Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D021905.709ON42642622840.0
NCAS0G002005.709ON43840210271e-136
NDAI0F002405.709ON4643289771e-128
Kpol_2001.775.709ON4134129601e-127
TDEL0B021105.709ON3893909501e-125
Suva_9.355.709ON3933489441e-124
Skud_9.155.709ON4023369411e-124
YIL153W (RRD1)5.709ON3933259391e-124
SAKL0E15070g5.709ON3853769261e-122
Smik_9.165.709ON3933259171e-120
ZYRO0B16478g5.709ON3913819111e-120
KLTH0E00880g5.709ON3713809051e-119
KNAG0L021705.709ON3963638971e-117
TPHA0D046505.709ON4214018841e-115
TBLA0E016905.709ON4883398861e-114
Ecym_40125.709ON3953888641e-112
CAGL0H06655g5.709ON4243678621e-112
Kwal_55.196615.709ON3713998491e-110
AFR293C5.709ON3653228341e-108
KLLA0A00462g5.709ON3533208131e-105
NCAS0C016908.674ON3593064416e-50
ZYRO0F07326g8.674ON3523254382e-49
KAFR0H024408.674ON3533354312e-48
KLLA0F11187g8.674ON3603064224e-47
Kpol_1013.48.674ON3583024215e-47
NDAI0E024108.674ON3593034215e-47
SAKL0H06622g8.674ON3553044191e-46
KLTH0D11176g8.674ON3532984191e-46
TDEL0A062008.674ON3553264181e-46
TBLA0C018608.674ON3563084181e-46
KNAG0J016908.674ON3633084145e-46
CAGL0M02255g8.674ON3583064129e-46
Ecym_23998.674ON3512714102e-45
TPHA0D012408.674ON3593154042e-44
Suva_16.1588.674ON3583124023e-44
Kwal_26.87838.674ON3553123962e-43
Smik_6.3498.674ON3583113953e-43
YPL152W (RRD2)8.674ON3583133831e-41
Skud_16.1308.674ON3583073813e-41
ACR139C8.674ON3592333718e-40
ADL248C2.253ON152895800.34
YBL063W (KIP1)7.387ON1111101696.0
KAFR0C028308.163ON164860687.7
Suva_2.737singletonON63561679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02190
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   884   0.0  
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      400   e-136
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      380   e-128
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   374   e-127
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   370   e-125
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   368   e-124
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   367   e-124
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   366   e-124
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   361   e-122
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   357   e-120
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   355   e-120
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   353   e-119
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   350   e-117
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   345   e-115
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   345   e-114
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   337   e-112
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   336   e-112
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   331   e-110
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   325   e-108
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   317   e-105
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   174   6e-50
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   173   2e-49
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   170   2e-48
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   167   4e-47
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   166   5e-47
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   166   5e-47
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   166   1e-46
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   166   1e-46
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   165   1e-46
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   165   1e-46
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   164   5e-46
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   163   9e-46
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   162   2e-45
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   160   2e-44
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   159   3e-44
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   157   2e-43
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   156   3e-43
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   152   1e-41
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   151   3e-41
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   147   8e-40
ADL248C Chr4 complement(262457..267043) [4587 bp, 1528 aa] {ON} ...    35   0.34 
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...    31   6.0  
KAFR0C02830 Chr3 complement(553971..558917) [4947 bp, 1648 aa] {...    31   7.7  
Suva_2.737 Chr2 (1282028..1283935) [1908 bp, 635 aa] {ON} YOR389...    30   9.9  

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/426 (100%), Positives = 426/426 (100%)

Query: 1   MNLPNDQPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPV 60
           MNLPNDQPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPV
Sbjct: 1   MNLPNDQPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPV 60

Query: 61  SRNITMTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIID 120
           SRNITMTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIID
Sbjct: 61  SRNITMTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIID 120

Query: 121 NFSTIENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFL 180
           NFSTIENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFL
Sbjct: 121 NFSTIENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFL 180

Query: 181 LIWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKK 240
           LIWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKK
Sbjct: 181 LIWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKK 240

Query: 241 DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300
           DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL
Sbjct: 241 DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300

Query: 301 NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLAR 360
           NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLAR
Sbjct: 301 NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLAR 360

Query: 361 SSKSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLSRPHSQSSNQNRNTSGSDTN 420
           SSKSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLSRPHSQSSNQNRNTSGSDTN
Sbjct: 361 SSKSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLSRPHSQSSNQNRNTSGSDTN 420

Query: 421 NILHRT 426
           NILHRT
Sbjct: 421 NILHRT 426

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  400 bits (1027), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 271/402 (67%), Gaps = 24/402 (5%)

Query: 9   VVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT-MT 67
           V+D   ++FS+PAKRIFDSQTTQ FQ S+A  RL++F  KYI++V  V  P    ++ +T
Sbjct: 32  VLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVT 91

Query: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNF---ST 124
           +   I+ LL+  S  IDETPPL+ PRR+GNL+CR WH K+ + LP  L  I+D +    +
Sbjct: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 125 IENENM---FNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQD-MTADDFL 180
            E+ +M     ELNYY+ N+FGS TRLD+GTGHELSF+AFI+ IDM+ +  D M   D L
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211

Query: 181 LIWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKK 240
           L++ +YY L RKLILTYTLEPAGSHGVWGLDDHFHLAYI GSSQ I + + + P+D+   
Sbjct: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRN-APMRPRDVKDI 270

Query: 241 DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300
            +V ++ ++NLYCQ I FIF VK GPF+EHSPILYDI+ +V +WSKV +GL+KMY DEVL
Sbjct: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330

Query: 301 NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPA---IMTMMPSSTETMASFN 357
            KFPVVQHFWFGDGF+PW + ++GK LP++EHS  +        I    P   +  A   
Sbjct: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390

Query: 358 LARSSKSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSY 399
            A+   + +            PS++     M PPS+ ++NS+
Sbjct: 391 TAKPGITAM------------PSVTNTRTNMAPPSSRMMNSH 420

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  380 bits (977), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 237/328 (72%), Gaps = 7/328 (2%)

Query: 9   VVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV---PLPVSRNIT 65
           ++D  A+ FS+P KRIFDSQTTQ FQ S+A  RL++F  +YI LV  V   P P S    
Sbjct: 13  LLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSE 72

Query: 66  MTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTI 125
           + +   I+ LL++ S  + +TPPL  PRR+GNL+CR WH KI   LP  L+  I    + 
Sbjct: 73  ILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAI---PSP 129

Query: 126 ENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQS 185
           + +    ELNYY+ NSFGS TRLDYGTGHELSF+AFI+ +DM+ +  D+T  D L+++ +
Sbjct: 130 DLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNA 189

Query: 186 YYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAE 245
           YY+L R+LILTYTLEPAGSHGVWGLDDHFHLAYI GSSQ +++ + L PK+I    +V +
Sbjct: 190 YYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN-APLTPKEITNSRLVKD 248

Query: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
           +   NLYCQ I F+ TVK GPF EHSPILYDIS +V +W KV +GL+KMY DEVLNKFPV
Sbjct: 249 YSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPV 308

Query: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHS 333
           VQHFWFG GF+PW +  + ++LPV+EHS
Sbjct: 309 VQHFWFGTGFYPWINFQTLRELPVYEHS 336

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/412 (49%), Positives = 269/412 (65%), Gaps = 24/412 (5%)

Query: 7   QPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT- 65
           QP+++    +F +P KRI+DSQ T  FQ SVA +RLKYF +KYI LV  V +P    ++ 
Sbjct: 5   QPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSE 64

Query: 66  MTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGEL-KTIIDNFST 124
           +     ++ L+ + S  +DETPP   PRRFGNLSCR WH K++  L   L K + D+   
Sbjct: 65  IPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQN 124

Query: 125 IENE--NMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM-LQDMTADDFLL 181
           I ++  +   EL+YYL NSFGS TRLDYGTGHELSF+A I+ IDM+ +  +++   D L+
Sbjct: 125 ISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI 184

Query: 182 IWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI-SDISHLAPKDILKK 240
           I+  YY L +KLILTYTLEPAGSHGVWGLDDHFH AYI GS+Q   ++   L P DI+ K
Sbjct: 185 IFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNK 244

Query: 241 DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300
           D+V E+   N+YC AI FI  VK GPF+EHSP+LYDIS++V +WSKV  GLLKMY  EVL
Sbjct: 245 DLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVL 304

Query: 301 NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFE---------HSEGESPNPAIMTMMPSSTE 351
           NKFPVVQHFWFG G FPW DNN+ K LP++E         H++  SP+P  +    S+  
Sbjct: 305 NKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGI----STRR 360

Query: 352 TMASFNLARSSKSPIM-NPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLSR 402
             + F     +++PI  NPN+ + +   P    N   M PPSTN +NS  +R
Sbjct: 361 DFSKFTSPALNRNPICRNPNH-LGIGANPLRKSN---MGPPSTNSVNSIFTR 408

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  370 bits (950), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 191/390 (48%), Positives = 255/390 (65%), Gaps = 19/390 (4%)

Query: 7   QPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITM 66
           +P +D   +KF  P K IFDSQ    FQ SVA  RLKY   KY  ++ G P+ V     +
Sbjct: 4   EPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPI-VHEPSGI 62

Query: 67  TITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIE 126
            +   ++ LL + S+ +DETPP   PRR+GNL+CR WHDK+++ L   L+ ++      +
Sbjct: 63  EVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQ----D 118

Query: 127 NENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM-LQDMTADDFLLIWQS 185
                 EL+YYL NSFGS TRLDYGTGHELSFLA +  +DM+ +   + +  D LL++ +
Sbjct: 119 YHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDT 178

Query: 186 YYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDIS-HLAPKDILKKDVVA 244
           YY L RKLILTYTLEPAGSHGVWGLDDHFH+ YI GSSQ  SD +  + P+D+  K +V 
Sbjct: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQ 238

Query: 245 EHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFP 304
           ++ + NLYCQAI+FIF VK GPF+EHS +LYDI+  V++WSKV  GLLKMY  EVL KFP
Sbjct: 239 DYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFP 298

Query: 305 VVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKS 364
           VVQHFWFG GF+PW  + +G+ LP++E++E E   P  MT M  S  TM        +  
Sbjct: 299 VVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHL-----TTR 353

Query: 365 PIMNPNYKMS-MHRPPSLSKNSREMKPPST 393
           PI  P+ K+S +H+ P+       M+PP++
Sbjct: 354 PI--PHGKLSQVHKLPTRGT----MQPPTS 377

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  368 bits (944), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/348 (52%), Positives = 237/348 (68%), Gaps = 9/348 (2%)

Query: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV--PLPVSRNITMT 67
           VD   + FS P KRIFD+QTTQ FQ S+A +R+KY  +KY  L+     P P +   ++ 
Sbjct: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65

Query: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127
           +   ++ +LD+ +Q ID+TPPL  PRR+GNL+CR WH K++++L   L+ ++      + 
Sbjct: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVL----PAQY 121

Query: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +D++ +   +   D  L++  YY
Sbjct: 122 HAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYY 181

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P+D+L K +V E
Sbjct: 182 AIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVRE 241

Query: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
           +++ N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 242 YQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301

Query: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMT-MMPSSTET 352
           VQHFWFG GFFPW +  +G DLPVFE  E ES + A  T   P  T T
Sbjct: 302 VQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTST 349

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/336 (53%), Positives = 231/336 (68%), Gaps = 8/336 (2%)

Query: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTIT 69
           VD   + FS P KRIFD+QTT  FQ S+A +R+KY  +KY  L+   P P +   + +I 
Sbjct: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74

Query: 70  RY--ILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127
               ++ +LDK +Q IDETPPL  PRR+GNL+CR WH K++ +L   L+ ++      E 
Sbjct: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEML----PAEY 130

Query: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +D++ +   +  +D  L++  YY
Sbjct: 131 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYY 190

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P+++L K +V +
Sbjct: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250

Query: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
           +K+ N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 251 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310

Query: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPA 341
           VQHFWFG GFFPW +  +G DLPVFE  E E+   A
Sbjct: 311 VQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQA 346

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  366 bits (939), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/325 (55%), Positives = 225/325 (69%), Gaps = 8/325 (2%)

Query: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV--PLPVSRNITMT 67
           VD   + FS P KRIFD+QTT  FQ S+A +R+KY  +KY  L+     P P +   ++ 
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65

Query: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127
           +   ++ +LDK +  IDETPPL  PRR+GNL+CR WH K++  LP  L+ ++ +    E 
Sbjct: 66  MVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPS----EY 121

Query: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +DM+ M   M   D  L++  YY
Sbjct: 122 HEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYY 181

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P++IL K +V E
Sbjct: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241

Query: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
           +K+ N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 242 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301

Query: 306 VQHFWFGDGFFPWKDNNSGKDLPVF 330
           VQHFWFG GFFPW +  +G DLPVF
Sbjct: 302 VQHFWFGTGFFPWVNIQNGTDLPVF 326

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  361 bits (926), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/376 (50%), Positives = 250/376 (66%), Gaps = 13/376 (3%)

Query: 8   PVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMT 67
           P +D   +KF+ P K+IFD+Q TQ FQ SV  YRL+ + +KYI LV    +P + N    
Sbjct: 8   PKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSN-NDA 66

Query: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127
           + R+   ++D  S+ IDETPPL  PRRFGN +CRTWH K+     G L  ++  F   + 
Sbjct: 67  VNRFT-QIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMR----GSLDALLQAFIPEKY 121

Query: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRML-QDMTADDFLLIWQSY 186
                E+ YYL N+FGSK RLDYGTGHELSFLA +S IDM+ +   + + +D L ++  Y
Sbjct: 122 HVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGY 181

Query: 187 YNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISH--LAPKDILKKDVVA 244
           Y L +KLI TYTLEPAGSHGVWGLDDHFHLAYI GSSQL + ISH  L P DIL +  V 
Sbjct: 182 YTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQL-APISHNPLRPSDILDRHTVE 240

Query: 245 EHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFP 304
           ++ + NLY QAI FI  VK G F+EHSP+LYDI+K V +WSKV +GLLKMY+ EVLNKFP
Sbjct: 241 DYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFP 300

Query: 305 VVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTM---MPSSTETMASFNLARS 361
           VVQHFWFG GFFPW +  SG  LP +E ++ E+P+ + +T    MP++T+++     + +
Sbjct: 301 VVQHFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTT 360

Query: 362 SKSPIMNPNYKMSMHR 377
              P + P+    M +
Sbjct: 361 MPPPTILPSRNSPMGK 376

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  357 bits (917), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 178/325 (54%), Positives = 223/325 (68%), Gaps = 8/325 (2%)

Query: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV--PLPVSRNITMT 67
           VD   + FS P KRIFD+QTT  FQ S+A +R+KY  +KY  L+     P P +   ++ 
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65

Query: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127
           +   ++ +LDK +  IDETPPL  PRR+GNL+CR WH K++  LP  L+ ++      E 
Sbjct: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPP----EY 121

Query: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +D++ M   +   D  L++  YY
Sbjct: 122 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYY 181

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P++IL K +V E
Sbjct: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241

Query: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
           +K  N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 242 YKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301

Query: 306 VQHFWFGDGFFPWKDNNSGKDLPVF 330
           VQHFWFG GFFPW +  +G +LPVF
Sbjct: 302 VQHFWFGTGFFPWVNIQNGTNLPVF 326

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 245/381 (64%), Gaps = 24/381 (6%)

Query: 15  SKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILD 74
           ++F+ P KRIFDSQ T  FQ SVA  RLKYF  KY  ++  V +P   +    +  ++  
Sbjct: 9   TQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV-G 67

Query: 75  LLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTII-DNFSTIENENMFNE 133
           +L+  S  +D+TPPL  PRR+GNL+CR WH KI+  +P   + ++ D F      +   E
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRF-----HHCIVE 122

Query: 134 LNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQD-MTADDFLLIWQSYYNLTRK 192
           L +YL NSFGS TRLDYGTGHELSFLA +  IDM+ +  D    +DFLLI  +YY + RK
Sbjct: 123 LVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRK 182

Query: 193 LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLIS-DISHLAPKDILKKDVVAEHKENNL 251
           LILTYTLEPAGSHGVWGLDDHFHLAY+FGS+Q  +   + L P+DIL   +V E+   NL
Sbjct: 183 LILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNL 242

Query: 252 YCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWF 311
           YCQ I FI+ VK+GPF EHS +LYD++  V +W+K+  GL+KMY  EVLNKFPVVQHFWF
Sbjct: 243 YCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWF 302

Query: 312 GDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIMNPNY 371
           G GF+PW DN +GK L +++ ++ +  N +      S+    A+F    S  SP+  P++
Sbjct: 303 GTGFYPWVDNQTGKQLLIYDPADADRRNTS------STGGKYAAF--VSSINSPV--PHF 352

Query: 372 KMSMHRPPSLSKNSREMKPPS 392
                  PS +  S    PP+
Sbjct: 353 PA-----PSTTAASEARAPPA 368

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 239/380 (62%), Gaps = 16/380 (4%)

Query: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTIT 69
           +D  ++ F+ P KRIFDS+ +  FQ SVA  RLK + +KY++ + GV +P     T    
Sbjct: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIP--ETSTNHEV 63

Query: 70  RYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENEN 129
           R   +LL   S+ +D TP L  PRR+GNL+CRTWHDK++      L+ ++  F       
Sbjct: 64  RSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDE----SLEALLHKFLPEPCHK 119

Query: 130 MFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRML-QDMTADDFLLIWQSYYN 188
              EL YYL N+FGS+ RLDYGTGHELSF A I  +DM+ +   D  A D L ++  YY 
Sbjct: 120 SIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYA 179

Query: 189 LTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI-SDISHLAPKDILKKDVVAEHK 247
           L RKL+LTYTLEPAGSHGVWGLDDHFHL YIFG+SQ +    + +AP+++  K +V E+ 
Sbjct: 180 LVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYT 239

Query: 248 ENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307
           + N YCQAI+FIF VK GPF+EHSP+L+DIS++V +WSKV +GLLKMY  EVLNKFPVVQ
Sbjct: 240 KTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299

Query: 308 HFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIM 367
           HFWFG G FPW     G  LP +E S+         T  P+ T    + N AR      M
Sbjct: 300 HFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPT----NLNSARRQ----M 351

Query: 368 NPNYKMSMHRPPSLSKNSRE 387
           NP     ++R  S  +  RE
Sbjct: 352 NPPNLRGINRLTSQDRFRRE 371

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 227/363 (62%), Gaps = 22/363 (6%)

Query: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILDLL 76
           F  P KRIFDSQTT  FQ SVA  R+++   KY+ ++RG     S  I+ ++ R +L +L
Sbjct: 23  FRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG---DTSGGISASVAR-MLQIL 78

Query: 77  DKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNELNY 136
           D+    +DETPPL+ PRR+GNL+CR WHDK++S LPG L + +D    +       E  Y
Sbjct: 79  DRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPG-LTSQVD---CLAGGGACIEAEY 134

Query: 137 YLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRKLILT 196
           YL NSFGSK RLDYGTGHELSFLAF++ +DM+   + +T  +   +W  YY L R+LI+ 
Sbjct: 135 YLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVRRLIVD 194

Query: 197 YTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVA-EHKENNLYCQA 255
           Y LEPAGSHGVWGLDDHFHLAY++G+SQ  ++   + P+D+L   +   +    N   +A
Sbjct: 195 YNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAPANFLVEA 254

Query: 256 INFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWFGDGF 315
           I F+ +VK GPF E+SP+L DI   V SW K+ +GL +MYN EVLNKFPVVQHFWFG  F
Sbjct: 255 IGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFGTAF 314

Query: 316 FPWKDNNSGKDLPVFEHS---------EGESPNPAIMTMMPSSTETMASFNLARSSKSPI 366
           FPW     G  LPV+E S          G  P P   T+    T TMAS      S+ P 
Sbjct: 315 FPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASV----PSRRPA 370

Query: 367 MNP 369
           M P
Sbjct: 371 MGP 373

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/401 (47%), Positives = 256/401 (63%), Gaps = 22/401 (5%)

Query: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT-MTITRYILDL 75
           FS+P KRI+DSQ+T  FQ S+A YRLKY+ +KYIN+V  V +P    ++ +TI   +  L
Sbjct: 14  FSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITIVNEMSSL 73

Query: 76  LDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTII--DNFSTIENE----- 128
           L + S  ID  PP   PRR+GNL+CR WH  I+S +P  L+ ++   N +T + E     
Sbjct: 74  LTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEKGEFEKLK 133

Query: 129 NMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM-LQDMTADDFLLIWQSYY 187
               ELNYYL NS GS TRLDYGTGHELSFLA I+ +DM+ +  ++    D L ++  YY
Sbjct: 134 GCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLLHMFHCYY 193

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISH-LAPKDILKKDVVAEH 246
            L +KLI+TYTLEPAGSHGVWGLDDHFHL+YI GSSQL  + +   +P DI+ K +V E+
Sbjct: 194 ELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIINKKIVTEY 253

Query: 247 KENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVV 306
              N YC  I+FI+ VK GPF+EHSPILYDIS  V SW KV  GL+KMY  EVLNKFPVV
Sbjct: 254 MHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEVLNKFPVV 313

Query: 307 QHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPI 366
           QHFWFG+GF+PWK+  + K L V+ +   +  N     +  SS  +    N     +S  
Sbjct: 314 QHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENN-----VFNSSDSSSIPNNAMNKDRSVN 368

Query: 367 MNPNY--KMSMHRPPSLSKNSRE-----MKPPSTNVINSYL 400
            NP+   ++  +R  ++  N+R+     M PPS++ + + L
Sbjct: 369 QNPSQLNRIPQNRYTAIPVNNRDLRRPPMGPPSSHGVENIL 409

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  345 bits (886), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/339 (51%), Positives = 229/339 (67%), Gaps = 32/339 (9%)

Query: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLP----VSRNITMT-ITRY 71
           FS P K+IFDSQ TQYF  S+A +R++YF +KY  L++   +P     S N T++ +++ 
Sbjct: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74

Query: 72  ILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN---- 127
           I DL+    + ++ETPPL  PRR+GNLSCR WH +++      +  + + + TI N    
Sbjct: 75  INDLI----KLVEETPPLPGPRRYGNLSCRQWHKRVDD----NINELFEKYLTISNTKFN 126

Query: 128 -ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSY 186
            + +F EL YY   S GS TRLDYGTGHELSFLAFI  +DM+ +L D++  D L I+  Y
Sbjct: 127 KDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEY 186

Query: 187 YNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI---SDISH-----------L 232
           Y L RKLIL YTLEPAGSHGVWGLDDHFHL YIFGSSQ     +D++            +
Sbjct: 187 YRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPI 246

Query: 233 APKDILKKDVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLL 292
            P DIL K+++ + K +N YCQ+I FI TVK GPF EHSPIL+DI+KNV +W KV  GLL
Sbjct: 247 KPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLL 306

Query: 293 KMYNDEVLNKFPVVQHFWFGDGFFPWKDNNSGKDLPVFE 331
           KMY  EVLNKFPVVQHFWFG GF+PW ++++   LP +E
Sbjct: 307 KMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  337 bits (864), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/388 (46%), Positives = 235/388 (60%), Gaps = 33/388 (8%)

Query: 15  SKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLP-VSRNITMTITRYIL 73
           +KFS P KRIFDS  T  FQ S+  YRL+    +Y+ LV    +P VS N   +++ ++ 
Sbjct: 8   TKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTN--GSVSSFVS 65

Query: 74  DLLDKCSQFIDETPPLI-EPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN----E 128
             LD+  + IDETPP    PRRFGN++CR WH K+      E+ ++   F  IE     E
Sbjct: 66  IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQE----EMDSLWRRFLPIERDAAYE 121

Query: 129 NMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQ------DMTADDFLLI 182
           N   EL YYL N+FGS  RLDYGTGHELSFLA +  +DM+ + +       +T  D L +
Sbjct: 122 NCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYL 181

Query: 183 WQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAP---KDILK 239
           W  YY++  KLILTYTLEPAGSHGVWGLDDH HLAYI G+SQ  SD    AP    DIL 
Sbjct: 182 WNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQW-SDKDQNAPIQLSDILD 240

Query: 240 KDVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEV 299
              + ++++ NLYC +I F+  VK GPF++HSP+LYDIS+ V +WSK   GL+KMY  EV
Sbjct: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300

Query: 300 LNKFPVVQHFWFGDGFFPWKDNNSGKDLPVFE-HSEGESPNPAI--------MTMMPSST 350
           LNKFPVVQHFWFG GFFPW D   G  LP +E +S+G     A+         T +P++T
Sbjct: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT 360

Query: 351 ETMASFNLARSSKSPIMNPNYKMSMHRP 378
            +      + +   P M   Y  S H P
Sbjct: 361 GSSGKLTTSAAMPPPRMTTGY--SHHTP 386

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  336 bits (862), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 236/367 (64%), Gaps = 20/367 (5%)

Query: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT----MTITRYI 72
           FS P KRI+DSQ   YFQ S A  RL+    KY +LV       SR++       +   +
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVE------SRDVADLELSGVVGGV 55

Query: 73  LDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFN 132
           + +LD+  Q + ETPP+  PRR+GN++CR WH+KI   +PG L+ +I +    E + +  
Sbjct: 56  VKVLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV- 114

Query: 133 ELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRK 192
           EL YYL NSFGS TRLD+GTGHELSFLA ++ +DM+    D   D  L I+  YY+L  +
Sbjct: 115 ELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD--GDQVLYIFDRYYSLVHR 172

Query: 193 LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDIS-HLAPKDILKKDVVAEHKENNL 251
           LIL+YTLEPAGSHGVWGLDDHFHLAYI GSSQ  +     + P D+    +V ++   N+
Sbjct: 173 LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNI 232

Query: 252 YCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWF 311
           +C+ +NF+FTVK G F EHSP+L+DIS++V++W+KV KGL KMY DEVLNKFPV+QHFWF
Sbjct: 233 FCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292

Query: 312 GDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIMNPNY 371
           G GF+PW D  +GK LP +E+S      P I       T+  A+ +  R  +S  ++P  
Sbjct: 293 GTGFYPWVDYKNGKPLPNYENS------PDIDETNDLKTQAQANMDGTRVVESRFLSPGN 346

Query: 372 KMSMHRP 378
           +  + RP
Sbjct: 347 ETFVRRP 353

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 179/399 (44%), Positives = 240/399 (60%), Gaps = 39/399 (9%)

Query: 6   DQPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPV-SRNI 64
           +Q  +D   + F+ P KRIFDS+ T  FQ SVA  RLK   +KY+ ++ G  +P  + N 
Sbjct: 2   EQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNP 61

Query: 65  TMTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFST 124
            +   R IL      S+ +DETP L  PRR+GNL+CR WHDK+      +++  +  F  
Sbjct: 62  NVISLRKILHFF---SKLVDETPALPGPRRYGNLACRDWHDKMEE----QIREQLQEFLP 114

Query: 125 IENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRML-QDMTADDFLLIW 183
            +      EL YYL N+FGS+ RLDYGTGHELSF + I  +DM+ +      A D L ++
Sbjct: 115 EKYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLF 174

Query: 184 QSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI-SDISHLAPKDILKKDV 242
             YY+L RKLI  Y+LEPAGSHGVWGLDDHFHL YIFG+SQ   S  +  +P++I  K +
Sbjct: 175 NEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMI 234

Query: 243 VAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNK 302
           V E+  +N YCQAI+FIF VK GPF+EHSP+LYDIS++V +WSKV +GLLKMY  EVLNK
Sbjct: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 303 FPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSS 362
           FPVVQHFWFG   FPW   + G  LP +E S+               T+T A        
Sbjct: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQ--------------ETDTQAQLP----- 335

Query: 363 KSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLS 401
                    +M+ H+ PS++K    M PP    ++ +++
Sbjct: 336 ---------RMTQHQ-PSMTKLRHPMNPPHLRNVSRFIA 364

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  325 bits (834), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 209/322 (64%), Gaps = 10/322 (3%)

Query: 14  ASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYIL 73
            ++FS P KRIFD+  T  FQ S+  YRL+    +Y+ LV+G  +P S      + R++ 
Sbjct: 7   GTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ-NRAVVRFVC 65

Query: 74  DLLDKCSQFIDETPPLI-EPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFN 132
            +L++    +DETPP     RRFG+L+CR WHD++   L G L+T++   +         
Sbjct: 66  -ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAA----RRSAA 120

Query: 133 ELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQD--MTADDFLLIWQSYYNLT 190
           EL YYL ++FGS+ RLDYGTGHEL+FLA +  +DM+ +  +   T +D L +W  YY L 
Sbjct: 121 ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV 180

Query: 191 RKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISH-LAPKDILKKDVVAEHKEN 249
            +LILTY LEPAGSHGVWGLDDH HLAYI G+SQ   D +  + P DIL    VA + E 
Sbjct: 181 HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSET 240

Query: 250 NLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHF 309
           NLYC +I F+  VK G F +HSP+L+DI++ V +WSKV  GL+KMY  EVLNKFPVVQHF
Sbjct: 241 NLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHF 300

Query: 310 WFGDGFFPWKDNNSGKDLPVFE 331
           WFG GFFPW D   G  LP +E
Sbjct: 301 WFGTGFFPWVDMAHGMSLPNYE 322

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  317 bits (813), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 216/320 (67%), Gaps = 6/320 (1%)

Query: 15  SKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILD 74
           +KFS+P KRIFDSQ T  FQ+SVA  R++Y   KYI L +G  +P +   +   T  +++
Sbjct: 8   AKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESF-FTNIVVE 66

Query: 75  LLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNEL 134
           LL + S  IDETPP     R+GNLS R W  K  + L   L  ++      +  N   EL
Sbjct: 67  LLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPE----KYNNSIIEL 122

Query: 135 NYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRKLI 194
           +YY+ N+FGSK R+DYGTGHELSFLA I C+DM++ ++ +     L  + SYY++ +KLI
Sbjct: 123 SYYISNAFGSKERIDYGTGHELSFLAVIICLDMLK-IETIKGPALLYCFNSYYDVIQKLI 181

Query: 195 LTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNLYCQ 254
           LTY LEPAGSHGVWGLDDHFH +YI G++QL+   + L PKDI    ++ ++  +NL+C+
Sbjct: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSSNLFCK 241

Query: 255 AINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWFGDG 314
           +I FI  VK GPF+ HSP+LY+IS++V +W K+ +GL+KMY  EVLNKFPVVQHFWFG  
Sbjct: 242 SIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTA 301

Query: 315 FFPWKDNNSGKDLPVFEHSE 334
           FFPW    +   LP+++ +E
Sbjct: 302 FFPWTSYGNNHSLPIYQPAE 321

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  174 bits (441), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 173/306 (56%), Gaps = 23/306 (7%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYIL 73
           +P KRI      + +++S     L  F +     V G     +  P+S +I       + 
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIAS-----LS 56

Query: 74  DLLDKCSQFIDETPPLIEPR--RFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMF 131
            LLD+ ++ +D+ P + E +  RFG +  R ++D++N      +KT    FST+ +E + 
Sbjct: 57  SLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKT---RFSTLSDEQL- 112

Query: 132 NELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDF---LLIWQSYYN 188
            +L+ YL  S+G+K R+DYG+GHEL+F+ F+  +    +  D+  D     L+++  Y N
Sbjct: 113 EQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLF-DLEKDAINLVLVVFLKYLN 171

Query: 189 LTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKE 248
           + R L   Y LEPAGSHGVWGLDD+  L ++FG+ QL+    HL P  I  +++V   K+
Sbjct: 172 IMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPH-KHLKPMSIHNEELVELFKD 230

Query: 249 NNLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307
             LY   I+FI +VK       HSP+L DIS  VK WSKV +G++KMY  EVL K P++Q
Sbjct: 231 KFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQ 289

Query: 308 HFWFGD 313
           HF+F +
Sbjct: 290 HFYFSE 295

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  173 bits (438), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 116/325 (35%), Positives = 179/325 (55%), Gaps = 28/325 (8%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYIL 73
           IP KR+  ++  + +  S     L  F     + VRG        P+S+++  T     +
Sbjct: 2   IPEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAYKEPISKDMEPT-----M 56

Query: 74  DLLDKCSQFIDETPPLIEP--RRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMF 131
            LL K +  ID+ P + +    RFG +  R ++D + ++    + T   +     N++  
Sbjct: 57  QLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSL----NKDQV 112

Query: 132 NELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM--LQDMTADDFLLIWQSYYNL 189
            EL  YL  S+G+K R+DYG+GHEL+F+ FI  + + ++  L+   AD  L ++  Y  +
Sbjct: 113 EELAVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRI 172

Query: 190 TRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKEN 249
            R L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL PK I  ++VV    + 
Sbjct: 173 MRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATH-PHLRPKSIHNEEVVEMFMDK 231

Query: 250 NLYCQAINFIFTVKK-GPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQH 308
            +Y   I FI +VK       HSP+L DIS  VK+W+KV +G++KMY  EVL+K P++QH
Sbjct: 232 YIYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQH 290

Query: 309 FWFG------DGFFPWKDNNSGKDL 327
           F+FG      +G  P K ++ G+DL
Sbjct: 291 FYFGNILPCPEGISPPKGDH-GRDL 314

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  170 bits (431), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/335 (35%), Positives = 172/335 (51%), Gaps = 36/335 (10%)

Query: 18  SIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYI 72
           S P KR+      + +  S     L  F       V+         P+S  ++ T     
Sbjct: 3   SCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAEVSST----- 57

Query: 73  LDLLDKCSQFIDETPPLIEP-RRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMF 131
           L LLD     +DE P L +   RFG    R+++  + S     L    D  +T    N  
Sbjct: 58  LALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTT----NQI 113

Query: 132 NELNYYLLNSFGSKTRLDYGTGHELSFLAFISCI---DMIRMLQDMTADDFLLIWQSYYN 188
            +L+ Y   S+G++ R+DYG+GHEL+F+ F+  +   D+ R+ +D T +  +L++  Y  
Sbjct: 114 EQLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDST-NIVILVFVKYLK 172

Query: 189 LTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKE 248
           + R+L   Y LEPAGSHGVWGLDD+  L ++FG+ QL S+  HL PK I   ++V   K+
Sbjct: 173 IMRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQL-SNHKHLKPKSIHNDEIVDMFKD 231

Query: 249 NNLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307
             LY   I FI +VK       HSP+L DIS  VK WSKV +G++KMY  EVL+K PV+Q
Sbjct: 232 KYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQ 290

Query: 308 HFWFGD------GFFPWKDNNSGKDLPVFEHSEGE 336
           HF+F +      G  P+ + N        EH E E
Sbjct: 291 HFYFSEFLACPTGISPYDERN--------EHLESE 317

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  167 bits (422), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 172/306 (56%), Gaps = 22/306 (7%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYIL 73
           +  KR+ +    + + +S     +  F N     VRG        P+S N+     + + 
Sbjct: 1   MAIKRLINEHDMELWNNSKTFEDVIGFINTLALSVRGRENNDYTQPISDNV-----QRVS 55

Query: 74  DLLDKCSQFIDETPPLIEPR--RFGNLSCRTWHDKINSYLPGELKTIIDNFSTIE--NEN 129
           +LL K ++ I +   + +    RFG +  R ++D I+ +   EL + I  F  IE  +  
Sbjct: 56  NLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEH-SNELISKI--FEGIEKPDTG 112

Query: 130 MFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM--LQDMTADDFLLIWQSYY 187
             +++  Y +NS+G ++R+DYG+GHEL+F+ F+ C+   ++  L++ +++  L+++  Y 
Sbjct: 113 KLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYL 172

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHK 247
            + R L L Y LEPAGSHGVWGLDD+  L ++FG+ QL S   HL PK I   +VV   +
Sbjct: 173 GIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL-STHKHLKPKSIHNPEVVEMFQ 231

Query: 248 ENNLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVV 306
           +  LY   I FI  VK       HSP+L DIS  VK WSKV +G++KMY  EVL K P++
Sbjct: 232 DRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIM 290

Query: 307 QHFWFG 312
           QHF+FG
Sbjct: 291 QHFYFG 296

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  166 bits (421), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 163/302 (53%), Gaps = 15/302 (4%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILDLLDK 78
           IP KR+   +  + +  S   + L  F  K    V G      +          + LL  
Sbjct: 2   IPEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKS 61

Query: 79  CSQFIDETPPLIEPR--RFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNELNY 136
            +  ID+ P + + +  RFG +  R ++D++ S    + KT+I N      E+  ++L  
Sbjct: 62  VNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTS----QSKTLISNAYPSLTEDQLDQLYV 117

Query: 137 YLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDF----LLIWQSYYNLTRK 192
           YL  S+G+K R+DYG+GHEL+FL  +  +   ++  +  + DF    L I+  Y  + R 
Sbjct: 118 YLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDE--SKDFTNMVLKIFIEYLRVMRI 175

Query: 193 LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNLY 252
           L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL P  I  +++V   ++  LY
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATH-KHLKPLSIHNEELVEMFQDKYLY 234

Query: 253 CQAINFIFTVKKG-PFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWF 311
              + FI +VK       HSP+L DIS  VK WSKV +G++KMY  EVL+K P++QHF+F
Sbjct: 235 FSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYF 293

Query: 312 GD 313
           G+
Sbjct: 294 GE 295

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  166 bits (421), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 112/303 (36%), Positives = 171/303 (56%), Gaps = 17/303 (5%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVP-LPVSRNITMTITRYILDLLD 77
           +P KR+      + ++ S     L  F +     V+G     +S  I+  I   +  +L 
Sbjct: 2   LPEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINT-LEQILV 60

Query: 78  KCSQFIDETPPL--IEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNELN 135
              + ID+ P L   E  RFG    R ++D+IN       K I +NF ++ +E +  +L 
Sbjct: 61  SIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSE---KLIHENFPSLTHEQL-EQLT 116

Query: 136 YYLLNSFGSKTRLDYGTGHELSFLAFISCI---DMIRMLQDMTADDF-LLIWQSYYNLTR 191
            YL  S+G+K R+DYG+GHEL+F+ F+  +   D++++  D+ A +  L+I+  Y ++ R
Sbjct: 117 IYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKL--DIDARNMVLIIFIKYLDIMR 174

Query: 192 KLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNL 251
            L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL P  I  +++V    +  L
Sbjct: 175 SLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATH-KHLKPLSIHNEELVEMFAKKYL 233

Query: 252 YCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFW 310
           Y   I FI +VK       HSP+L DIS  VK WSKV +G++KMYN EVL+K P++QHF+
Sbjct: 234 YFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFY 292

Query: 311 FGD 313
           F +
Sbjct: 293 FSE 295

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  166 bits (419), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 164/304 (53%), Gaps = 21/304 (6%)

Query: 20  PAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVP-----LPVSRNITMTITRYILD 74
           P KR+      + +  S     L  F  K    V+G        P+S +I       +  
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDE-----LCS 57

Query: 75  LLDKCSQFIDETPPLIEP--RRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFN 132
           LLDK ++ +   P + +    RFG +  R ++D ++S     + ++ D  ST +     +
Sbjct: 58  LLDKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQ----VD 113

Query: 133 ELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM--LQDMTADDFLLIWQSYYNLT 190
           EL  Y   S+G++TR+DYG+GHEL+F+ F+  ++      L+    +  L ++  Y ++ 
Sbjct: 114 ELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVM 173

Query: 191 RKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENN 250
           R L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL PK I  K+ V   ++  
Sbjct: 174 RTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATH-KHLKPKSIHNKEFVEMFEKRY 232

Query: 251 LYCQAINFIFTVKKG-PFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHF 309
           LY   I FI +VK       HSP+L DIS  VK+WSKV +G++KMY  EVL K P++QHF
Sbjct: 233 LYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHF 291

Query: 310 WFGD 313
           +FGD
Sbjct: 292 YFGD 295

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  166 bits (419), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 156/298 (52%), Gaps = 11/298 (3%)

Query: 20  PAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILDLLDKC 79
           P KR+        + HS     L  F +     V+G+     +  T +       LL++ 
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEYQKPTGSSIESCCQLLEEV 62

Query: 80  SQFIDETPPL--IEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNELNYY 137
           +   ++ P     E  RFG +  R ++D + S   G ++   D     + E    EL+ Y
Sbjct: 63  ASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCE----ELSVY 118

Query: 138 LLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMT--ADDFLLIWQSYYNLTRKLIL 195
              S+G ++R+DYG+GHEL+FL F+  +    + ++     +  L ++  Y  + R L  
Sbjct: 119 FAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTLET 178

Query: 196 TYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNLYCQA 255
            Y LEPAGSHGVWGLDD+  L ++FG+ QL S   HL PK I   +VV    +  LY   
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQL-STHKHLKPKSIHNSEVVEMFGKRYLYFGC 237

Query: 256 INFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWFG 312
           I+FI  VK       HSP+L DIS  VK+W+KV +G++KMY  EVLNK P++QHF+FG
Sbjct: 238 IDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFG 294

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  165 bits (418), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 174/326 (53%), Gaps = 29/326 (8%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVP-----LPVSRNITMTITRYIL 73
           +P KR+      Q +Q+      L  F  +  + V+G+       P+  +I       ++
Sbjct: 3   LPEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQSV--EALI 60

Query: 74  DLLDKCSQFIDETP-PLIEPRRFGNLSCRTWHDKINSYLPGELKTII-DNFSTIENENMF 131
           + +D+C   I+  P     P RFG    R  +D I+    G    +I + F ++ +E + 
Sbjct: 61  ECVDQC---IENHPVESTGPSRFGKGEFRDLYDDIS----GRSSVLIKEKFGSLTDEQV- 112

Query: 132 NELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADD---FLLIWQSYYN 188
            +L+ Y   S+G K+R+DYG+GHEL+FL F+  +    +  D+  D+    L+++  Y  
Sbjct: 113 AQLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVF-DLAKDNRNLVLIVFMKYLK 171

Query: 189 LTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKE 248
             R +   Y LEPAGSHGVWGLDD+  L ++FG+SQL S   HL PK I   +VV    E
Sbjct: 172 TMRVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQL-STHRHLKPKSIHNPEVVEMFSE 230

Query: 249 NNLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307
             LY   I+FI +VK       HSP+L DIS  VK W+KV +G++KMY+ EVL K P++Q
Sbjct: 231 KYLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQ 289

Query: 308 HFWFGDGFFPWKDNNSGKDLPVFEHS 333
           HF+F + F P  +  S    P  +HS
Sbjct: 290 HFYFSE-FLPCPEGVS----PARKHS 310

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  165 bits (418), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 173/308 (56%), Gaps = 18/308 (5%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLV-----RGVPLPVSRNITMTITRYIL 73
           +P KR+  SQ    + +S     L  F     N +       + LP+S +I    +  + 
Sbjct: 1   MPEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSDSINNAFS-LLQ 59

Query: 74  DLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNE 133
           D+ D   ++  E+       RFG +  ++++D IN       K I  +F+ ++  N   E
Sbjct: 60  DIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQ---NSEKLIKSHFNGLD-PNQIQE 115

Query: 134 LNYYLLNSFGSKTRLDYGTGHELSFLAFISCI---DMIRMLQDMTADDFLLIWQSYYNLT 190
           L+ YL+ S+G++ R+DYG+GHEL+F+ F+  +   ++  +L+D T +  L I+  Y N+ 
Sbjct: 116 LSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDST-NLVLKIFMEYINIM 174

Query: 191 RKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENN 250
           R +   Y LEPAGSHGVWGLDD+  L ++FG+ QL S   HL P  I  +++V   K+  
Sbjct: 175 RIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL-SKHKHLKPISIHNEEMVEMFKDKY 233

Query: 251 LYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHF 309
           +Y   I+FI ++K       HSP+L DIS  VK WSKV +G++KMY+ EVL K P++QHF
Sbjct: 234 MYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHF 292

Query: 310 WFGDGFFP 317
           +F D F P
Sbjct: 293 YFSD-FLP 299

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  164 bits (414), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 162/308 (52%), Gaps = 23/308 (7%)

Query: 18  SIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYI 72
           ++P KR+   +    ++ S     L +F  +  + VRG       LP+S ++       +
Sbjct: 4   AMPCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEA-----L 58

Query: 73  LDLLDKCSQFIDETPPLIE---PRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENEN 129
           + LL +    I+  P   +     RFG +  R ++D++ +    E  ++I        +N
Sbjct: 59  MGLLQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRA----ESASLITGAFPQLTQN 114

Query: 130 MFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQ---SY 186
              +L  YL  S+G K R+DYG+GHEL+F+ F+  +   ++      D   L+ +    Y
Sbjct: 115 QVRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVLKPFIEY 174

Query: 187 YNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEH 246
             + R L   Y LEPAGSHGVWGLDD+  L ++FG+ QL S   HL P  I  ++VV   
Sbjct: 175 LKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQL-STHKHLKPLSIHNEEVVELF 233

Query: 247 KENNLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
            +  LY   I+FI +VK       HSP+L DIS  VK WSKV +G++KMY  EVL+K P+
Sbjct: 234 ADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPI 292

Query: 306 VQHFWFGD 313
           +QHF+F D
Sbjct: 293 MQHFYFSD 300

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  163 bits (412), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 167/306 (54%), Gaps = 23/306 (7%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYIL 73
           IP+KRI   +  + ++ S     +  F       V G     V  PVS ++  TI   +L
Sbjct: 2   IPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIA--VL 59

Query: 74  DLLDKCSQFIDETPPLIEPR---RFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENM 130
             +DK  +      P+I+ +   RFG +  R ++D +       L +   +F  + +E +
Sbjct: 60  TEIDKLIKL----HPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSS---HFPALTSEQI 112

Query: 131 FNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM--LQDMTADDFLLIWQSYYN 188
             +L+ YL  S+G+K R+DYG+GHEL+F+ F+  +   ++  LQ    +  L+++  Y  
Sbjct: 113 -EQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLK 171

Query: 189 LTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKE 248
           + R++   Y LEPAGSHGVWGLDD+  L ++FG+ QL     HL PK I  +++V    +
Sbjct: 172 IMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPH-KHLKPKSIHNEELVEMFAD 230

Query: 249 NNLYCQAINFIFTVKKG-PFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307
             LY   I FI +VK       HSP+L DIS  VK WSKV +G++KMY  EVL K P++Q
Sbjct: 231 KYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQ 289

Query: 308 HFWFGD 313
           HF+F +
Sbjct: 290 HFYFSE 295

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 150/271 (55%), Gaps = 17/271 (6%)

Query: 75  LLDKCSQFIDETPPLIEP--RRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFN 132
           LLD  ++ +D+ P + +    RFG +  R ++D++        K +I + S+   +    
Sbjct: 58  LLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRE----TTKELISSLSSELTDEQVE 113

Query: 133 ELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLL-IWQSYYNLTR 191
           EL  Y   S+G + R+DYG+GHEL+F+ F+  +    +L D    + +L ++  Y ++ R
Sbjct: 114 ELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDVMR 173

Query: 192 KLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNL 251
            L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL PK I   ++V   ++  +
Sbjct: 174 LLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTH-KHLKPKSIHNPEIVEVFEKRYM 232

Query: 252 YCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFW 310
           Y + + FI  VK       HSP+L DIS  V++WSKV +G++KMY  EVL K P++QHF+
Sbjct: 233 YFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLPIMQHFF 291

Query: 311 FGDGFFPWKDNNSG------KDLPVFEHSEG 335
           F   F P  +N S        D     HS G
Sbjct: 292 FST-FLPGPENVSAPRDGATDDAHCISHSHG 321

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  160 bits (404), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/315 (34%), Positives = 163/315 (51%), Gaps = 21/315 (6%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG-----VPLPVSRNITMTITRYIL 73
           +P KR+  +   + +  S     L  F  +    V G       LP+S+ +       ++
Sbjct: 2   LPQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPV-----ESMM 56

Query: 74  DLLDKCSQFIDETPPLIEPR--RFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMF 131
            LL K    + + P + +    RFG +  R ++D + S    + KT++        ++  
Sbjct: 57  KLLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTS----QSKTLLKECFPSLTDSQI 112

Query: 132 NELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM--LQDMTADDFLLIWQSYYNL 189
            +L  Y+  S+G+K R+DYG+GHEL+F+ FI  +   ++  L+    +  L ++  Y  L
Sbjct: 113 EQLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKL 172

Query: 190 TRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKEN 249
            R L L Y LEPAGSHGVWGLDD+  L ++FG+ QL S   HL P  I   D++    + 
Sbjct: 173 MRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQL-STHKHLKPSSIHNDDLIEMFADK 231

Query: 250 NLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQH 308
            LY   I FI +VK       HSP+L DIS  VK WSKV +G+ KMY  EV+ K P++QH
Sbjct: 232 YLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQH 290

Query: 309 FWFGDGFFPWKDNNS 323
           F+F D F    +N S
Sbjct: 291 FYFNDMFLICPENVS 305

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  159 bits (402), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/312 (34%), Positives = 170/312 (54%), Gaps = 28/312 (8%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVP--------LPVSRNITMTITR 70
           +P KR+  ++  + ++ S        FT   I+L + V          PVS  IT     
Sbjct: 2   LPEKRLLTAEDMKLWEKSQTRAD---FTKFVIDLAKSVEGHENSQYKEPVSEQITR---- 54

Query: 71  YILDLLDKCSQFIDETPPL--IEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENE 128
            +L LL +    I++ P +  ++  RFG +  R ++D+++       K +   FS + +E
Sbjct: 55  -MLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQ---NSRKLLKSEFSLLTDE 110

Query: 129 NMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCID--MIRMLQDMTADDFLLIWQSY 186
            +  +L+ YL  S+G+K R+DYG+GHEL+F+  +  +    +  L + + +  L ++  Y
Sbjct: 111 QL-EQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEY 169

Query: 187 YNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEH 246
            ++ R L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL P  I   ++V   
Sbjct: 170 LDIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTH-KHLKPISIHNSELVEMF 228

Query: 247 KENNLYCQAINFIFTVKK-GPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305
            +  LY   I FI  VK       HSP+L DIS  VK+WSKV +G++KMY  EVL+K P+
Sbjct: 229 SDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 306 VQHFWFGDGFFP 317
           +QHF+F + F P
Sbjct: 288 MQHFYFSE-FLP 298

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  157 bits (396), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/312 (34%), Positives = 154/312 (49%), Gaps = 39/312 (12%)

Query: 20  PAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVP-----LPVSRNITMTITRYILD 74
           P KR+  SQ  + +       +L  F ++    V+G+       P+  +I          
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGASI---------- 52

Query: 75  LLDKCSQFIDETPPLI---------EPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTI 125
             DKC   +DE   +          E  RFG +  R ++D +       +    D  S  
Sbjct: 53  --DKCCSLLDEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQD 110

Query: 126 ENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDF----LL 181
           + E    EL  Y + S+G + R+DYG+GHEL+F+ F+  +    + +   + D+    L 
Sbjct: 111 QAE----ELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFE--RSRDYRNLVLK 164

Query: 182 IWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKD 241
           ++  Y  L R L  TY LEPAGSHGVWGLDD+  L ++FG+SQL     HL PK I   +
Sbjct: 165 VFIHYLELMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPH-KHLKPKSIHNNE 223

Query: 242 VVAEHKENNLYCQAINFIFTVK-KGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300
           +V       LY   I+FI  VK       HSP+L DIS   KSWSKV +G++KMY  EVL
Sbjct: 224 LVDMFASRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVL 282

Query: 301 NKFPVVQHFWFG 312
            K P++QHF FG
Sbjct: 283 AKLPIMQHFLFG 294

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  156 bits (395), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 108/311 (34%), Positives = 162/311 (52%), Gaps = 26/311 (8%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRG---------VPLPVSRNITMTIT 69
           +P KR+  S   + ++ S        F       V+G         V  P+SR   M + 
Sbjct: 2   LPEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISR--MMNLL 59

Query: 70  RYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENEN 129
            YI D++ K     D         RFG +  R ++D+++       K +   F ++ +E 
Sbjct: 60  SYIRDIIQKHPVVKDANSS-----RFGKIEFRDFYDEVSQ---SSRKFLRSEFPSLTDEQ 111

Query: 130 MFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM--LQDMTADDFLLIWQSYY 187
           +  +L+ YL  S+G+K R+DYG+GHEL+F+  +  +    +  L + + +  L ++  Y 
Sbjct: 112 L-EQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYL 170

Query: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHK 247
            + R L   Y LEPAGSHGVWGLDD+  L ++FG+ QL S   HL P  I   ++V    
Sbjct: 171 KIMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTSH-KHLKPISIHNNELVEMFA 229

Query: 248 ENNLYCQAINFIFTVKK-GPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVV 306
              LY   I+FI  VK       HSP+L DIS  VK+WSKV +G++KMY  EVL+K P++
Sbjct: 230 NRYLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIM 288

Query: 307 QHFWFGDGFFP 317
           QHF+F D F P
Sbjct: 289 QHFYFSD-FLP 298

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  152 bits (383), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 166/313 (53%), Gaps = 18/313 (5%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILDLLDK 78
           +P KR+      + ++ S       +FT   I+L   V    +      I+  I  +++ 
Sbjct: 2   LPEKRLLTPDDMKLWEESPTR---AHFTKFIIDLAESVKGHENSQYKEPISESINSMMNL 58

Query: 79  CSQFIDETP--PLI---EPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNE 133
            SQ  D T   P+I   +  RFG +  R ++D+++       K +   F ++ +E +  +
Sbjct: 59  LSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSR---NSRKILRSEFPSLTDEQL-EQ 114

Query: 134 LNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDM--IRMLQDMTADDFLLIWQSYYNLTR 191
           L+ YL  S+G+K R+DYG+GHEL+F+  +  +    I  L + + +  L ++  Y  + R
Sbjct: 115 LSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMR 174

Query: 192 KLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNL 251
            L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL P  I   ++V       L
Sbjct: 175 ILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTH-KHLKPISIHNNELVEMFAHRYL 233

Query: 252 YCQAINFIFTVKK-GPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFW 310
           Y   I FI  VK       HSP+L DIS  VK+WSKV +G++KMY  EVL+K P++QHF+
Sbjct: 234 YFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFY 292

Query: 311 FGDGFFPWKDNNS 323
           F + F P  D  S
Sbjct: 293 FSE-FLPCPDGVS 304

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  151 bits (381), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 163/307 (53%), Gaps = 18/307 (5%)

Query: 19  IPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILDLLDK 78
           +P KR+  +   + ++ S        FT   I L   V    +      I+  I+ +++ 
Sbjct: 2   LPEKRLLTAGDMKLWEESQTRAD---FTKFIIELAESVKGHENYQFKEPISEQIISMMNL 58

Query: 79  CSQFID--ETPPLIE---PRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNE 133
            SQ  D  +  P+++     RFG +  R ++D+++       K +   F  + +E +  +
Sbjct: 59  LSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQ---NSRKLLRSEFPHLTDEQL-EQ 114

Query: 134 LNYYLLNSFGSKTRLDYGTGHELSFLAFISCID--MIRMLQDMTADDFLLIWQSYYNLTR 191
           L+ YL  S+G+K R+DYG+GHEL+F+  +  +    I  L D + +  L ++  Y  + R
Sbjct: 115 LSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMR 174

Query: 192 KLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNL 251
            L   Y LEPAGSHGVWGLDD+  L ++FG+ QL +   HL P  I   ++V       L
Sbjct: 175 ILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTH-KHLKPISIHNNELVEMFAHRYL 233

Query: 252 YCQAINFIFTVKK-GPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFW 310
           Y   I FI  VK       HSP+L DIS  VK+WSKV +G++KMY  EVL+K P++QHF+
Sbjct: 234 YFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFY 292

Query: 311 FGDGFFP 317
           F + F P
Sbjct: 293 FCE-FLP 298

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  147 bits (371), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 130/233 (55%), Gaps = 11/233 (4%)

Query: 94  RFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNELNYYLLNSFGSKTRLDYGTG 153
           RFG +  R +H ++ +      + ++        +    EL  YL N++G   R+DYG+G
Sbjct: 87  RFGKVEFRDFHKEVQA----RAEALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSG 142

Query: 154 HELSFLAFISCIDMIRML--QDMTADDFLLIWQSYYNLTRKLILTYTLEPAGSHGVWGLD 211
           HEL+F+ F+  +    +L   D T +  L ++  Y ++ R L   Y LEPAGSHGVWGLD
Sbjct: 143 HELNFVCFLYGLWKYGVLSEHDFT-NAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLD 201

Query: 212 DHFHLAYIFGSSQLISDISHLAPKDILKKDVVAEHKENNLYCQAINFIFTVK-KGPFNEH 270
           D+  L ++FG+ QL +   HL PK I   +VV   +   LY   I FI  VK       H
Sbjct: 202 DYHFLPFLFGAFQLATH-KHLKPKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWH 260

Query: 271 SPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWFGDGFFPWKDNNS 323
           SP+L DIS  V+SW+KV +G++KMY  EVL K P++QHF+F   F P  D  S
Sbjct: 261 SPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFFSR-FLPVPDGVS 311

>ADL248C Chr4 complement(262457..267043) [4587 bp, 1528 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL115C
           (NUP159)
          Length = 1528

 Score = 35.4 bits (80), Expect = 0.34,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 40/95 (42%), Gaps = 11/95 (11%)

Query: 328 PVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIMNPNYKMSM-HRPPSLSKNSR 386
           P F H   ES  P+  TM+PS   T   F    +S     NP+      H+ PS + +  
Sbjct: 460 PAFGHQSMESIAPSGATMVPSHGTT---FGQDTNSMQTDANPDKTEDQRHQWPSSTSHPF 516

Query: 387 EMKPPSTNVINSYLSRPHSQSSNQNRNTSGSDTNN 421
            + PP T   N     PHS  SN     +G +T N
Sbjct: 517 GVPPPGTTSNN----EPHSSKSNA---VTGGNTGN 544

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 20/101 (19%)

Query: 45  FTNKYINLVRGVPLPVSRNITMTITRYILDLLDKCSQFIDET----------PPLIEPRR 94
           FTN  I+L RG+ + +S  +    +  I + L+K SQ I ET          P L   ++
Sbjct: 824 FTNDLISLSRGMNMDISSKLR---SLPINEFLNKISQTICETCGDDNTIASNPVLTSIKK 880

Query: 95  FGNLSCRT---WHDKINSYLPGELKTIIDNFSTIENENMFN 132
           F N+ C      ++KI S L  E+++ I+   TI NEN  N
Sbjct: 881 FQNIICSDIALTNEKIMS-LIDEIQSQIE---TISNENNIN 917

>KAFR0C02830 Chr3 complement(553971..558917) [4947 bp, 1648 aa] {ON}
           Anc_8.163 YBL017C
          Length = 1648

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 248 ENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307
           E+ L+C+     F  KKG   E S  L+ +S       KV+K  L+ +ND+ +N + +++
Sbjct: 287 ESTLFCKYQKTFFNKKKGDLIEDSTELFTVSNK----GKVVKS-LEFFNDKTVNHYKILE 341

>Suva_2.737 Chr2 (1282028..1283935) [1908 bp, 635 aa] {ON} YOR389W
           (REAL)
          Length = 635

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 6/61 (9%)

Query: 134 LNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRKL 193
           LN+ L     S     +G+G + +   ++S        QD+  D   L+W S  N+ RK+
Sbjct: 464 LNFCLRFEAASNNSDQFGSGRDFAVYQYVSP------YQDLVTDADFLVWSSTVNVVRKI 517

Query: 194 I 194
           +
Sbjct: 518 V 518

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,540,690
Number of extensions: 2552855
Number of successful extensions: 11927
Number of sequences better than 10.0: 147
Number of HSP's gapped: 12262
Number of HSP's successfully gapped: 151
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)