Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D022005.707ON1821829561e-133
KNAG0L021605.707ON2091191562e-12
ZYRO0B16434g5.707ON2371751113e-06
NDAI0F002705.707ON2981541019e-05
SAKL0E15026g5.707ON290147947e-04
TBLA0I016905.707ON32099930.001
TDEL0B021305.707ON208123810.026
TPHA0E001805.707ON16595760.12
NCAS0G002105.707ON288116740.25
TBLA0C017808.661ON888134710.90
YIL152W5.707ON235107691.0
Smik_9.175.707ON251108691.3
TPHA0D011708.661ON91594672.6
KNAG0A029808.661ON87199672.9
ZYRO0F02684g8.21ON18673652.9
NDAI0J00450singletonON15552653.1
ZYRO0F07018g8.661ON86199673.1
Ecym_22396.177ON980111654.7
KLTH0E00946g5.707ON21578636.2
Skud_15.2965.466ON545118646.7
KLTH0G01452g3.534ON607114639.0
NDAI0F022906.186ON42241629.3
TBLA0A031405.355ON124550639.6
NOTE: 6 genes in the same pillar as KAFR0D02200 were not hit in these BLAST results
LIST: Kpol_1043.74 Skud_9.16 Suva_9.36 Kwal_55.19675 KLLA0A00506g Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02200
         (182 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...   372   e-133
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    65   2e-12
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    47   3e-06
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    44   9e-05
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    41   7e-04
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    40   0.001
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    36   0.026
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    34   0.12 
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    33   0.25 
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    32   0.90 
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    31   1.0  
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     31   1.3  
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    30   2.6  
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    30   2.9  
ZYRO0F02684g Chr6 complement(216318..216878) [561 bp, 186 aa] {O...    30   2.9  
NDAI0J00450 Chr10 (81098..81565) [468 bp, 155 aa] {ON}                 30   3.1  
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    30   3.1  
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    30   4.7  
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    29   6.2  
Skud_15.296 Chr15 (529599..531236) [1638 bp, 545 aa] {ON} YOR132...    29   6.7  
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    29   9.0  
NDAI0F02290 Chr6 complement(553379..554647) [1269 bp, 422 aa] {O...    28   9.3  
TBLA0A03140 Chr1 (746259..749996) [3738 bp, 1245 aa] {ON} Anc_5....    29   9.6  

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score =  372 bits (956), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MTALLQSRYDVNKNCVEHTRRNLEFIKSSMNSTHCLKNSKETQGRTQVITILNNSEVKKM 60
           MTALLQSRYDVNKNCVEHTRRNLEFIKSSMNSTHCLKNSKETQGRTQVITILNNSEVKKM
Sbjct: 1   MTALLQSRYDVNKNCVEHTRRNLEFIKSSMNSTHCLKNSKETQGRTQVITILNNSEVKKM 60

Query: 61  TFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRL 120
           TFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRL
Sbjct: 61  TFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRL 120

Query: 121 SSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNWKL 180
           SSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNWKL
Sbjct: 121 SSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNWKL 180

Query: 181 LQ 182
           LQ
Sbjct: 181 LQ 182

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 62/119 (52%), Gaps = 7/119 (5%)

Query: 69  RPHLNLLDEC----NKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTE 124
           RPHL+ + E         +L   LQ+SL  LN LV  + +++ YD L+ V    +LSS E
Sbjct: 88  RPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHE 147

Query: 125 MLIIPSTDEAMRYILHKPLTFRTNSVDNFT--GAHLALNSKISFRLDDTLIWCLNWKLL 181
            L++ +   + RY+LH         +D     G  +AL SK++ R+   L WCL WKL+
Sbjct: 148 -LMLETGHSSKRYVLHSNGPVHGFLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 78/175 (44%), Gaps = 26/175 (14%)

Query: 28  SSMNSTHCLKNSKETQGRTQVITILNNSEVKKMT-------FARHWNERPHLNLL----- 75
           SS+N    +  S+E+     + +IL NS+V K++        AR  + R    L      
Sbjct: 68  SSINQKSYVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGEDIRDSYTLRRRIRD 127

Query: 76  --DEC-----NKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLII 128
             ++C      K  +L   L  +L D N +V  S+ N+ YD+L+ +  A  LS  E+++I
Sbjct: 128 DNEKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVI 187

Query: 129 PSTDEAMRYIL--HKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNWKLL 181
                  R IL  HK +    NS      + LA+ SK    L + + W L WK L
Sbjct: 188 SDDPRVKRAILHSHKAIPKFVNS-----PSRLAICSKCCLTLYNDMNWYLKWKFL 237

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 72/154 (46%), Gaps = 16/154 (10%)

Query: 38  NSKETQGRTQVITILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLN- 96
           +SK   G   +      S  K  +  R +   P  +L  E NKP +L  SLQKSL DL+ 
Sbjct: 151 DSKNGIGSKIIKAKFRKSHFKLGSVTRKYELFPLQDL--EQNKPSALLQSLQKSLCDLDT 208

Query: 97  ALVTVSKNNKKYDLLIKVASARRLSSTEMLIIP--------STDEAMRYILHKPLTFRTN 148
           +L T+S ++  YD L+ V S   LS  E+ I          +TD  M  +LH  ++    
Sbjct: 209 SLKTLSYHS--YDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDVTM--LLHSKISLNVP 264

Query: 149 SVDNFTGAH-LALNSKISFRLDDTLIWCLNWKLL 181
             +N    + LAL+SK+   L   + W L WK +
Sbjct: 265 LPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (44%), Gaps = 21/147 (14%)

Query: 38  NSKETQGRTQVITILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNA 97
           NS  T GRT       +S V++           H       +K  S+   LQKSL D N 
Sbjct: 152 NSTSTDGRTGGTKFTGSSNVQRYL---------HPEFSASLSK-DSMLFRLQKSLCDFNT 201

Query: 98  LVTVSKNNKK--YDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTG 155
           +  +S +  K  YD+++ V   ++LS  E+L+I S++ A   +LH+   F+  +    T 
Sbjct: 202 VYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVI-SSECAHAIVLHR---FKNKAFPR-TE 256

Query: 156 AH----LALNSKISFRLDDTLIWCLNW 178
            H    L L+S+    L   L W  NW
Sbjct: 257 KHRVLKLHLDSRSEIELYPGLYWYSNW 283

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 84  LAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPL 143
           L   L   L +LN  +  S+N  K+D + +++   +LS TE+L+I +T+ ++  +LH   
Sbjct: 225 LVNGLHTILSNLNTRIHSSRN-LKFDKIFQISKLTKLSDTELLVITNTNSSL--LLHSDS 281

Query: 144 TFRTNSVDNFT-GAHLALNSKISFRLDDTLIWCLNWKLL 181
           T   +  +N+T    +A NS    ++ + L W L WK +
Sbjct: 282 TIGQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKFI 320

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 9/123 (7%)

Query: 63  ARHWNERPHLNLLD----ECNKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASAR 118
           AR    +PHL        E ++  SL+ ++  +L  LN  + V     + D L+      
Sbjct: 91  ARGRRVKPHLRRSRDQGLETSRDKSLSTAVSVALSHLNTRIQVLSG--ELDQLMAFERLV 148

Query: 119 RLSSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNW 178
            LS  E+L++  T   + ++LH  +      V  F    LA+NS+  + L + ++W + W
Sbjct: 149 LLSQHELLVV--TQRKI-FVLHSVIPLTREGVSRFGALKLAVNSQCYYVLYNDVVWFMRW 205

Query: 179 KLL 181
           K  
Sbjct: 206 KFF 208

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 7/95 (7%)

Query: 88  LQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPLTFRT 147
           L+ S+   N L+  S N  KYD +  + S  +LS  E ++  +T ++   ILH       
Sbjct: 62  LRLSINKFNMLLKASSN--KYDEIHDINSIEKLSQNEFIV--TTIDSKTLILHSNEKNVV 117

Query: 148 NSVDNFTGAH--LALNSKISFRLDDTLIWCLNWKL 180
           NS +N+T  +  +A+NSK    L + L W L+WK 
Sbjct: 118 NS-NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 15/116 (12%)

Query: 79  NKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYI 138
           N+P     SLQK L DL+ ++  SK    YD +  + S  +LS  E+ +       +  I
Sbjct: 172 NEPKIFVTSLQKYLCDLDTMMKTSKKFS-YDSVWTINSITKLSDFELQVTTQMSPQL-II 229

Query: 139 LHKPLTFRTNSVDNFT-------------GAHLALNSKISFRLDDTLIWCLNWKLL 181
           LH   +     +  F                 LA+NSK   ++ D + W ++WK +
Sbjct: 230 LHNKTSINNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285

>TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {ON}
           Anc_8.661 YPL147W
          Length = 888

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 36/134 (26%)

Query: 51  ILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDL-----NALVTVSKNN 105
           +L+  E ++M FAR    RP   +LDE    +S  I ++  L++L        VT+S+  
Sbjct: 757 LLSGGEKQRMNFARILFHRPKFIILDEATNAIS--IDMEDYLFNLLKRYRFNFVTISQRP 814

Query: 106 ---KKYDLLIKV-----ASARRLSSTEM------LIIPSTDEAMRYILHKPLTFRTNSVD 151
              K +DLL+++     +    ++STE+      L    TDEA+            NS+D
Sbjct: 815 SLIKYHDLLLEINHSSNSDDTLVTSTEVPLSTWKLQTVGTDEAI------------NSID 862

Query: 152 NFTGAHLALNSKIS 165
           N     L LN K+S
Sbjct: 863 N---EILQLNEKLS 873

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 17/107 (15%)

Query: 84  LAISLQKSLWDLNALVTVSKNNKKYDLLIK-VASARRLSSTEMLIIPSTDEAMRYILHKP 142
           L   L  S+ DL+A++   K   K+D +I+  + A  LSS E+LI    D+ +  ILH  
Sbjct: 137 LVSQLHSSVKDLDAIIQTHK--PKFDTIIRDFSQATILSSNELLIKLPKDQTI--ILHS- 191

Query: 143 LTFRTNSVD--------NFTGAHLALNSKISFRLDDTLIWCLNWKLL 181
              R   ++        N   A L ++S+    L + + W L+WK +
Sbjct: 192 ---RAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 19/108 (17%)

Query: 84  LAISLQKSLWDLNALVTVSKNNKKYDLLIK-VASARRLSSTEMLIIPSTDEAMRYILHKP 142
           L   L  S+ DL+A++   K   K+D +I  ++    LSS E+LI    +E +  ILH  
Sbjct: 153 LVSQLHSSVKDLDAIIQTHK--PKFDTIIHDLSRTTILSSNELLIKLPMEETI--ILHS- 207

Query: 143 LTFRT---------NSVDNFTGAHLALNSKISFRLDDTLIWCLNWKLL 181
              RT         N V N  GA L ++S+    L + + W L+WK +
Sbjct: 208 ---RTPTINEEWLHNKVSN-PGASLVIDSRSFLILCNNIKWYLHWKFI 251

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 51  ILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAIS------LQKSLWDLNALVTVSKN 104
           +L+  E ++M FAR    +P   +LDE    +S+ +       L+K  ++  ++      
Sbjct: 793 VLSGGEKQRMNFARILFHKPRFVILDEATNAISVDMEDYLFKMLKKYRFNFISISQRPSL 852

Query: 105 NKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYI 138
            K +DLL++++  +    T  L    TDEA+  I
Sbjct: 853 VKYHDLLLEISEDKE--GTWTLQTLGTDEAISSI 884

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 13/99 (13%)

Query: 51  ILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDL-----NALVTVSKNN 105
           +L+  E ++M FAR    +P   +LDE    +S    ++  L+++      + +T+S+  
Sbjct: 750 VLSGGEKQRMNFARILFHKPKFIVLDEATNAIS--ADMEDYLFNMLKKFRFSFITISQRP 807

Query: 106 ---KKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHK 141
              K +D+L+++A        + L    TDEA+  I H+
Sbjct: 808 SLIKYHDMLLEIADRDGKWQLQTL---GTDEAITTIDHE 843

>ZYRO0F02684g Chr6 complement(216318..216878) [561 bp, 186 aa] {ON}
           similar to uniprot|Q12133 Saccharomyces cerevisiae
           YLR066W SPC3 Subunit of signal peptidase complex (Spc1p
           Spc2p Spc3p Sec11p) which catalyzes cleavage of
           N-terminal signal sequences of proteins targeted to the
           secretory pathway homologous to mammalian SPC22/23
          Length = 186

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 110 LLIKVASARRLSSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSKISFRLD 169
           + I + S  +L S +  ++PST E+++      L+FRT+            N+KI+F L+
Sbjct: 24  VFIAITSWFQLQSQDADLVPSTIESIK----PSLSFRTSRYYGSVNGKPKENAKITFDLE 79

Query: 170 DTLIWCLNWKLLQ 182
             L     W   Q
Sbjct: 80  TDLTPLFTWNTKQ 92

>NDAI0J00450 Chr10 (81098..81565) [468 bp, 155 aa] {ON} 
          Length = 155

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 51  ILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNALVTVS 102
           ILNN+EVK +T  R     P    L EC   + + + ++ +L +LN    +S
Sbjct: 104 ILNNNEVKCLTLLRKRAPSPLPITLPECETHIKIYVDIRHNLRELNQKFRIS 155

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 30.4 bits (67), Expect = 3.1,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 14/99 (14%)

Query: 51  ILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNA-----LVTVSKNN 105
           +L+  E ++M FAR    RP   +LDE    +S  + ++  L++L        +T+S+  
Sbjct: 741 VLSGGEKQRMNFARILFHRPRFVVLDEATNAIS--VDMEDYLFNLLKRYRFNFITISQRP 798

Query: 106 ---KKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHK 141
              K +D+L++V S    S +  L    T EA+  I H+
Sbjct: 799 SLIKYHDMLLEVDS----SGSWQLQALGTVEAITSIDHE 833

>Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}
           similar to Ashbya gossypii AFL056C
          Length = 980

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 20/111 (18%)

Query: 52  LNNSEVKKMTFARHWNERPHLNLLDEC-----NKPVSLAISLQKSLW-----------DL 95
           LN+ + +      HW ER H+  +  C     N  VS     +  LW           DL
Sbjct: 665 LNHFDPRSGNITIHWTERQHVGGMQRCKFINNNFLVSCGAKEELFLWEITESPERPYIDL 724

Query: 96  NALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPS--TDEAMRYILHKPLT 144
           N  +  S NN   DL I   S   + ST+  I+ +  +D +++  +++P T
Sbjct: 725 NTKLPFSSNNP--DLRIMDFSYLFIESTKKFILATVYSDSSVKIWVYQPKT 773

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 107 KYDLLIKVASARRLSSTEMLII---PSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSK 163
           +YD  + V   + LS TE+L +   P   E +  ILH  +   T   +  +G+ L L+S 
Sbjct: 142 EYDRKLHVQYTKLLSPTELLAVAAGPLGREVL--ILH--MLPSTKDAEPKSGSQLLLSSN 197

Query: 164 ISFRLDDTLIWCLNWKLL 181
            S  L   L W   W+++
Sbjct: 198 ASALLYPGLRWYFEWRVI 215

>Skud_15.296 Chr15 (529599..531236) [1638 bp, 545 aa] {ON} YOR132W
           (REAL)
          Length = 545

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 18/118 (15%)

Query: 10  DVNKNCVEHTRRNLEFIKSSMNSTHCLK----NSKETQGRTQVITILNNSEVKKMTFARH 65
           D++ N     + + E I ++ + +  +     N++E  G  Q I+ +N+++ +  T ++ 
Sbjct: 12  DLDNNPFAEPQEDSEPIATNTDGSSSMVKEQINAEEAIGSDQAISTVNSAQNENATQSKT 71

Query: 66  WNERPHLNLLDECNKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSST 123
            +E+         NK   LA  L++     + L   S   KKY LL+KV    R  ST
Sbjct: 72  SSEQ-------SGNK--QLAQPLER-----DVLPERSDEKKKYSLLVKVVGLERFGST 115

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 28.9 bits (63), Expect = 9.0,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 6/114 (5%)

Query: 6   QSRYDVNKNCVEHTRRNLEFIKSSMN--STHCLKNSKETQGRTQVITILNNSEVKKMTFA 63
           Q + D+NK+ +E  R     I            +     +G+T  +  L+  +  ++ FA
Sbjct: 465 QEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLGRYGLTGEGQTSQMGTLSEGQRSRVVFA 524

Query: 64  RHWNERPHLNLLDECNKPVSLAI--SLQKSLWDLNALVTVSKNNKKYDLLIKVA 115
               + P++ LLDE    + +A   SL +++ D N  V V  ++  + LL K+A
Sbjct: 525 LLALQAPNVLLLDEPTNGLDIATIDSLAEAINDFNGGVVVVSHD--FRLLDKIA 576

>NDAI0F02290 Chr6 complement(553379..554647) [1269 bp, 422 aa] {ON}
           Anc_6.186
          Length = 422

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 103 KNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPL 143
           KNN K+ + IK  S  R SST   + P   +    I HKPL
Sbjct: 32  KNNSKFSV-IKPVSNLRTSSTAEFVTPPNSKLQSLIWHKPL 71

>TBLA0A03140 Chr1 (746259..749996) [3738 bp, 1245 aa] {ON} Anc_5.355
            YHR073W
          Length = 1245

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 87   SLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMR 136
            S Q++LW++  LV   K  KKY      A+   ++  E  ++P TD  +R
Sbjct: 1125 SSQETLWEVGELVKSPK--KKYGFTKFAANLNEITEIEKDMLPPTDSRLR 1172

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,529,561
Number of extensions: 784844
Number of successful extensions: 2724
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2764
Number of HSP's successfully gapped: 51
Length of query: 182
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 79
Effective length of database: 41,670,801
Effective search space: 3291993279
Effective search space used: 3291993279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)