Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D022105.703ON58458430380.0
Suva_9.385.703ON56956915230.0
YIL150C (MCM10)5.703ON57156914930.0
Smik_9.195.703ON57257114850.0
Skud_9.185.703ON57157114840.0
NCAS0G002205.703ON59257714200.0
ZYRO0G06578g5.703ON56957513960.0
TDEL0B021705.703ON56759313820.0
KNAG0L021505.703ON61660013511e-180
Kpol_1043.715.703ON58557512831e-170
NDAI0F002805.703ON61059612801e-170
TBLA0G010205.703ON59459912621e-167
CAGL0H06589g5.703ON58358112431e-165
TPHA0E002105.703ON54453111791e-155
KLTH0E01034g5.703ON58357311091e-144
SAKL0E14938g5.703ON57457410871e-141
Kwal_55.196915.703ON4664539641e-124
AFR287W5.703ON6115988971e-112
KLLA0A00572g5.703ON5775818701e-109
ZYRO0B05786g3.124ON299494771.1
ZYRO0B13332g4.290ON39140732.4
Kpol_1023.1037.435ON83855724.0
TPHA0C01870singletonON23380704.7
ACR228C7.387ON1129144698.6
NCAS0B072801.349ON54675699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02210
         (584 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...  1174   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   591   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   579   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   576   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   576   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   551   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   542   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   536   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   525   e-180
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   498   e-170
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   497   e-170
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   490   e-167
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   483   e-165
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   458   e-155
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   431   e-144
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   423   e-141
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   375   e-124
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   350   e-112
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   339   e-109
ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] ...    34   1.1  
ZYRO0B13332g Chr2 complement(1080477..1081652) [1176 bp, 391 aa]...    33   2.4  
Kpol_1023.103 s1023 (243143..245659) [2517 bp, 838 aa] {ON} (243...    32   4.0  
TPHA0C01870 Chr3 (428204..428905) [702 bp, 233 aa] {ON}                32   4.7  
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...    31   8.6  
NCAS0B07280 Chr2 complement(1375883..1377523) [1641 bp, 546 aa] ...    31   9.6  

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/584 (97%), Positives = 572/584 (97%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120
           VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180
           YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY
Sbjct: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240
           TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK
Sbjct: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300
           YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR
Sbjct: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360
           ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD
Sbjct: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420
           LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR
Sbjct: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEGKTREEVEK 480
           NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEGKTREEVEK
Sbjct: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEGKTREEVEK 480

Query: 481 MKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFKKE 540
           MKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFKKE
Sbjct: 481 MKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFKKE 540

Query: 541 YIILAPSKVDLLNKKNKREKVWQENFGQXXXXXXXXXXXXLEIV 584
           YIILAPSKVDLLNKKNKREKVWQENFGQ            LEIV
Sbjct: 541 YIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSESDSDLEIV 584

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/569 (52%), Positives = 397/569 (69%), Gaps = 20/569 (3%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M DPREI   D Y N+T D+ED + I  ELE +E  K+ L+ERL RK+   +  DPNF  
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120
           V+VP SP KK    +V++    LK   R   SN   NE  L Q+ Q+  +       +T 
Sbjct: 61  VEVPQSPAKK---SIVKKSQDALKQAIRPVASN--INESMLSQQSQESPSN------TTT 109

Query: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180
           YFM+KF+DAKR E   I K+E MM +RVHTF G + K EY+ +I +ELE +SNLW+ KRY
Sbjct: 110 YFMQKFQDAKRNEDKQIAKYEGMMNARVHTF-GTDNK-EYKPIITNELESFSNLWVKKRY 167

Query: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240
            P  +LK  LHE+KILRLNKLFAK+RPPKF+EP Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 168 IPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVK 227

Query: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300
           +  FT+TDF+H +D YIFGK+GVERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 228 FFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLR 287

Query: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360
           ISH +KCILEIG SRDL  CPIV + T K CG PIN  V  CC+YHRE++ R   +KR++
Sbjct: 288 ISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIE 347

Query: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420
           L+G YALGAPTK++SQP+LYR           F +  S  +      ++    S  F+N 
Sbjct: 348 LNGGYALGAPTKVDSQPSLYRAKGE-----NQFNIVRSTRKGLSEEEERVKRNSHNFTNS 402

Query: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478
           N+AKAFFD++FQNPDM++NLD+KRRKI++ +KS  L+REL +++R+     LE K+  E 
Sbjct: 403 NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK 462

Query: 479 EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538
           +KMKQTT+  LQ+GL Q++GFDPT GKIS++LK+     +  P  ++ K   ++DL+ +K
Sbjct: 463 QKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYK 522

Query: 539 KEYIILAPSKVDLLNKKNKREKVWQENFG 567
           KE +ILAPSK +   K++ RE+VWQ +FG
Sbjct: 523 KEKVILAPSKNEWFKKRSHREEVWQRHFG 551

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/569 (51%), Positives = 397/569 (69%), Gaps = 18/569 (3%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M+DPREI   D Y NIT D+ED + I  ELE +E  ++ L+ERL RK+   + +DPNF  
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120
           ++VP SP K    ++        +   +FE SN N   L   Q+  K  A      ++T 
Sbjct: 61  IEVPQSPTKN---RVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPA------STTT 111

Query: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180
           YFMEKF++AK+ E   I K ESMM +RVHTF+  E K  Y  +I +ELE +SNLW+ KRY
Sbjct: 112 YFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKK--YVPIITNELESFSNLWVKKRY 169

Query: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240
            P  +LK  LHE+KILRL KLFAK+RPPKF+EP+Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 170 IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVK 229

Query: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300
           +  FT+TDF+H +D YIFGK+GVERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 230 FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLR 289

Query: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360
           ISH +KCILEIG SRDL  CPIV + T K+CG PIN  + +CC+YHRE++ R   +KR++
Sbjct: 290 ISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIE 349

Query: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420
           L+G YALGAPTK++SQP+LY+           F +     +      ++  + S  F+N 
Sbjct: 350 LNGGYALGAPTKVDSQPSLYKAKGE-----NGFNIIKGTRKRLSEEEERLKKSSHNFTNS 404

Query: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478
           N+AKAFFD++FQNPDM++NLDNKRRKI+E +KS  L+REL +++R+     LE K+  E 
Sbjct: 405 NSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGER 464

Query: 479 EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538
           +KMK+TT+  LQ+GL Q++GFDPT GKIS++LK+     + +   L +K   ++DL+ +K
Sbjct: 465 QKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYK 524

Query: 539 KEYIILAPSKVDLLNKKNKREKVWQENFG 567
           KE +ILAPSK +   K++ RE+VWQ++FG
Sbjct: 525 KEKVILAPSKNEWFKKRSHREEVWQKHFG 553

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/571 (51%), Positives = 399/571 (69%), Gaps = 22/571 (3%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M DPREI   D Y ++T D+ED + I  ELE +E  ++ L+ERL RK+   +  DPNF  
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTAR-LNDSNAST 119
           ++VP SP K    ++       +K + R E SN N + L    + QKQ    +N    +T
Sbjct: 61  IEVPQSPTKS---RVKSGSQNAVKQVTRLETSNANESNLS---QIQKQPELPIN----TT 110

Query: 120 EYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKR 179
            YFM+KF++AK+ E   I K ESMM +RVHTF G + K +Y+ +I +ELE +SNLW+ KR
Sbjct: 111 TYFMQKFQNAKKDEDRQIAKFESMMDARVHTF-GTDNK-KYKPIIANELEGFSNLWVKKR 168

Query: 180 YTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQ 239
           Y P  +LK  LHE+KILRL KLFAKVRPPKF+ P+Y+NW  VG++S KSDIKFT+S KP 
Sbjct: 169 YIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPV 228

Query: 240 KYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNL 299
           K+  FT+TDF+H +D YIFGK+GVERYYNLR+GDIIA+LNPE+LPWRPSG+ N+IKSFNL
Sbjct: 229 KFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNL 288

Query: 300 RISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRL 359
           RISH +KCILEIG SRDL  CPIV   T K+CG PIN  + +CC+YHRE++ R   +KR+
Sbjct: 289 RISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRI 348

Query: 360 DLSGQYALGAPTKLESQPALYRGHTAQNVKIQN-FKLTPSYSQNNPHLIDKYGEKSKFFS 418
           +L+G YALGAPTK+ SQP+LY+       K +N F +     +      ++  + S  F+
Sbjct: 349 ELNGGYALGAPTKVNSQPSLYK------AKGENRFNIIRDARKGLSEEEERMKKSSHNFT 402

Query: 419 NRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQD--LEGKTRE 476
           N N+AKAFFD++FQNPDM++NLDNKRRKI + +KS  LNREL +++R+ +   LE K+  
Sbjct: 403 NSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDG 462

Query: 477 EVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMA 536
           E +KMKQTT+  LQ+GL Q++GFDPT G+IS++LK+     + +   L+ K   ++DL+ 
Sbjct: 463 EKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLH 522

Query: 537 FKKEYIILAPSKVDLLNKKNKREKVWQENFG 567
           +KKE +ILAPSK +   K+N RE+VWQ +FG
Sbjct: 523 YKKEKVILAPSKNEWFKKRNHREEVWQRHFG 553

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/571 (51%), Positives = 395/571 (69%), Gaps = 22/571 (3%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M DPRE    D Y N+T D++D + I  ELE +E  K+ L+ERL RK+      DPNF  
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120
           ++VP SP K   +    +    +K   R   SN   N+L L Q  QKQ    N    +T 
Sbjct: 61  IEVPQSPAKNRNIM---KSQNTMKRDMRPAASN--INDLKLSQLQQKQELPSN----TTG 111

Query: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180
           YFM+KF++AKR E+    K+E+MM +RVHTF     K EY+  I +ELE++SN+W+ KRY
Sbjct: 112 YFMQKFQNAKRNEEKQRAKYENMMNARVHTFG--TDKKEYRATIANELEEFSNIWVKKRY 169

Query: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240
            P  +LK  LHE+KILRL KLFAK+RPPKF+EP Y+NW VVG++S KSD+KFT+S+KP K
Sbjct: 170 IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAK 229

Query: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300
           +  FT+TDF+H +D YIFGK+ VERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 230 FFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLR 289

Query: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360
           ISH +KCILEIG SRDL  CPIV R  ++ CG PIN  + +CC+YHRE++ R   +KR++
Sbjct: 290 ISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIE 349

Query: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420
           L+G YALGAPTK+++QP LYR          NF L  S  +      ++  + S  F N 
Sbjct: 350 LNGGYALGAPTKVDAQPTLYRAKGE-----NNFNLVRSIRKTLSEEEERMKKNSHNFRNS 404

Query: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478
           N+AKAFFD++FQNPDM++NLD+KRRKI++ +KS  L+REL +++R+     LE K  EE 
Sbjct: 405 NSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEK 464

Query: 479 EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEP--KFLSQKDRTVDDLMA 536
           +K+KQTT+  LQ+GL Q++GFDPT GKIS++LK+      GEP  K +  K   +DDL+ 
Sbjct: 465 QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSS--VPGGEPRNKVMGGKKTVIDDLLN 522

Query: 537 FKKEYIILAPSKVDLLNKKNKREKVWQENFG 567
           +KKE +ILAPSK +   K++ RE+VWQ++FG
Sbjct: 523 YKKEKVILAPSKNEWFKKRSHREEVWQKHFG 553

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/577 (49%), Positives = 411/577 (71%), Gaps = 23/577 (3%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M+DPRE+   D Y N++ D++D   I  +LE +E  ++DLL R+  K+   +  DPNF  
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  VQVPASPVKKHELQL-VEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNAST 119
           +QVP SPVKK E  + V  K    K+ N  E  +ENPNEL    R ++++ +L  SN +T
Sbjct: 61  LQVPCSPVKKTETNVPVAMK----KSTNEMEIPHENPNEL----RIREKSGQL-PSNTTT 111

Query: 120 EYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKR 179
            YFMEKF+ +K++E+  I+K E+MM +RVHTF     K E++ + V+E+E+YSN+W+ KR
Sbjct: 112 -YFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKR 170

Query: 180 YTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQ 239
           Y P S L+ MLH +KILRL+KLFAKVRPPKF EPQYSNW  +GI+S K D KFT ++KP+
Sbjct: 171 YIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPK 230

Query: 240 KYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNL 299
           KYLKFT+TDF+HK+D YIFGK GVERYYNLR+GD+IA+LNPE+ PWRPSGK  +IKSFNL
Sbjct: 231 KYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNL 290

Query: 300 RISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRL 359
           RI+H +KCILEIG S+DL  C +  R+ +  C  PIN   +  C+YH+E+  R   SKR+
Sbjct: 291 RINHDFKCILEIGSSKDLGFCKVTSRNGTL-CNTPINMSKEDRCDYHQEIRFRDNNSKRI 349

Query: 360 DLSGQYALGAPTKLESQPALYR---GHTAQNVKI-QNFKLTPSYSQNNPHLIDKYGEKSK 415
           +L+G +ALGAPTK+E+ P LYR   G T  + K  QNF ++ S+   N    D++  +++
Sbjct: 350 ELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINK---DQFDLRNR 406

Query: 416 FFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLL--RKDQDLEGK 473
            FSN N+AKAFFD++FQNPDM++NL++KRRKI + +K   +++EL + +  R   DL  +
Sbjct: 407 HFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGER 466

Query: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILK--NKERSKDGEPKFLSQKDRTV 531
           +  EV++MK+ T+ TLQSG+ Q++GFDPT GKI+ +L+  + +  KD   + +S K   V
Sbjct: 467 SAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKV 526

Query: 532 DDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ 568
           +DL+ F+K ++ILAP++ +L+ ++++RE++WQENFGQ
Sbjct: 527 NDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQ 563

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/575 (48%), Positives = 402/575 (69%), Gaps = 31/575 (5%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M DPRE+  NDLY  +T + E+   IE ++ +IE  K+DLL+RL+ KK   +  DPN + 
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  VQVPASPVKKHELQL---VEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNA 117
           +QV +SP K     L   V+Q++       R E  NEN NEL  Q + Q           
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEP------RGEVRNENLNELKAQSQEQIPAN------- 107

Query: 118 STEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWIN 177
           +T +F+EK+  +KRK+   +   E ++ +RVHTF G   ++EY+ +  +ELE++SNLWI+
Sbjct: 108 TTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWIS 167

Query: 178 KRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNK 237
           KRY P    +S+   +KILRL+KLFAKV+PPKF EP YSNW V+G++S+K ++KFT++  
Sbjct: 168 KRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAAS 227

Query: 238 PQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSF 297
           P+KY KFTLT+F++ +DTYIFGKEGVERYYNLR+GDIIA+LNP++LPWRPSG + +IKSF
Sbjct: 228 PKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSF 287

Query: 298 NLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSK 357
           NLRISH ++CILEIG SRDL  CP+  +S ++ C  PINK  + CCEYHRE++ R   +K
Sbjct: 288 NLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAK 347

Query: 358 RLDLSGQYALGAPTKLESQPALYRGHTAQ-----NVKIQNFKLTPSYSQNNPHLIDKYGE 412
           R++LSG YALGAPT++++QPALYRG ++Q     N+ I N     S  + NP  I+    
Sbjct: 348 RVELSGTYALGAPTRIDAQPALYRGGSSQKNLNYNI-ITNGADGGSNKEINPLDIN---- 402

Query: 413 KSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEG 472
            ++ FSNRNAAKAFFD+ FQNP+ + NL+NKRRK+ + RKSN+LNREL +    + D++ 
Sbjct: 403 -ARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK--NSELDIKH 459

Query: 473 KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVD 532
           K+ EE++++K+TT+ T+ SG+ + +GFDPT GKI+ + K++    D +P  L++KD +V 
Sbjct: 460 KSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVA 517

Query: 533 DLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFG 567
            L++FKK+ + L PSK  L+ +K +RE+VW+E+FG
Sbjct: 518 SLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFG 552

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/593 (46%), Positives = 408/593 (68%), Gaps = 35/593 (5%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M+DPRE+   D +  +T D+ED R +E ++ +IE  KRDL+ERL  K+ +++ +DPNF  
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKR-QLKSKDPNFDA 59

Query: 61  VQVPASPVKK--HELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNAS 118
           +QV +SPVKK    +++   + +++ +I       EN NE  ++ R Q           +
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLDI-------ENLNEKKVESRSQIPAN-------T 105

Query: 119 TEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINK 178
           T YF++ FR++K++E+   ++ + ++  RVHTF GI+  ++++ V V+E+E+YS+LW+ +
Sbjct: 106 TSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQ 165

Query: 179 RYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKP 238
           RY    +L+ +LHEVKILRL+KLFAK++PPKF EPQYSNW  +GI+S K  +KF++S KP
Sbjct: 166 RYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKP 225

Query: 239 QKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFN 298
            KY KFTLTDF++ +D Y+FGK+GVERYYNLR+GDI+A+LNPE+LPWRPS K N+IKSFN
Sbjct: 226 MKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFN 285

Query: 299 LRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKR 358
           LRISH + CILEIG+SRD+  C    +S +K CG PINK  ++CC++HRE++ R   +KR
Sbjct: 286 LRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKR 345

Query: 359 LDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKF-- 416
           ++L+G +ALGAPTK++S PALYR  +A   +  NFK+ P++ Q +       G+ S    
Sbjct: 346 IELNGSFALGAPTKVDSGPALYREKSAGAHR--NFKVLPNHYQKS------VGKNSDLRG 397

Query: 417 --FSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLE-GK 473
             FSN NAAKAFF+DEFQNPD+++NLD+KRRK  + +KS +L ++L R+  +   +E  K
Sbjct: 398 IHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIEK 457

Query: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKN--KERSKDGEPKFLSQKDRTV 531
             ++ E++ +TT+ TLQSGL Q +GFDPT G+I  +LK   K++S +G+   L++K + V
Sbjct: 458 GSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQ---LNKKQKEV 514

Query: 532 DDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQXXXXXXXXXXXXLEIV 584
             L+ FKKE++ L P+K  LL +K  RE+ WQENFG             +EIV
Sbjct: 515 SSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDIEIV 567

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  525 bits (1351), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 278/600 (46%), Positives = 400/600 (66%), Gaps = 42/600 (7%)

Query: 3   DPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFT-GV 61
           DPR++   D Y NIT D+++  +I+ ELE++E  K+DL +RL  K+  ++  D N    V
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  QVPASPVKK------------HELQLVEQKDQKLKNINRFEESNENPNELC-LQQRFQKQ 108
           QVP+SP K+             E + +++++  L  +N  ++ N N      L     KQ
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLA-LNTAQKVNLNEARFAQLDGDDGKQ 122

Query: 109 TARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDEL 168
           +      NA+T YF+EKF+ +K+ EK+ IE  E+M+ +RVHTF G++   E+Q   V+EL
Sbjct: 123 SV-----NATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNEL 175

Query: 169 EQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKS 228
           EQ+S+LWI+KRY P   L+  L +VK+LRLNKLFAKVRPPKF+EPQYSNW V+ I+S KS
Sbjct: 176 EQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKS 235

Query: 229 DIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPS 288
           ++KFT S  PQK+++FTLT+F+ ++D ++FG  GV+RYYNLR GDI+AVLNPEILPWRPS
Sbjct: 236 EVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPS 295

Query: 289 G---KQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEY 345
           G   +   IKSFNL+I+H +KCILEIGKSRDL  CP+  + ++++CG  IN   DR CEY
Sbjct: 296 GGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEY 355

Query: 346 HREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYR---GHTAQNVKI------QNFKLT 396
           HRE+++R+  SKRLDL+G +ALGAPTK+ +QP L+R   G   Q+ +       + F   
Sbjct: 356 HRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTE 415

Query: 397 PSYSQNNPHLI---DKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKS 453
           PS++  +       + YG K KFF++ NAAKAFFDDEFQNPDM+ NLD KRRK+ + +KS
Sbjct: 416 PSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKS 475

Query: 454 NVLNRELDRLLRKDQDLEG--KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILK 511
             L+R+L RLL KD+D     K   E+  +K+TT+  L +GL Q++GFDPT G+ + ++K
Sbjct: 476 RQLDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMK 535

Query: 512 NKER---SKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ 568
            ++    S   E   LSQK+  V++L+ +K++   L PS+  L ++K  R +VW+E FG+
Sbjct: 536 KRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGK 595

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  498 bits (1283), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 278/575 (48%), Positives = 383/575 (66%), Gaps = 27/575 (4%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M+DPRE A  DLY N++ D+ +   I  +L+ IE  K+DLLERL +KK    + DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSN-AST 119
           VQVP+SP K    ++VE K       N  EE  ENPNE+ L  +        +DSN  +T
Sbjct: 59  VQVPSSPKKS---RVVELKPTSKPIDNNEEEEEENPNEVALMTK--------DDSNYGTT 107

Query: 120 EYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKR 179
            YFMEKF ++K+  +  +  + SMM SRVHTF+G   K E++   VDEL+QYSNLW+  R
Sbjct: 108 SYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSR 167

Query: 180 YTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQ 239
           Y PV  L  ML ++KILRL KLFAKVRPPKF EPQYSNWVV GI++ K DIK+T+S+KP 
Sbjct: 168 YIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPT 227

Query: 240 KYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPS----GKQNYIK 295
           KY KFT++DF+H +D +IFG +GVE+YYNLR+GD++A+LNPEILPWRPS    G  + IK
Sbjct: 228 KYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIK 287

Query: 296 SFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGP 355
           SFNLRISH + CILEIG SRDL  CPI   S +  C  PINK  +  C+YHRE++ RK  
Sbjct: 288 SFNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTT 347

Query: 356 SKRLDLSGQYALGAPTKLESQPALYRGH-TAQNVKIQ-NFKLTPSYSQNNPHLIDKYGEK 413
           S R++LSG YALGAPTK++++PALY+   T+ N ++Q ++ +            +K   +
Sbjct: 348 SNRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETR 407

Query: 414 SKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEGK 473
              FS  N+AKAFFD++FQNPD+++NLD+KRRKI + +    + R L + L+   D E K
Sbjct: 408 MHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALKNTVDKESK 463

Query: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDD 533
                + +K  TQ TLQ+G+ Q++GFDPTGGK+S +++N     +   K+  +K   +DD
Sbjct: 464 N---FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDD 520

Query: 534 LMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ 568
           LM F+K+ + L PSK DL+ ++  R++ W++ FG+
Sbjct: 521 LMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGK 555

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  497 bits (1280), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 275/596 (46%), Positives = 397/596 (66%), Gaps = 39/596 (6%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M+DPRE +P D + +++  +E+   +  ELE ++  K DLL RL   K   +RRDPNF  
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  VQVPASPVKKH------ELQLVEQKDQKLKNINRFEESNE---NPNELCLQQRFQKQTAR 111
           VQ+P +P +K+      E  +++ +D+K + +   E S E   NPNEL +++R ++   +
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVRER-EENLEK 119

Query: 112 LNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEP-----KNEYQHVIVD 166
           L   + +T YFMEKF+  K+KE++   ++E M+K+RVH F G+       K EYQ    +
Sbjct: 120 L--PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAAN 177

Query: 167 ELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSD 226
           E+E+YS L I KRY P   L  +   +KILRLNKLFAKVRPPKFEEPQYSNWV +GI++ 
Sbjct: 178 EVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQ 237

Query: 227 KSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWR 286
           K  IKFT+S+KP+KY KFT++DFK+ VD +IF K  VERYYNLRIGDIIA+LNPE+LPWR
Sbjct: 238 KGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWR 297

Query: 287 PSGKQN--YIKSFNLRISHPYKCILEIGKSRDLARCPIVVR-STSKECGVPINKKVDRCC 343
           PS  +N   IKSFNLRI+H Y CI+E+GKS+DL  CPI  + + S  C  PI+   +  C
Sbjct: 298 PSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRC 357

Query: 344 EYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQ--------NFKL 395
            YH+E+  R   SKR++L+G +ALGAP K+ +QP LYR +   NV ++        N   
Sbjct: 358 SYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNN---NVPVRGVYHGNRFNVVK 414

Query: 396 TPSYSQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNV 455
                +N   L+++   + ++FS+ N+AKAFFD++FQNPDM++NLD KRRKI + ++SN 
Sbjct: 415 GSEIRKNESKLMEE--RRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNY 472

Query: 456 LNRELDRLL--RKDQDLEG-KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILK- 511
           L++EL + +  +    L G KT++E  KMK  T+ TLQ+G+ Q++GFDPT GKI+++L+ 
Sbjct: 473 LDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQT 532

Query: 512 NKERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFG 567
            K+  KD      + K   V DL+ FKK  ++LAP+K +L+ +KN+RE+VWQ++FG
Sbjct: 533 GKDSGKDNVHN--THKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFG 586

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  490 bits (1262), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 259/599 (43%), Positives = 381/599 (63%), Gaps = 59/599 (9%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M+DPRE+  NDL+ NI+PD+++   ++ ++E IE  KRDL ERL  K+      DPNF  
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 61  ------------VQVPASP--VKKHELQL----VEQKDQKLKNINRFEESNENPNELCLQ 102
                       +QVP SP  +K+   QL    V +K+  ++         +NPNEL L+
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQ---------DNPNELKLK 111

Query: 103 QRFQKQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTF-NGIEPKNEYQ 161
            + +  +        ST YFM  F  +K+ E   I+ +E++M +RVH+F N    + E Q
Sbjct: 112 NQIEPASV----PAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQ 167

Query: 162 HVIVDELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVV 221
            + V+E E+YS LWI++RY     +  +L ++KILRLNKLFAK+RPPKFE PQYSNWV V
Sbjct: 168 IINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAV 227

Query: 222 GIVSDKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPE 281
           G++++KS  K T+SN P+KY KFT+ DF+  +  ++F +E + +YYNLR+GDII +LNP 
Sbjct: 228 GVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPV 287

Query: 282 ILPWRPSGKQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRS-TSKECGVPINKKVD 340
           I PWRPS +  YIKSFNL I   Y CI+EIGKSRDL  C + V+S   K CG PINK  D
Sbjct: 288 IAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKD 347

Query: 341 RCCEYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYS 400
           +CCE+HRE E R   +KR++L+G +ALGAPTK ++ P+LY+  T  N+          YS
Sbjct: 348 KCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKT-NNI----------YS 396

Query: 401 QNNPHLIDKYGEK----SKF----FSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRK 452
           +N  +++ +   +    SK     F + N AKAFF+DEFQNPD+ISNLD+KRRK+ + ++
Sbjct: 397 KNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKR 456

Query: 453 SNVLNRELDRLLRKD----QDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISR 508
            + L +EL++ L K+    ++LEGK++E+V++M+  T+  +Q G+ + +G+DPT GK+  
Sbjct: 457 DSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKY 516

Query: 509 ILKNKERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFG 567
           ++K   +S   +P + S +   V+DL+ FKK+ + L P K DLL KK KR+++W E FG
Sbjct: 517 LMK---KSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFG 572

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  483 bits (1243), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 262/581 (45%), Positives = 374/581 (64%), Gaps = 33/581 (5%)

Query: 2   SDPREIAPNDLYQNIT-PDKEDARRIELELEKIENVKRDLLERL--HRKKIEIERRDPNF 58
           +DPRE+   D Y +++  DKE    I+ ELE IE  K+DL+ RL  +++K+  ++ DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  TG------VQVPASPVKKHELQLVEQKDQKLKNINRFEESN---ENPNELCLQQRFQKQT 109
                   V+VP SP K+  L   E     +  +   + +N    NPNE   +   +K+ 
Sbjct: 67  KNINSRGRVEVPRSP-KRESLPAQENLQHNVPQVTHNQAANNKKANPNE---EDIVRKEL 122

Query: 110 ARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELE 169
               D  A+T YF  KF+++K  E   +  ++ MM +R HTFNG    ++ + +  DELE
Sbjct: 123 ----DVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELE 178

Query: 170 QYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSD 229
            YSN  I KRY P   +  +LH +KILRLNKLFAKVRPP F EPQYSNWV +G +S K D
Sbjct: 179 PYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKED 238

Query: 230 IKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSG 289
           +K T + KP KY KFTLTDF+H +D Y+FGK+ VERYYNLR+GDIIAVLNPEILPWRPSG
Sbjct: 239 VKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSG 298

Query: 290 KQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREM 349
             N IKSFNLRI H + CILEIG SRDL  C +V    SK C  PIN K DRCCE+HRE+
Sbjct: 299 CVNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHREL 358

Query: 350 EIRKGPSKRLDLSGQYALGAPTKLESQPALY----RGHTAQNVKIQNFKLTPSYSQNNPH 405
           ++R   SKR++LSG YALGAPTK+ +QP++Y    +       K + F +T  +      
Sbjct: 359 QMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSIT-GHGSKKEQ 417

Query: 406 LIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLR 465
             +K+  ++  FSN+ AAKAFFDD FQ+P +++NL++KRRKI    K++ ++R L + L 
Sbjct: 418 EKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALN 473

Query: 466 KDQDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLS 525
            +   + K +++V   K+ T++TLQ+G+ Q++GFDP+GG+I+++L     +K  +P  +S
Sbjct: 474 GEDASQSKNKQQV---KEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPT-IS 529

Query: 526 QKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566
           +K   ++DL+ FKK+ I L PS+   L K+++RE +W+++F
Sbjct: 530 KKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF 570

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  458 bits (1179), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 243/531 (45%), Positives = 333/531 (62%), Gaps = 24/531 (4%)

Query: 41  LERLHRKKIEIERRDPNFTGVQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELC 100
           ++RL  KK + ++ DPNFT +Q+  SP KK            LK   R  E + NPNE  
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLK---RLVE-DVNPNE-- 54

Query: 101 LQQRFQKQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEY 160
                 K  +  N    +T YFM+ F  AK++E   +++++  M SRVH+F G     +Y
Sbjct: 55  -----AKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKY 109

Query: 161 QHVIVDELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVV 220
           Q +IV+ELE+YS   I+KRY P   +   LH +KILRLNKLFAK+RPPKF EP Y+NW V
Sbjct: 110 QSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAV 169

Query: 221 VGIVSDKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNP 280
            GI+  K DIK T+S  P K+ KFT+T+F+H +D +IFG  GVE+YYNLR+GDII +LNP
Sbjct: 170 TGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNP 229

Query: 281 EILPWRPSGKQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVD 340
           E+LPWRP  K N IKSFNLRISH + CILEI +S+D+A C  + R T  +C  PINK   
Sbjct: 230 EVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQ 289

Query: 341 RCCEYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKI-QNFKLTPSY 399
             C+YH+EM+ R   +KR++LSG YALGAPT+++S+PALYR     N+K   NF +    
Sbjct: 290 DVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADR 349

Query: 400 SQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRE 459
                   D    K   FS+ N+AKAFFD++FQNPDM+ NL+NKRRKI + ++  +L R 
Sbjct: 350 RYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRA 409

Query: 460 L------DRLLRKDQDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNK 513
           L       +LL KD     K+ +E++ M+ TT  TLQ+G  QK+GFDPTGG+I  +L+ K
Sbjct: 410 LRESVGNSKLLLKD-----KSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLE-K 463

Query: 514 ERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQE 564
              K  + K   QK   +++L+ FKK  + L PS+  LL K + RE+ + +
Sbjct: 464 SADKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQ 514

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  431 bits (1109), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 236/573 (41%), Positives = 351/573 (61%), Gaps = 28/573 (4%)

Query: 2   SDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTGV 61
           +DPRE+   D++  +T D+++  +I+ +L+++E  +RDL +RL +K    + +  +   V
Sbjct: 5   TDPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERV 64

Query: 62  QVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTEY 121
           +VPASP ++ + +   Q  +  K I     SN +  E+  +          N  + +T Y
Sbjct: 65  EVPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWK----------NGPSNTTSY 114

Query: 122 FMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRYT 181
           F+E F +A++ E+  I+   S++  RVHTF GI+     Q V VDE E YS   I++RY 
Sbjct: 115 FVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYM 174

Query: 182 PVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQKY 241
             S L  ++ E+K+LRL KLF+KVRPPKF EP Y+NWV +GI+S KS++K T+S+KP KY
Sbjct: 175 STSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKY 234

Query: 242 LKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQN------YIK 295
            K TLTDF H +D YIF  + VE+YYNLR+GDIIA+LNP+ILPWRPS   N       +K
Sbjct: 235 FKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVK 294

Query: 296 SFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGP 355
           SFNL I H + C+LEIG S+DL  C I  ++T K CG PIN+     CEYH+++  R   
Sbjct: 295 SFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVN 354

Query: 356 SKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSK 415
           ++R++L+G  +L +P K   + ALY G +    K+Q   L P   ++ P   D   + + 
Sbjct: 355 AQRVELNGSTSLRSPVKNGKKQALY-GTSGVKRKLQ---LLP--DKHAPQAQDGESQNTL 408

Query: 416 FFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKD--QDLEGK 473
           FFSN N AKAFFDD +QNPDM++NL+NKRRK+ +  K   L  +L+  + K   Q    K
Sbjct: 409 FFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNK 468

Query: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDD 533
           ++EE ++MK  T++ L SGL + +GFDP  GK+  +LK  +    G    L+ K   V +
Sbjct: 469 SKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSG----LNSKSSQVKE 524

Query: 534 LMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566
           +M+FKK  + LAPSK +   +  +RE+VW+E+F
Sbjct: 525 IMSFKKSNVSLAPSKAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/574 (41%), Positives = 347/574 (60%), Gaps = 30/574 (5%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60
           M DPRE    D++  ++ D++D   +   L+++E  K+DL +RL       ++ DPNF+G
Sbjct: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120
           V+VP SP K   + + E    K    + F  ++EN NEL +Q++     A L  S+ ST 
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFP-AHENLNELQVQKK-----ASL--SSISTP 110

Query: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180
           YF + F  +K+ ++V   +   M+  RVHTF+G +   EY  + V+E E++S  WI+KRY
Sbjct: 111 YFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRY 170

Query: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240
                 + +L E K+LRL KLFAKVRPP F EPQYSNWV +GI+S KS +K T   KP +
Sbjct: 171 ITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSR 230

Query: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPS------GKQNYI 294
           Y   TLTDFKH ++ Y+FG + VE+YYNL++GDIIAVLNPEI PWRPS        Q  I
Sbjct: 231 YFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVI 290

Query: 295 KSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKG 354
           KSFNL I H +  ILEIG SRD   C I  +   K CG PINK V+  C YH+E++ R+ 
Sbjct: 291 KSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQV 350

Query: 355 PSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKS 414
            +KRL+L+G  +L +PTK   +  LY  +     K   + L P   +  P    K  +  
Sbjct: 351 NAKRLELNGNKSLRSPTKNGVKHILYGKN-----KSGKYDLLP--DRYAPQTQSKDSQNV 403

Query: 415 KFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQD--LEG 472
            +FSN NAA+AFFDD++QNPD ++NLD+KRRK+   +K  +L ++L +++ K      + 
Sbjct: 404 LYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKN 463

Query: 473 KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVD 532
           +T  + +++++ T+  L+SGL +K+GFDPT G++S +LKN  +    +      K+  V+
Sbjct: 464 ETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQA-----KNSAVE 518

Query: 533 DLMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566
           +++  KKE I L PSK  L  K  KRE+VW  +F
Sbjct: 519 EILQIKKEKIELKPSKEALRQKFKKREEVWNHHF 552

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  375 bits (964), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 286/453 (63%), Gaps = 20/453 (4%)

Query: 123 MEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRYTP 182
           ME F ++++ E+  I+    M+ SRVHTF G++     + + V+E E  S LW+++RY  
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 183 VSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQKYL 242
              L  +L ++KILRL KLF+KVRPPKF EP Y+NWV VGI+  KS +K T+S+KP KY 
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 243 KFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQN------YIKS 296
           K T+TDF H +D Y+F    VE+YYNLR+GDIIA+LN +ILPWRPS   N       +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 297 FNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINK-KVDRCCEYHREMEIRKGP 355
           FNL I   Y C+LEIG SRDL  C I  ++  K CG PIN+  VDR C+YH+E+  R+  
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDR-CDYHQEIRFRQVN 239

Query: 356 SKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSK 415
           ++R++L+G  +L +P K   + ALY G +    K+    L P   ++ P   D+  + + 
Sbjct: 240 AQRVELNGSMSLRSPVKNGKKQALY-GSSGVKRKLN---LLP--DKHAPQQQDRESQNTL 293

Query: 416 FFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKD--QDLEGK 473
           +FSN N AKAFFDD +QNPD++ NLD+KRRK+ +      L  +L R L KD  Q    K
Sbjct: 294 YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEK 353

Query: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDD 533
           T++E ++MKQ T++T+ SGL + +GFDPT GK+  +LK  + SK+        K   V +
Sbjct: 354 TKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNS----TDTKSIQVRE 409

Query: 534 LMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566
           ++  +K  + LAPSK D   +  +RE+VW+E+F
Sbjct: 410 IIETRKTNVSLAPSKADQKKRLLRREQVWKEHF 442

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  350 bits (897), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/598 (34%), Positives = 331/598 (55%), Gaps = 55/598 (9%)

Query: 1   MSDPREIAPNDLYQNITPDKEDA-----------------------RRIELELEKIENVK 37
           ++DPREI P   Y +I  D+ED                          ++L L++IE+ +
Sbjct: 6   LNDPREIVPTSNY-DILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  RDLLERLHRKKIEIERRDPNFTGVQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPN 97
            DLL RL   K   +++      V+VP SP K    + VE +            ++ +  
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKA---KCVEDEPAP--------STSASTT 113

Query: 98  ELCLQQRFQKQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPK 157
            +   +  + +   L+ +  +T YF EKF  A+      + + + ++K RV+TF+  +  
Sbjct: 114 YVEEPEENENERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTA 173

Query: 158 NEYQHVIVDELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSN 217
            EY    VDE+E YSN+ INKRY P  +LK +LH++K+LRL KLFAKVRPPKF EP Y+N
Sbjct: 174 IEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYAN 233

Query: 218 WVVVGIVSDKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAV 277
           WV +G +S KSD+K T+  KP KY    +TDF + V   +FG++ VE+YY LR+GD+IA+
Sbjct: 234 WVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAI 293

Query: 278 LNPEILPWRPSGK------QNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKEC 331
           LNPEI PW+ S K      +   +SF L I H   CILEIG S++L  CP + ++    C
Sbjct: 294 LNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPC 353

Query: 332 GVPINKKVDRCCEYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQ 391
           G PINK  ++ C YH+E  +R   +KR++L+G  +L APT+   Q A Y    +   KI 
Sbjct: 354 GAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKI- 412

Query: 392 NFKLTPS-YSQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQ 450
              L P  Y+   P    K+ E    F++ NA +A+FD ++ NPD++ NL++KRRKI   
Sbjct: 413 --GLLPDVYAPRAPGAEQKFRE---HFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLS 467

Query: 451 RKSNVLNRELDRLLRKD--QDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISR 508
           +K   +N++L  +L K+  Q  +  + E +++ ++ T+  +++G+ + +GFDPTGG+++ 
Sbjct: 468 KKDQQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAA 527

Query: 509 ILKNKERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566
           +L   +          + ++ ++ +++A KK  I L PSK     +  +R +V+   F
Sbjct: 528 VLYQGDHGPAD-----TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  339 bits (870), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/581 (36%), Positives = 332/581 (57%), Gaps = 47/581 (8%)

Query: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERR----DP 56
           ++DPREI   D Y+ ++ D+ +  R++  + +I+  KRDL  RL    +E+E++    DP
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRL----LELEKKRNLKDP 60

Query: 57  NFTGVQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSN 116
           NF  + VP SP K        +  + +  +   EE+  N NE  ++++ +K         
Sbjct: 61  NFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL-------- 112

Query: 117 ASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWI 176
            +T YF EK R     E   I++ + ++  RV+TFNG +  +EY+ + VDE +  S L I
Sbjct: 113 GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVI 171

Query: 177 NKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASN 236
           ++RY P++ L+     +K+LRL KLF+KVR PKF EP Y NW+V+GI+S K++ + T S 
Sbjct: 172 DRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSV 231

Query: 237 KPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWR--PSGKQNYI 294
           KP K+   T++DF+ +++   FGK  VE+YY LR+GD+IA+LNPEI+P +   +G     
Sbjct: 232 KPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSY 291

Query: 295 KSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKG 354
            +F+L++S     ILE+G S++   C   +++  K CG PINK  D  C YH+E ++R+ 
Sbjct: 292 ATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQN 351

Query: 355 PSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQ--NFKLTPSYSQN--NPHLID-K 409
            S+R+++S   A+ AP        + +G+    VK Q  N K +  Y QN   P + +  
Sbjct: 352 SSRRVEISSSVAMRAP--------VVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPA 403

Query: 410 YGEKSKF-FSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNREL----DRLL 464
             E ++F FS+ NA+ AFFDD+++NPD+++NLDNKRRKI E R +  L ++L    D+LL
Sbjct: 404 AAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLL 463

Query: 465 RKDQDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGE-PKF 523
            K +D     R   E  K  T    Q GL  ++G+DPT GK S  L+  E S + + PK 
Sbjct: 464 SKKED-----RVNQEAKKTATLSMFQHGLANQIGYDPTKGKAS--LEMLEYSTENKAPK- 515

Query: 524 LSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQE 564
            + K   + D+   KK+ + L PSK  L  K  KR  ++ E
Sbjct: 516 -NDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNE 555

>ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] {ON}
            similar to uniprot|P18963 Saccharomyces cerevisiae
            YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
            YOL081w IRA2
          Length = 2994

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 7/94 (7%)

Query: 122  FMEK--FRDAKRKEKVHIEKHESMMKSRV----HTFNGIEPKN-EYQHVIVDELEQYSNL 174
            FM +  FR     +  +   HESM    +     TF+    KN E + +I    + Y+ +
Sbjct: 1929 FMSRHAFRSIAVFDTTNTFVHESMSSDGLPIITLTFSSFRSKNIEIETIIYRTFQIYARI 1988

Query: 175  WINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPP 208
            W  K Y  +       HE+ +++L  LF  + PP
Sbjct: 1989 WSVKYYLVLDCTHFDEHEIDVVKLTSLFNNLVPP 2022

>ZYRO0B13332g Chr2 complement(1080477..1081652) [1176 bp, 391 aa]
           {ON} similar to uniprot|Q06697 Saccharomyces cerevisiae
           YLR418C CDC73 Substituent of the Paf1 complex together
           with RNA polymerase II Paf1p Hpr1p Ctr9 Leo1 Rtf1 and
           Ccr4p distinct from Srb-containing Pol II complexes
           required for the expression of certain genes and
           modification of some histones
          Length = 391

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 63  VPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQ 102
            PA  VK H L+  EQKD +L+N +  EE   N +++ LQ
Sbjct: 120 TPAVEVKDHALESGEQKDSRLENPHGGEEQAANGHDVALQ 159

>Kpol_1023.103 s1023 (243143..245659) [2517 bp, 838 aa] {ON}
           (243143..245659) [2517 nt, 839 aa]
          Length = 838

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 226 DKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNL-RIGDIIAVLN 279
           DK  I FT  N  + + KF + D K K+D ++   E V  +  L ++GDI+ ++N
Sbjct: 423 DKDLIIFTVDNLVETFEKFKVHDEKWKLDIFLKVLELVGSFITLEKLGDILIIIN 477

>TPHA0C01870 Chr3 (428204..428905) [702 bp, 233 aa] {ON} 
          Length = 233

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 400 SQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIME-QRKSNVLNR 458
           + NN  +I   G + +    R A K  F +   NPD+ +  DN  ++I+E +    ++ R
Sbjct: 24  ANNNDSIIK--GIRRRLVVLRKARKELFSNSDANPDITN--DNDLKEILEFEENEGIIRR 79

Query: 459 ELDRLLRKDQDLEGKTREEV 478
            ++R  ++  DLEG+T  ++
Sbjct: 80  AIERYTKELADLEGQTTSKI 99

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 17/144 (11%)

Query: 425 AFFDDEFQN-PDMISNLDNKRRKIMEQRKSNV------LNRELDRLLRKD-QDLEGKTRE 476
           +F D++F+   D+I        + M++  SN+      L      LL K+ Q L GK ++
Sbjct: 635 SFVDEKFEEVTDIIKATCENLVRTMDEHVSNMKLETTDLTSSCASLLEKECQALHGKLQK 694

Query: 477 EVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMA 536
            VE MKQ    TLQ  + + +       K S +L   + +KDG    +S K     DL +
Sbjct: 695 YVESMKQELNSTLQE-MVRDLDM-----KASSMLNVVQCTKDG---LISHKKELEADLES 745

Query: 537 FKKEYIILAPSKVDLLNKKNKREK 560
            K+E+  +A +  + L K   +E+
Sbjct: 746 QKREHFDIAQTMEEQLQKIVGKER 769

>NCAS0B07280 Chr2 complement(1375883..1377523) [1641 bp, 546 aa]
           {ON} Anc_1.349 YFR028C
          Length = 546

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 258 FGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKS----FNLRISHPYKCILEIGK 313
           F  E  E++  +  GD   +L PE + +    ++N+ K     FN  ++ P+KC+LE  K
Sbjct: 162 FNLEAYEKFECVENGDF-NILTPEFIAFASPQEENFNKMAYQRFNKALNRPFKCVLEAFK 220

Query: 314 SRDLARCPIVVRSTS 328
            +++    +VVR  S
Sbjct: 221 EQNVQ---LVVRLNS 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,955,413
Number of extensions: 3296933
Number of successful extensions: 15480
Number of sequences better than 10.0: 290
Number of HSP's gapped: 16281
Number of HSP's successfully gapped: 323
Length of query: 584
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 469
Effective length of database: 40,294,809
Effective search space: 18898265421
Effective search space used: 18898265421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)