALEEDYLTK--KDYHLQKELEFSKLEESLNKDLSLVKAKETKLQNE 861

Query: 1294 LNQ-----EVVSLREEINVLRKKDDETNQLISTMKLDF--EREKDRLI--EEKVRELNEK 1344
             NQ     + +SLR E   L+K+ DE N+L + +K  F  +RE +RL   E ++RE+++ 
Sbjct: 862  YNQLSSKKDKLSLRHE--KLQKELDENNELFTVVKEQFVVKRENERLKRQEARIREISD- 918

Query: 1345 FESG 1348
            FE G
Sbjct: 919  FELG 922

>KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5.267
            YHR023W
          Length = 1891

 Score = 32.7 bits (73), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (65%), Gaps = 6/61 (9%)

Query: 548  GKLQNELQQTREYLTK---EIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIE 604
            G+L++EL+ +R+ +TK   E  +L++  +DILNK K LE   + +E  KE +E   EL++
Sbjct: 1647 GRLKSELESSRDAITKSSAEFGELSQEKEDILNKMKYLE---ETLELQKEQSERNEELVQ 1703

Query: 605  N 605
            N
Sbjct: 1704 N 1704

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.126    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 170,932,626
Number of extensions: 8166742
Number of successful extensions: 78895
Number of sequences better than 10.0: 3716
Number of HSP's gapped: 69250
Number of HSP's successfully gapped: 8619
Length of query: 1674
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1551
Effective length of database: 39,377,481
Effective search space: 61074473031
Effective search space used: 61074473031
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)