Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D021705.711ON66066033900.0
KLLA0A00418g5.711ON64261924140.0
CAGL0H06699g5.711ON65062524060.0
TDEL0B020905.711ON64361823950.0
SAKL0E15114g5.711ON64962423930.0
TPHA0E001505.711ON64662023860.0
KLTH0E00836g5.711ON64161523440.0
ZYRO0B16522g5.711ON64362823210.0
Kwal_55.196495.711ON64161923200.0
NCAS0G001805.711ON65466723160.0
Ecym_40105.711ON64461322980.0
Kpol_1043.775.711ON65762422590.0
AFR295W5.711ON63161222450.0
TBLA0E017505.711ON66561222400.0
YIL155C (GUT2)5.711ON64960722260.0
Skud_9.135.711ON64962522170.0
NDAI0F002105.711ON65362322110.0
Smik_9.145.711ON65260721970.0
Suva_9.325.711ON53854920360.0
KNAG0L021905.711ON64560520460.0
Kwal_33.140151.215ON271212770.85
KLLA0B13167g4.198ON254115761.0
Smik_6.608.56ON49960761.6
YFL018C (LPD1)8.56ON49960761.6
Skud_6.538.56ON49944751.8
Suva_6.418.56ON49947742.3
KLLA0D11154g8.56ON49341733.6
Suva_10.5264.276ON114446733.6
KAFR0A076502.58ON1064139734.0
CAGL0F01947g8.56ON49339715.3
TPHA0K021404.34ON94959717.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02170
         (660 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...  1310   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   934   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   931   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   927   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   926   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   923   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   907   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   898   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   898   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   896   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   889   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   874   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   869   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   867   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   862   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   858   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   856   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   850   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   788   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   792   0.0  
Kwal_33.14015 s33 complement(484017..484832) [816 bp, 271 aa] {O...    34   0.85 
KLLA0B13167g Chr2 (1152802..1153566) [765 bp, 254 aa] {ON} simil...    34   1.0  
Smik_6.60 Chr6 complement(115090..116589) [1500 bp, 499 aa] {ON}...    34   1.6  
YFL018C Chr6 complement(101628..103127) [1500 bp, 499 aa] {ON}  ...    34   1.6  
Skud_6.53 Chr6 complement(103908..105407) [1500 bp, 499 aa] {ON}...    33   1.8  
Suva_6.41 Chr6 complement(74641..76140) [1500 bp, 499 aa] {ON} Y...    33   2.3  
KLLA0D11154g Chr4 (952049..953530) [1482 bp, 493 aa] {ON} highly...    33   3.6  
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    33   3.6  
KAFR0A07650 Chr1 complement(1539297..1542491) [3195 bp, 1064 aa]...    33   4.0  
CAGL0F01947g Chr6 complement(189377..190858) [1482 bp, 493 aa] {...    32   5.3  
TPHA0K02140 Chr11 (456578..459427) [2850 bp, 949 aa] {ON} Anc_4....    32   7.1  

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score = 1310 bits (3390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/660 (97%), Positives = 645/660 (97%)

Query: 1   MFTAKTKNLLPKXXXXXXXXXXXXXXXYAKKGPRIHAPSYQEDGKLISPLDKRSVNLPTR 60
           MFTAKTKNLLPK               YAKKGPRIHAPSYQEDGKLISPLDKRSVNLPTR
Sbjct: 1   MFTAKTKNLLPKVVVAGIATVTVGGIIYAKKGPRIHAPSYQEDGKLISPLDKRSVNLPTR 60

Query: 61  NDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMAHG 120
           NDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMAHG
Sbjct: 61  NDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMAHG 120

Query: 121 GVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYAGC 180
           GVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYAGC
Sbjct: 121 GVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYAGC 180

Query: 181 KMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVTAI 240
           KMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVTAI
Sbjct: 181 KMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVTAI 240

Query: 241 ENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQMD 300
           ENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQMD
Sbjct: 241 ENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQMD 300

Query: 301 QNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAKTSD 360
           QNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAKTSD
Sbjct: 301 QNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAKTSD 360

Query: 361 GRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVLSAW 420
           GRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVLSAW
Sbjct: 361 GRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVLSAW 420

Query: 421 AGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETVDEAI 480
           AGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETVDEAI
Sbjct: 421 AGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETVDEAI 480

Query: 481 KVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAPIICEM 540
           KVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAPIICEM
Sbjct: 481 KVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAPIICEM 540

Query: 541 YAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYSVNYEY 600
           YAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYSVNYEY
Sbjct: 541 YAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYSVNYEY 600

Query: 601 AITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYIKTFGV 660
           AITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYIKTFGV
Sbjct: 601 AITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYIKTFGV 660

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/619 (73%), Positives = 529/619 (85%), Gaps = 24/619 (3%)

Query: 47  ISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDF 106
           +S + K +V+LP+R +L+S+L+KT++FDVL+IGGGATG GCALDA+TRGLNVALVE  DF
Sbjct: 43  VSTIKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDF 102

Query: 107 ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIP 166
           ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAH+LNTAPHLCKILPIMIP
Sbjct: 103 ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIP 162

Query: 167 VYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTF 226
           VYNYWQ+PYFY G KMYDLFAGSQNLKSSYLLS   A++VAPMLD +KLKAGLVYHDG+F
Sbjct: 163 VYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSF 222

Query: 227 NDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVI 286
           NDSRMNS+LA+TAIE G+TVLNY+++KQL+K K +GK+EGAI  D ETG +Y IKAKVV+
Sbjct: 223 NDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVV 282

Query: 287 NATGPYSDAILQMDQNPTGLP-DPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSF 345
           NATGPYSD +LQMDQ+PTGLP D +   +  N  ++TK++V NPKMVVPSAGVHI+LPSF
Sbjct: 283 NATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSF 342

Query: 346 YCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQH 405
           YCPK+IGLLDA+TSDGRVMFFLPWQGKVLAGTTD+PMKQIPENPTATEADIQDILKELQH
Sbjct: 343 YCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQH 402

Query: 406 YIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKW 465
           YI FPVKREDVLSAWAGIRPLVKDPR  D +G GSTQ LVRSHF+FTS   LVTI+GGKW
Sbjct: 403 YINFPVKREDVLSAWAGIRPLVKDPRKAD-SGSGSTQQLVRSHFLFTSPSNLVTISGGKW 461

Query: 466 TTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQH 525
           TTYR MAEET+DE +KVG+F N KPC+T+ +KL GGENWNPNL ALL+Q+YHLSS +S+H
Sbjct: 462 TTYREMAEETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEH 520

Query: 526 LADNYGTRAPIICEMYAKDRKNKLPIALAANYN----EHEDEIENANDLIYNNERGDVFE 581
           LA+NYGTRAP+ICE++ +D +NKLP+ALA   N     H D                 ++
Sbjct: 521 LANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVD-----------------YD 563

Query: 582 CFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDE 641
            FRYP+T+GE+KYS+ YEYA   LDFLMRR+R+AFLDAK+A++AVEGTVK+MGDEL WD 
Sbjct: 564 SFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDS 623

Query: 642 SRRHKEIENTIKYIKTFGV 660
            +R  EI+   +YIKTFGV
Sbjct: 624 KKRQDEIQQATEYIKTFGV 642

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/625 (73%), Positives = 531/625 (84%), Gaps = 23/625 (3%)

Query: 43  DGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVE 102
           D  LISP++K  V LPTR++L+ KL++TNQFDVL+IGGGATG GCALDA TRGLNVALVE
Sbjct: 42  DVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVE 101

Query: 103 KYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILP 162
           K DFASGTSSKSTKMAHGGVRYLEKAFWE+SKAQLDLVIEALNERAHLLNTAPHLCK+LP
Sbjct: 102 KNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLP 161

Query: 163 IMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYH 222
           I+IPVYNYWQ+PYFYAGCKMYDLFAGSQNLK SYL+SK +  +VAPMLD + LKAGLVYH
Sbjct: 162 IIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYH 221

Query: 223 DGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKA 282
           DG+FND+RMN+TLAVTAIEN +TVLNYMEVKQL+K+K  GK+ GA+VED ETGK Y+++A
Sbjct: 222 DGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDK-DGKVAGAVVEDRETGKTYSVRA 280

Query: 283 KVVINATGPYSDAILQMDQNPTGLPD-------PLNVNLKTNNDIATKVSVSNPKMVVPS 335
           KVV+NATGPYSD +LQMD NP GLPD       P+     T   I ++V+V+ P MVVPS
Sbjct: 281 KVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPS 340

Query: 336 AGVHIILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEAD 395
           AGVHIILPSFYCPK++GLLDAKTSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENPTATEAD
Sbjct: 341 AGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEAD 400

Query: 396 IQDILKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDH 455
           IQDILKELQ YI+FPVKREDVLSAWAGIRPLV DPR   K  DGSTQGLVRSHFIFTSDH
Sbjct: 401 IQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSK-ADGSTQGLVRSHFIFTSDH 459

Query: 456 GLVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQR 515
           GLVTIAGGKWTTYRAMAEET+DE +K GKF + KPCITR +KLAG ENW+PNL ALLAQ+
Sbjct: 460 GLVTIAGGKWTTYRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDPNLPALLAQK 518

Query: 516 YHLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNE 575
           YHLS K+S +LA+NYGTRAP+ICEM+ +D +N+LP+ LA   ++ +  +    D      
Sbjct: 519 YHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLA---DKEQTPVLGHVD------ 569

Query: 576 RGDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGD 635
               F+ FRYP T+ E+KY++ YEYA TALDFLMRR+RFAFLDAK+A++AVEGTV++MGD
Sbjct: 570 ----FDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGD 625

Query: 636 ELNWDESRRHKEIENTIKYIKTFGV 660
            L WDE RR  EI  + ++IKTFGV
Sbjct: 626 SLGWDEQRRQDEIRYSTEFIKTFGV 650

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/618 (72%), Positives = 522/618 (84%), Gaps = 16/618 (2%)

Query: 43  DGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVE 102
           D  L S +D  +V LP+R DL+SKL+KT+QFDVLVIGGGATG GCA+DA TRGLNVALVE
Sbjct: 42  DVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVE 101

Query: 103 KYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILP 162
            +DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER H+LNTAPHLCKILP
Sbjct: 102 MHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILP 161

Query: 163 IMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYH 222
           IMIPVY YWQIPYFY GCKMYDLFAGSQNLK+SYLL+KR AAD+APMLD T LKAGLVYH
Sbjct: 162 IMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYH 221

Query: 223 DGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKA 282
           DG+FNDSRMN+ LAVTAIENG+TVLNYMEVKQL+K+K +GK++GA+V + ETG+Q+ +KA
Sbjct: 222 DGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKA 281

Query: 283 KVVINATGPYSDAILQMDQNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIIL 342
           KV +NATGPYSD +LQMD+N  G PDP       N  I+TKV+V NPKMVVPSAGVHIIL
Sbjct: 282 KVTVNATGPYSDKLLQMDENKDGKPDP--TKPLPNATISTKVAVENPKMVVPSAGVHIIL 339

Query: 343 PSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKE 402
           PSFYCP+++GLLD KTSDGRVMFFLPWQGKVLAGTTD+PMKQ+P+ PTA E+DIQDIL+E
Sbjct: 340 PSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQE 399

Query: 403 LQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAG 462
           LQHYI+FPVKREDVLSAWAGIRPLV DPR    N  GSTQGLVRSH  FT+D+G+VTIAG
Sbjct: 400 LQHYIKFPVKREDVLSAWAGIRPLVIDPRKSQGNTGGSTQGLVRSHLCFTTDNGMVTIAG 459

Query: 463 GKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKL 522
           GKWTTYR MAEET++E +KVGKF NVKPCITR +KL+G ENWNPNL ALLAQ+YHLS  +
Sbjct: 460 GKWTTYREMAEETINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAM 518

Query: 523 SQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFEC 582
           S HL++NYGTRAP+ICEM+ +D +N+LP+                N  +Y N     F+ 
Sbjct: 519 SNHLSENYGTRAPLICEMFQEDERNQLPVTFGG----------RENVTVYGNVN---FDS 565

Query: 583 FRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDES 642
           FRYPFT+GE+ YSV+YEY  TALDFLMRR+RFAFLDA++A+ AVEGTV +MGD+LNWD +
Sbjct: 566 FRYPFTIGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDST 625

Query: 643 RRHKEIENTIKYIKTFGV 660
           RR  EIE + ++I+TFGV
Sbjct: 626 RRKHEIEKSKEFIRTFGV 643

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/624 (72%), Positives = 527/624 (84%), Gaps = 20/624 (3%)

Query: 43  DGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVE 102
           D  + +P+ K  +NLPTR DL+SKL+KTNQFDVL+IGGGATG G ALDA TRGLNVALVE
Sbjct: 40  DVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVE 99

Query: 103 KYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILP 162
             DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNERAH+L TAPHLCKILP
Sbjct: 100 MNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILP 159

Query: 163 IMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYH 222
           IMIPVYNYWQ PYFY GCKMYDLFAGSQNLKSSY+L+   AA+VAPMLD +KLKAGLVYH
Sbjct: 160 IMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYH 219

Query: 223 DGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKA 282
           DG+FNDSRMN+TLAVTA+E G+TVLNYMEVKQL+K + +GK+EGA+ +D ETG+ + IKA
Sbjct: 220 DGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKA 279

Query: 283 KVVINATGPYSDAILQMDQNPTGLPDP-LNVNLKTNNDIATKVSVSNPKMVVPSAGVHII 341
           KVV+NATGP+SD ILQMD++  GLPD  L  +   N  I++KV+V+NP+MVVPSAGVHI+
Sbjct: 280 KVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIV 339

Query: 342 LPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILK 401
           LPSFYCPK+IGLLDAKTSDGRVMFFLPWQGKVLAGTTD+PMKQIPENPTATEADIQDILK
Sbjct: 340 LPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILK 399

Query: 402 ELQHYIRFPVKREDVLSAWAGIRPLVKDPRTL-----DKNGDGSTQGLVRSHFIFTSDHG 456
           ELQHYI+FPVKREDVLSAWAGIRPLVKDPR        +    STQ LVRSHF+FTSD+ 
Sbjct: 400 ELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDND 459

Query: 457 LVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRY 516
           LVTIAGGKWTTYR M+EET++E +KVGKF N KPCITR +KLAG EN++PNL A+LAQ Y
Sbjct: 460 LVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEY 518

Query: 517 HLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNER 576
           HLSSK++++LA+NYGTRAP+ICE++  D KNKLP+A               N  +Y N  
Sbjct: 519 HLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGG----------KENVTVYGNVD 568

Query: 577 GDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDE 636
              F+ FRYPFT+GE+KYS+N EY  TALDFLMRR+R+AFLDAK+A+ AV+GTVK+MGDE
Sbjct: 569 ---FDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDE 625

Query: 637 LNWDESRRHKEIENTIKYIKTFGV 660
           L+WD +RR +E E   ++IKTFGV
Sbjct: 626 LSWDSNRRQEEREKATEFIKTFGV 649

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/620 (73%), Positives = 529/620 (85%), Gaps = 18/620 (2%)

Query: 41  QEDGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVAL 100
           Q +  L +P+D  +VN+PTR++L++ L  T+QFDVL+IGGGATG+G ALDA TRGLNVAL
Sbjct: 45  QNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVAL 104

Query: 101 VEKYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKI 160
           VEK DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNERAHLL TAPHLCKI
Sbjct: 105 VEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI 164

Query: 161 LPIMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLV 220
           LPIMIPVY YWQ+PYFYAG KMYD+FAGSQNLKSSYL+SK +A ++APMLD +KLKAGLV
Sbjct: 165 LPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLV 224

Query: 221 YHDGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNI 280
           YHDGTFNDSRMNSTLA+TAIENG+TVLNYMEVKQLLK+  S ++ GAIVED+ETG++  I
Sbjct: 225 YHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQI 284

Query: 281 KAKVVINATGPYSDAILQMDQNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHI 340
            AKV++NATGPYSD ILQMD N  G PD    + +T+  IATKV+V NP MVVPSAGVHI
Sbjct: 285 NAKVIVNATGPYSDKILQMDNNKNGKPDEFTQSAETS--IATKVAVQNPHMVVPSAGVHI 342

Query: 341 ILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDIL 400
           ILPSFYCP+++GLLDA TSDGRVMFFLPWQGKVLAGTTD+PMK +PENPTATEADIQDIL
Sbjct: 343 ILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDIL 402

Query: 401 KELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTI 460
           KELQHYI+FPVKREDVLSAWAGIRPLV+DPR   K  +G+TQ LVRSHFIFTSDHGLVTI
Sbjct: 403 KELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPK--EGATQELVRSHFIFTSDHGLVTI 460

Query: 461 AGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSS 520
           AGGKWTTYR MAEET+D  +K GKF NVKPC TR +KLAGGEN++PNL ALLAQ+YHL S
Sbjct: 461 AGGKWTTYREMAEETIDTVVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPS 519

Query: 521 KLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVF 580
           KLS+HLA+NYGTR+P+IC+M+  D  N+LPI LA    + E+++    D          F
Sbjct: 520 KLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAG---KEENKVYGTVD----------F 566

Query: 581 ECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWD 640
           + FRYP+++ EVKY V++EYA T LDFLMRRSRFAFLDAK+A+ +VEGTVKIMGDELNWD
Sbjct: 567 DSFRYPYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWD 626

Query: 641 ESRRHKEIENTIKYIKTFGV 660
           E RR +E + +I+YIKTFGV
Sbjct: 627 EERRKQETDYSIEYIKTFGV 646

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/615 (70%), Positives = 512/615 (83%), Gaps = 17/615 (2%)

Query: 49  PLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFAS 108
           PL   +  +P+R++L+ K+ KT+QFDVLVIGGGATG GCA+D  TRGLNVALVE  DFAS
Sbjct: 41  PLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFAS 100

Query: 109 GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVY 168
           GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER H+LNTAPHLCK+LPIMIPVY
Sbjct: 101 GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVY 160

Query: 169 NYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFND 228
           NYWQ+PYFY GCKMYDLFAGSQNLKSSY+++ R A++VAPMLD + LKAGLVYHDG+FND
Sbjct: 161 NYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFND 220

Query: 229 SRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINA 288
           SRMN+ LAVTAIE G+TVLNYMEV +LLK + +G++EGA+  D ETGK++ I AKVV+N+
Sbjct: 221 SRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNS 280

Query: 289 TGPYSDAILQMDQNPTGLP--DPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFY 346
           TGP+SD ILQMD    GLP  D +    + ++ I ++V+VSNP+MVVPSAGVHI+LP+FY
Sbjct: 281 TGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFY 340

Query: 347 CPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHY 406
           CPK IGLLDAKTSDGRVMFFLPWQGKVLAGTTD+PMKQ+PENPTATEADIQDILKELQHY
Sbjct: 341 CPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHY 400

Query: 407 IRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD-GSTQGLVRSHFIFTSDHGLVTIAGGKW 465
           I+FPVKREDVLSAWAGIRPLV+DPRTL +  D  STQGLVR+HF+FTSD+GLVTIAGGKW
Sbjct: 401 IKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKW 460

Query: 466 TTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQH 525
           TTYR MAEET+DE +K G F   KPCIT+ IKLAG E W+PN  A+LAQ YHLSSK+++H
Sbjct: 461 TTYREMAEETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEH 519

Query: 526 LADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRY 585
           LA+NYGTR+PIICEM+ +D KN+LP+                N  +Y N     F+ FRY
Sbjct: 520 LANNYGTRSPIICEMFRRDEKNQLPVTFGG----------RENVTVYKNVN---FDSFRY 566

Query: 586 PFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRH 645
           PFT+ E+KYSV YEY  TALDFLMRR+RF FLDAK+A+ AV+GTV IMGDEL WDE++R 
Sbjct: 567 PFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRL 626

Query: 646 KEIENTIKYIKTFGV 660
            EI+    +IKTFGV
Sbjct: 627 SEIQQASDFIKTFGV 641

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/628 (69%), Positives = 518/628 (82%), Gaps = 17/628 (2%)

Query: 34  RIHAPSYQEDGKLISPLDKR-SVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDAT 92
           R  + +   +  ++SP+D R SVNLP+R DL+S L KT++FDVL+IGGGA+GAG ALDA 
Sbjct: 32  RRQSSALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAA 91

Query: 93  TRGLNVALVEKYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLN 152
           TRGLNVA VE  DFASGTSSKSTKMAHGGVRYLEKA +ELS+AQLDLVIEALNER H+L 
Sbjct: 92  TRGLNVACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLE 151

Query: 153 TAPHLCKILPIMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDT 212
           TAPHLCKILPIMIPVY+YWQ+PYF+AGCK+YD FAG QNL+SSYLLSK  A+++APMLD 
Sbjct: 152 TAPHLCKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDE 211

Query: 213 TKLKAGLVYHDGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDL 272
           +KLKAGLVYHDG+FNDSRMNSTLA++AIE+G+TVLNY++V QLLK+  + K+EGAIVED 
Sbjct: 212 SKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQ 271

Query: 273 ETGKQYNIKAKVVINATGPYSDAILQMDQNPTGLPDPLNVNLKTNNDIATKVSVSNPKMV 332
           ETGKQY +KAKV +NATGPYSD ILQMD+N  GLPDP       N  IAT+V+V+ P MV
Sbjct: 272 ETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDP-QPPQPANVSIATEVAVNKPNMV 330

Query: 333 VPSAGVHIILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTAT 392
           VPSAGVHIILPS+YCPK +GLLD KT+DGRVMFFLPWQGKVLAGTTD+PMK +P+NPTAT
Sbjct: 331 VPSAGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTAT 390

Query: 393 EADIQDILKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFT 452
           EADIQDIL+ELQHYI+FPV+REDVLSAWAGIRPLV DPR     G GST+GLVR+H IFT
Sbjct: 391 EADIQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTG-GSTEGLVRNHLIFT 449

Query: 453 SDHGLVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALL 512
           S+ GL+T+AGGKWTTYR MAE+T+DE +K G F+ VKPCITR IKLAGGENW PNL ALL
Sbjct: 450 SETGLITLAGGKWTTYREMAEQTIDEVVKEGGFS-VKPCITRKIKLAGGENWTPNLSALL 508

Query: 513 AQRYHLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIY 572
           AQ Y LS  +SQHL++NYGTRAPIICE++ +D +N+LP+A            EN   L +
Sbjct: 509 AQHYKLSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGR--------ENVTVLHH 560

Query: 573 NNERGDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKI 632
            N     F+ FRYPFT+GE  YS+ +EY+  A DFLMRR+R+AFLDA  A+ AVEGTVK+
Sbjct: 561 VN-----FDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKV 615

Query: 633 MGDELNWDESRRHKEIENTIKYIKTFGV 660
           MGDELNWD +RR +EIE   ++IKTFGV
Sbjct: 616 MGDELNWDSARRQREIEECTEFIKTFGV 643

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/619 (69%), Positives = 514/619 (83%), Gaps = 17/619 (2%)

Query: 45  KLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKY 104
           ++  PL   +  LPTR++L+ K+ KT QFDVL+IGGGATG GCA+DA TRGLNVALVE  
Sbjct: 37  RVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMN 96

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIM 164
           DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER H+LNTAPHLCK+LPIM
Sbjct: 97  DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIM 156

Query: 165 IPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDG 224
           IPVYNYWQ+PYFY GCKMYDLFAGSQNLKSSY++S + A++VAPMLD + LKAGLVYHDG
Sbjct: 157 IPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDG 216

Query: 225 TFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKV 284
           +FNDSRMN+ LAVTAIE G+TVLNYMEV QL+K   SG+IEGA+V D ETG+++ IKAKV
Sbjct: 217 SFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKV 276

Query: 285 VINATGPYSDAILQMDQNPTGLP--DPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIIL 342
           V+N+TGP+SD +LQMD    G P  D +    + ++ I ++++VSNP+MVVPSAGVHI+L
Sbjct: 277 VVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVL 336

Query: 343 PSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKE 402
           P+FYCPK+IGLLDAKTSDGRVMFFLPWQGKVLAGTTD+PMKQ+PENPTATEADIQDILKE
Sbjct: 337 PAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKE 396

Query: 403 LQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD-GSTQGLVRSHFIFTSDHGLVTIA 461
           LQHYI+FPVKR DVLSAWAGIRPL++DPRT+ +  D  STQGLVR+HF++TSD+GLVTIA
Sbjct: 397 LQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIA 456

Query: 462 GGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSK 521
           GGKWTTYR MAEET+DE +K GKF   KPCIT+ IKLAG E W+PN  A+LAQ YHLSSK
Sbjct: 457 GGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSK 515

Query: 522 LSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFE 581
           +++HLA+NYGTR+PIICEM+ +D KN+LP+                N  +Y N     F+
Sbjct: 516 MAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGG----------RENVTVYKNVN---FD 562

Query: 582 CFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDE 641
            FRYPFT+GE+KYS+ YEY  TALDFLMRR+RF FLDA++A+ AV+GTV +MGDEL W +
Sbjct: 563 SFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSD 622

Query: 642 SRRHKEIENTIKYIKTFGV 660
            RR  E +   ++IKTFG+
Sbjct: 623 DRRQAERQQASEFIKTFGL 641

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/667 (65%), Positives = 533/667 (79%), Gaps = 20/667 (2%)

Query: 1   MFTAKTKNLLPKXXXXXXXXXXXXXXXYAKKGPR--IHAPSYQEDGKLISPLDKRSVNLP 58
           MF+  +K++L K               + ++  +   H    Q    L+SP+D   V+LP
Sbjct: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60

Query: 59  TRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMA 118
           TR+ L+ +L +  QFDVL+IGGGATG GCA+DA TRGL VALVE+ DFASGTSSKSTKMA
Sbjct: 61  TRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKMA 120

Query: 119 HGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYA 178
           HGGVRYLEKAF++LSK+QLDLVIEALNERAHLLNTAPHLCKILPI+IPVY YWQ+PYFYA
Sbjct: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180

Query: 179 GCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVT 238
           GCK+YDLFAG+QNLK+SYLLS+ +A ++APML+ T LKA LVYHDG+FNDSR+N+TLA+T
Sbjct: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240

Query: 239 AIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQ 298
           AIE G+TVLNY+EV++LLK+  +G I G  V D+ETG   ++ +KVV+NATGP+SD ILQ
Sbjct: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300

Query: 299 MDQNPTGLPDPLNVNLKTNN--DIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDA 356
           MD+NPTGLPD +N+N K  N  DI++K++V NP MVVPS+GVHIILPS+YCPK +GLLD 
Sbjct: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360

Query: 357 KTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDV 416
           +TSDGRVMFFLPWQGKV+AGTTD+PM Q+PE P A EADIQDILKELQHYI+FPVKREDV
Sbjct: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420

Query: 417 LSAWAGIRPLVKDPRTL---DKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAE 473
           LSAWAGIRPLV+DPR +   +K   GSTQGLVRSHFIFTSD+GLVTIAGGKWTTYR MAE
Sbjct: 421 LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE 480

Query: 474 ETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTR 533
           ET+DE +K G F + KPCITR++KLAG E W+PN+ ALL+Q+Y+L S ++ +L+DNYGTR
Sbjct: 481 ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR 540

Query: 534 APIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVK 593
           +PIICE++  D  NKLP+ LA    E +++I    D          F  FRYP T+GE+K
Sbjct: 541 SPIICELFLNDEINKLPVLLAG---EEKEQILGNTD----------FNTFRYPITIGELK 587

Query: 594 YSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIK 653
           YS+ YEYA TALDFLMRR+RFAFLDAKEA+ AV GTVKIMGDE NW   RR +E E TI+
Sbjct: 588 YSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQ 647

Query: 654 YIKTFGV 660
           +IK+FGV
Sbjct: 648 FIKSFGV 654

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/613 (70%), Positives = 510/613 (83%), Gaps = 23/613 (3%)

Query: 50  LDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASG 109
           L+K +   P+R  L+ KL KT+QFDVLVIGGGA+G G ALDA TRGLNVAL+E  D+ASG
Sbjct: 53  LEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASG 112

Query: 110 TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYN 169
           TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAH+L+TAPHLCKILPIMIPVY 
Sbjct: 113 TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYK 172

Query: 170 YWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDS 229
           +WQ+PYFY G KMYD FAG QNLKSSYLLS   A+ VAPMLD +KLKAGLVYHDG+FNDS
Sbjct: 173 WWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDS 232

Query: 230 RMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINAT 289
           RMNSTLAVTAIENG+T+LNYMEVKQLLK   +GK+EGAI  D ETGKQY++KAKVV++AT
Sbjct: 233 RMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSAT 292

Query: 290 GPYSDAILQMDQNPTGLPDPLNVNLKTNN--DIATKVSVSNPKMVVPSAGVHIILPSFYC 347
           GP+SD ILQM+ +P GLPD L+++ K N    I TKV+V++PKMVVPS+GVHIILPSFYC
Sbjct: 293 GPFSDRILQMENHPKGLPDDLSLS-KANEGATITTKVAVADPKMVVPSSGVHIILPSFYC 351

Query: 348 PKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYI 407
           PKD+GLLDA+TSDGRVMFFLPWQGKVLAGTTD+PMKQ+PENPTATEADIQDILKELQHYI
Sbjct: 352 PKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYI 411

Query: 408 RFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTT 467
           +FPVKREDV SAWAGIRPLVKDPR      +  TQ LVRSHF+FTSD GLVTI+GGKWTT
Sbjct: 412 KFPVKREDVQSAWAGIRPLVKDPR----KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTT 467

Query: 468 YRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLA 527
           YR MA+ET+DE +KVG F N KPCITR IKL G ENW+PNL A+L+Q+Y+L   LS++L+
Sbjct: 468 YREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLS 527

Query: 528 DNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPF 587
           +NYGT+A  ICE++  D++N+LP++LAA     E    N +           ++ FRYPF
Sbjct: 528 ENYGTKAAAICEIFQSDKRNQLPVSLAA-----EKAAANVD-----------YDAFRYPF 571

Query: 588 TVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKE 647
           TVGE+KY++  EYA   LDFLMRR+R+AFLDAK+AV AV GTVKIMGDEL WD ++R  E
Sbjct: 572 TVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREME 631

Query: 648 IENTIKYIKTFGV 660
            +  I++IKTFGV
Sbjct: 632 TKYAIEFIKTFGV 644

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/624 (70%), Positives = 513/624 (82%), Gaps = 27/624 (4%)

Query: 48  SPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFA 107
           SP+D   V LP+R DL+SKL KT QFDVL+IGGGATG GCA+DA TRGLNVALVEK D+A
Sbjct: 50  SPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYA 109

Query: 108 SGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPV 167
           SGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNERAHLL TAPHLCKILPIMIPV
Sbjct: 110 SGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPV 169

Query: 168 YNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFN 227
           Y YWQ+PYFY G KMYDLFAGSQNLKSSYLLSK SA ++APMLD++KLKAGLVYHDG+FN
Sbjct: 170 YQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFN 229

Query: 228 DSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVIN 287
           DSRMN+TLA++AIE G+TVLNYMEVKQL+K++ + K+ GAIVED ETG+ Y IKAKV++N
Sbjct: 230 DSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVN 289

Query: 288 ATGPYSDAILQMDQNPTGLPDPLNVNLKTNN-----------DIATKVSVSNPKMVVPSA 336
           ATGPYSD ILQMD N  GLPD     ++T N            I+ +V+V NP MVVPSA
Sbjct: 290 ATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSA 349

Query: 337 GVHIILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADI 396
           GVHIILPS+YCP ++GLLDA T+DGRVMFFLPWQGKVLAGTTD+PMK +PENPTATEADI
Sbjct: 350 GVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADI 409

Query: 397 QDILKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHG 456
           QDILKELQHYI+FPVKREDVLSAWAGIRPLV+DPR       G+TQ +VRSHFIFTSD+G
Sbjct: 410 QDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV---QKGGATQEVVRSHFIFTSDNG 466

Query: 457 LVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRY 516
           LVTIAGGKWTTYR MAEET+DE +K GKF N KPCITR +KLAG ENW+ NL ALL+Q+Y
Sbjct: 467 LVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKY 525

Query: 517 HLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNER 576
           ++S+ +++HLA+NYGTR+PIICEM  +  +NKLP+ LA   NE           I N   
Sbjct: 526 NVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENES----------ISNAHV 575

Query: 577 GDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDE 636
           G  ++ FRYP+T+ E+KYS++YEY  TALDFLMRR+R+AFLDAKEA+ AV GTVKIMGD 
Sbjct: 576 G--YDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDH 633

Query: 637 LNWDESRRHKEIENTIKYIKTFGV 660
           LNWD  RR +E      YIKTFGV
Sbjct: 634 LNWDNDRREREKVYATDYIKTFGV 657

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/612 (68%), Positives = 510/612 (83%), Gaps = 22/612 (3%)

Query: 50  LDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASG 109
           L++R+   P+R++L+ KL KTNQFDVLVIGGGA+GAG ALDA+TRGLNVAL+E  DFASG
Sbjct: 41  LERRAPAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASG 100

Query: 110 TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYN 169
           TSSKSTKMAHGGVRYLEKA WELSKAQLDLVIEALNERAHLL TAPHLCK+LPIMIPVY 
Sbjct: 101 TSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYK 160

Query: 170 YWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDS 229
           +WQ+PYFY G KMYD FAGSQNLKSSYLLS  +A +VAPMLD +KLKAGLVYHDG+FNDS
Sbjct: 161 WWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDS 220

Query: 230 RMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINAT 289
           RMN+T+AVTAIENG+TVLNYMEVK+L+K    GK+EGA+  D ETGK+Y ++AKVV+NAT
Sbjct: 221 RMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNAT 280

Query: 290 GPYSDAILQMDQNPTGLPDPLNVN-LKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCP 348
           GP+SD +LQMD +P GLPD   ++ +  ++ IAT+V+V+NPKMVVPS+GVHIILPS+YCP
Sbjct: 281 GPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCP 340

Query: 349 KDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIR 408
           K++GLLDA+TSDGRVMFFLPWQGKVLAGTTD+PMKQ+P NPTATEADIQDILKELQHYI+
Sbjct: 341 KNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIK 400

Query: 409 FPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTY 468
           FPVKREDV SAWAGIRPLVKDPR   KN    TQGLVRSH +FTS +G+VTI+GGKWTTY
Sbjct: 401 FPVKREDVQSAWAGIRPLVKDPR---KNL-SDTQGLVRSHLVFTSKNGMVTISGGKWTTY 456

Query: 469 RAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLAD 528
           R MAEETV+E +KVGKF N KPCITR +KL+G E+W+ NL ALL+ +Y++   L++HL+ 
Sbjct: 457 REMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQ 516

Query: 529 NYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFT 588
           NYGT+A  +CE++  DR N LP++LAA+     D                 +  FRYP+T
Sbjct: 517 NYGTKAAQVCELFEDDRANMLPVSLAADKPTSID-----------------YNAFRYPYT 559

Query: 589 VGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEI 648
           +GE+K+++ +EYA T LDFLMRR+R+AFLDAK+A+ AV+GTVK+MGD L WD ++R  E 
Sbjct: 560 IGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAET 619

Query: 649 ENTIKYIKTFGV 660
           +  I+YIKTFGV
Sbjct: 620 KYAIEYIKTFGV 631

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/612 (69%), Positives = 510/612 (83%), Gaps = 23/612 (3%)

Query: 58  PTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKM 117
           P+R++L+S L KT +FDVL+IGGGATG GCA+DA+TRGLNVAL+E  DFAS TSSKSTKM
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 118 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFY 177
           AHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAPHLCKILPIMIPVYNYW++PYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 178 AGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAV 237
           AGCKMYD FAGSQNLKS+YLLSK SA  +APMLD  KLKA LVYHDG+FND+RMN +LAV
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 238 TAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAIL 297
           TAIENG+TVLNYMEV++L+K+  +GKI+GA V D ET K+Y++ AKVV+N+TGP+SD IL
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 298 QMDQNPTGLPDPLN-VNLKT------NNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKD 350
           QMD+N +G PD  +  N+ T      ++D  ++++V NPKMVVPSAGVHIILPS+YCPKD
Sbjct: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKD 367

Query: 351 IGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFP 410
           +G+LD KT+DGRVMFFLPWQ KVLAGTTD+PMK++PENP ATEADI+DIL ELQHY +FP
Sbjct: 368 MGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKFP 427

Query: 411 VKREDVLSAWAGIRPLVKDPRTLDKN--GDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTY 468
           VKREDVLSAWAGIRPLV+DPR L  N  GD STQGLVRSHFIFTS++ LVTIAGGKWTTY
Sbjct: 428 VKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTY 487

Query: 469 RAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLAD 528
           R MAEET+DEAIKVG+  N KP +T+D+ L+GGENW PN  ALL+Q+YH+ S LS++L++
Sbjct: 488 RRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLSE 546

Query: 529 NYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFT 588
           NYGTRAPIICE+  KD+KN+LP+ LA    EH + + N +           F+  RYP+T
Sbjct: 547 NYGTRAPIICELLKKDKKNELPVTLAG--KEHNEILGNVD-----------FQALRYPYT 593

Query: 589 VGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEI 648
           V EVKY ++ EY+ TALDFL+RR+RF FLDAKEA++AVEGTV IMGDELNWD  +R  EI
Sbjct: 594 VAEVKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEI 653

Query: 649 ENTIKYIKTFGV 660
           + + +YIKT GV
Sbjct: 654 KKSKEYIKTLGV 665

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/607 (68%), Positives = 500/607 (82%), Gaps = 16/607 (2%)

Query: 59  TRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMA 118
           +R DL+ +L KT+QFDVL+IGGGATG GCALDA TRGLNVALVEK DFASGTSSKSTKM 
Sbjct: 54  SRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 113

Query: 119 HGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYA 178
           HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+Y+ WQ+PY Y 
Sbjct: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173

Query: 179 GCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVT 238
           GCK YD FAGSQNLK SYLLSK +  + APML T  LKA LVYHDG+FNDSR+N+TLA+T
Sbjct: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233

Query: 239 AIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQ 298
           A+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   I AK V+NATGPYSDAILQ
Sbjct: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293

Query: 299 MDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357
           MD+NP+GLPD PLN N K  +    +++V +PKMV+PS GVHI+LPSFYCPKD+GLLD +
Sbjct: 294 MDRNPSGLPDSPLNDNSKIKSTF-NQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVR 352

Query: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417
           TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDILKELQHYI FPVKREDVL
Sbjct: 353 TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVL 412

Query: 418 SAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEET 475
           SAWAG+RPLV+DPRT+  +G    +TQG+VRSHF+FTSD+GL+TIAGGKWTTYR MAEET
Sbjct: 413 SAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEET 472

Query: 476 VDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAP 535
           VD+ ++VG F N+KPC TRDIKLAG E W  N  ALLAQ YHLSSK+S +L  NYGTR+ 
Sbjct: 473 VDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSS 532

Query: 536 IICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDV--FECFRYPFTVGEVK 593
           IICE + +  +NKLP++LA          +  N++IY++E  ++  F+ FRYPFT+GE+K
Sbjct: 533 IICEFFKESMENKLPLSLA----------DKENNVIYSSEENNLVNFDTFRYPFTIGELK 582

Query: 594 YSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIK 653
           YS+ YEY  T LDFL+RR+RFAFLDAKEA++AV  TVK+MGDE NW E +R  E+E T+ 
Sbjct: 583 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVN 642

Query: 654 YIKTFGV 660
           +IKTFGV
Sbjct: 643 FIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/625 (66%), Positives = 504/625 (80%), Gaps = 16/625 (2%)

Query: 41  QEDGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVAL 100
           + D   + P    +    +R DL+ +L KT+QFDVL+IGGGATG GCALDA TRGLNVAL
Sbjct: 36  RNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVAL 95

Query: 101 VEKYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKI 160
           VEK DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +
Sbjct: 96  VEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTV 155

Query: 161 LPIMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLV 220
           LPI+IP+YN WQ+PY Y GCK YD FAGSQNLK SYLLSK +  + APML T  LKA LV
Sbjct: 156 LPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLV 215

Query: 221 YHDGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNI 280
           YHDG+FNDSR+N+TLA+TA+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   I
Sbjct: 216 YHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKI 275

Query: 281 KAKVVINATGPYSDAILQMDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVH 339
            AK V+NATGPYSDAILQMD+NP+G P+ PLN N    +    +++V++PKMV+PS GVH
Sbjct: 276 NAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTF-NQIAVTDPKMVIPSIGVH 334

Query: 340 IILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDI 399
           I+LPSFYCPKD+GLLD +TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDI
Sbjct: 335 IVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDI 394

Query: 400 LKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGL 457
           LKELQHYI FPVKREDVLSAWAG+RPLV+DPRT+  +G    +TQG+VRSHF+FTSD+GL
Sbjct: 395 LKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGL 454

Query: 458 VTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYH 517
           +TIAGGKWTTYR MAEETVD+ ++VG+F N+KPC TRDIKLAG E W  N  ALLAQ YH
Sbjct: 455 ITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH 514

Query: 518 LSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERG 577
           LSSK+S +L  NYGTR+ IICE + +  +NKLP++LA          +  N++IY++E  
Sbjct: 515 LSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLA----------DKENNVIYSSEEN 564

Query: 578 DV--FECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGD 635
           ++  F+ FRYPFT+GE+KYS+ YEY  T LDFL+RR+RFAFLDAKEA+++   TVK+MGD
Sbjct: 565 NLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGD 624

Query: 636 ELNWDESRRHKEIENTIKYIKTFGV 660
           E NW E +R  E+E TI +IKTFGV
Sbjct: 625 EFNWSEKKRQWELEKTINFIKTFGV 649

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/623 (66%), Positives = 518/623 (83%), Gaps = 22/623 (3%)

Query: 46  LISPLDKRSVNLPTRNDLISKLN-KTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKY 104
           LISP++   +NLP+R+ L ++L  K +QFD+L+IGGGATG GCALDA TRGLNVALVE+ 
Sbjct: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERD 104

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIM 164
           DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLVIEALNERAHLLNTAPHLCKILPI+
Sbjct: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164

Query: 165 IPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDG 224
           IPVYNYWQ+PYFYAGCK YD FAG QNLKSSYL+S+++A ++APMLD   LKA LVYHDG
Sbjct: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224

Query: 225 TFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKV 284
           +FNDSR+NS++A+TAIENG+TVLNY+EV++LLK+  S KI G  V+D ETG+  N+K+KV
Sbjct: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284

Query: 285 VINATGPYSDAILQMDQNPTGLPDPLNVNLKTN--NDIATKVSVSNPKMVVPSAGVHIIL 342
           ++NATGPYSD ILQMD+N +GLPD  N++ K    NDI++K++VSNPKMVVPS+GVHIIL
Sbjct: 285 IVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIIL 344

Query: 343 PSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKE 402
           PS+YCPK +GLLDA+T+DGRVMFFLPWQGKV+AGTTD+PM Q+P+ P A E DIQDILKE
Sbjct: 345 PSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKE 404

Query: 403 LQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD---GSTQGLVRSHFIFTSDHGLVT 459
           LQHYI+FPV+REDVLSAWAGIRPLV+DPR +  +     G+TQGLVRSHF+FTSD+GL+T
Sbjct: 405 LQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLIT 464

Query: 460 IAGGKWTTYRAMAEETVDEAIKVGKFAN-VKPCITRDIKLAGGENWNPNLQALLAQRYHL 518
           IAGGKWTTYR MAEET+DE +K G FAN  KPC T+D+KL G ENW+PNL ALL+Q+++L
Sbjct: 465 IAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNL 524

Query: 519 SSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGD 578
           SS ++++L++NYGTR+ IIC+++ ++  NKLP+ LA         IE+   L      G+
Sbjct: 525 SSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAG--------IEDKPIL------GN 570

Query: 579 V-FECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDEL 637
           V F  FRYP T+ E+KY++ YEYA T LDFLMRR+RFA+LDA +A+ AV+GTVK+MGDE 
Sbjct: 571 VDFNTFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEF 630

Query: 638 NWDESRRHKEIENTIKYIKTFGV 660
            WD  RR +EI+N   +I++FGV
Sbjct: 631 GWDSKRREQEIKNATLFIESFGV 653

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/607 (67%), Positives = 497/607 (81%), Gaps = 16/607 (2%)

Query: 59  TRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMA 118
           +R DL+ +L KT+QFDVL+IGGGATG GCALDA TRGLNVALVEK DFASGTSSKSTKM 
Sbjct: 57  SRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 116

Query: 119 HGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYA 178
           HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+Y+  Q+PY Y 
Sbjct: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176

Query: 179 GCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVT 238
           GCK YD FAGSQNLK SYLLSK +  + APML T  LKA LVYHDG+FNDSR+N+TLA+T
Sbjct: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236

Query: 239 AIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQ 298
           A+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   IKAK V+NATGPYSDAILQ
Sbjct: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296

Query: 299 MDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357
           MD+NP+G PD PLN N K  +    +++V +PKMV+PS GVHI+LPSFYCPKD+GLLD +
Sbjct: 297 MDRNPSGQPDSPLNDNSKAKSAF-NQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVR 355

Query: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417
           TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDILKELQHYI FPVKREDVL
Sbjct: 356 TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVL 415

Query: 418 SAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEET 475
           SAWAG+RPLV+DPRT+  +G    +TQG+VRSHF+FTSD+ L+TIAGGKWTTYR MAEET
Sbjct: 416 SAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEET 475

Query: 476 VDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAP 535
           +D+ ++VG F N+ PC TRDIKLAG E W  N  ALLAQ YHLSSK+S +L  NYGTR+ 
Sbjct: 476 IDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSS 535

Query: 536 IICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDV--FECFRYPFTVGEVK 593
           IICE + +  +NKLP++LA          +  N++IY++E  ++  F+ FRYPFT+GE+K
Sbjct: 536 IICEYFKESMENKLPLSLA----------DKENNVIYSSEENNLVNFDTFRYPFTIGELK 585

Query: 594 YSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIK 653
           YS+ YEY  T LDFL+RR+RFAFLDAKEA+++V  TVK+MGDE NW E +R  E+E T+ 
Sbjct: 586 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVN 645

Query: 654 YIKTFGV 660
           +IKTFGV
Sbjct: 646 FIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/549 (66%), Positives = 445/549 (81%), Gaps = 16/549 (2%)

Query: 117 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYF 176
           M HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+YN WQ+PY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 177 YAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLA 236
           YAGCK YD FAG QNLKSSYLLSK +  + APML T  LKA LVYHDG+FNDSR+N+TLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 237 VTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAI 296
           +TA+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   I AK V+NATGPYSDAI
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 297 LQMDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLD 355
           LQMD+N +G P+ PLN N K  +    +V+V +P+MV+PS GVHI+LPSFYCPKDIGLLD
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAF-NQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLD 239

Query: 356 AKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKRED 415
            +TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDILKELQHYI FPVKRED
Sbjct: 240 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 299

Query: 416 VLSAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAE 473
           VLSAWAG+RPLV+DPR++   G    +TQG+VRSHF+FTSD+GL+TIAGGKWTTYR MAE
Sbjct: 300 VLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAE 359

Query: 474 ETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTR 533
           ET+D+ ++VG F N+KPC TRDIKLAG E W  N  ALLAQ YHLSSK+S +L +NYGTR
Sbjct: 360 ETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTR 419

Query: 534 APIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDV--FECFRYPFTVGE 591
           + IICE +    +NKLP++LA          +  N+ IY+NE  ++  F+ FRYPFT+GE
Sbjct: 420 SSIICEFFKDSMENKLPLSLA----------DKENNTIYSNEENNLVNFDTFRYPFTIGE 469

Query: 592 VKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENT 651
           +KYS+ YEY  T LDFL+RR+RFAFLDAKEA+++V  TVK+MGDE NW + +R  E+E T
Sbjct: 470 LKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKT 529

Query: 652 IKYIKTFGV 660
           + +IKTFGV
Sbjct: 530 VNFIKTFGV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/605 (64%), Positives = 473/605 (78%), Gaps = 20/605 (3%)

Query: 58  PTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKM 117
           P R  ++ +L  T +FDVLV+GGGATG G ALDA+ RGL VALVEK DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 118 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFY 177
           AHGGVRYLEKA +ELSK QLDLV+EALNERAHLL  APHL KILPI+IPVY YW++PYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 178 AGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAV 237
           AGCKMYD FAG+QNLKSSYLLS+ + + +APMLD  KLK GLVYHDG FNDSR+ +TLA+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 238 TAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAIL 297
           +A+E G+TV NY+ V+QL+K+K +G I GA VED ETG  + + AK+V+NATGPYSD IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 298 QMDQNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357
           QMD NP GLP+         N +   ++V NPKMVVPS GVHI LPSFYCP ++GLLDA 
Sbjct: 298 QMDANPQGLPEKEPEKATPENAL---IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDAS 354

Query: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417
           TSDGRVMFFLPWQGKV+AGTTD+P+KQ+P +P+ TEADIQDIL+ELQHYI+FPV+REDVL
Sbjct: 355 TSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVL 414

Query: 418 SAWAGIRPLVKDPRTLDKN-GDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETV 476
           SAWAGIRPLV+DPR  + + G G T+GLVRSHFIFTS   LVTIAGGKWTTYR MAEETV
Sbjct: 415 SAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474

Query: 477 DEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYH-LSSKLSQHLADNYGTRAP 535
           DE IKVGKF  +KPC TR  KL G ++WN N QA L QRY  L   L++HLA+NYG RAP
Sbjct: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534

Query: 536 IICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYS 595
           IICEM+  D+ +KLP+ L   Y + +D+++N +              F YPFT+ E+KY 
Sbjct: 535 IICEMFEADKSSKLPVGL---YGDGDDKVKNMDA-----------NAFDYPFTIAELKYC 580

Query: 596 VNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYI 655
           + +EY  TALDFL+RRSRFAFLDA+EA++AV+ TV ++GDEL WD  +R  E   T  YI
Sbjct: 581 IRFEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYI 640

Query: 656 KTFGV 660
           KTFGV
Sbjct: 641 KTFGV 645

>Kwal_33.14015 s33 complement(484017..484832) [816 bp, 271 aa] {ON}
           YKR055W (RHO4) - ras homolog--GTP binding protein
           [contig 106] FULL
          Length = 271

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 84/212 (39%), Gaps = 34/212 (16%)

Query: 37  APSYQEDGKLISPLDKRSVNLPTRNDLI-SKLNKTNQFDVLVIGGGATGAGCALDATTRG 95
           +P     GKL +PL +    +P+   +  S+    +   ++V+G GA G  C L + T+G
Sbjct: 29  SPLSGSRGKLPTPLARTLTEVPSYERVKRSQKVADHHLKIVVVGDGAVGKTCLLISYTQG 88

Query: 96  LNVALVEKYDFASGTSSKSTKMAHGGVRYLEKAFWE------------LSKAQLDL--VI 141
                 E+Y   +   +  TKM       +E A W+            LS   +DL  V 
Sbjct: 89  ---HFPEEY-IPTVFENYVTKMKGPDNTVVELALWDTAGQEEYNRLRPLSYTDVDLLMVC 144

Query: 142 EALNERAHLLNTAP-------HLCKILPIMI-----PVYNYWQIPYFYAGCKMYDLFAGS 189
            +++ +  LLN          H C   PI++      +Y    +       +  DLFA  
Sbjct: 145 YSVDSKTSLLNVQELWIPEVRHFCPDTPILLVGLKSDLYALDNLDKLVDPGEA-DLFATE 203

Query: 190 QNLKSSYLLSKRSAADVAPMLDTTKLKAGLVY 221
            NL   Y  S +S  +V  + +     A L+Y
Sbjct: 204 HNLLGHYQCSSKSRQNVEELFNVA--MATLLY 233

>KLLA0B13167g Chr2 (1152802..1153566) [765 bp, 254 aa] {ON} similar
           to uniprot|P53237 Saccharomyces cerevisiae YGR057C LST7
           Protein possibly involved in a post-Golgi secretory
           pathway required for the transport of nitrogen-
           regulated amino acid permease Gap1p from the Golgi to
           the cell surface
          Length = 254

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 3/115 (2%)

Query: 447 SHFIFTSDH-GLVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWN 505
           S F+F  +H GL    G K     A   E       +       PC   D+     +NW 
Sbjct: 106 SPFMFCDEHRGLNLAVGFKLEDVHARGNER--RYCLILSLEKRNPCDGNDVFKTLSDNWQ 163

Query: 506 PNLQALLAQRYHLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEH 560
             +++L     H+  +  + L       A I+   Y ++ K KLP++LA   N+ 
Sbjct: 164 FIIESLSKLIDHIKIQAREQLNRRQTDFAQIMGGTYLRENKQKLPVSLADIVNDQ 218

>Smik_6.60 Chr6 complement(115090..116589) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 51  DKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGT 110
           +KR+ +   R   I+K       DV++IGGG  G   A+ A   G N A VEK     GT
Sbjct: 10  NKRAFSSTVRTLTINK-----SHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGT 64

>YFL018C Chr6 complement(101628..103127) [1500 bp, 499 aa] {ON}
           LPD1Dihydrolipoamide dehydrogenase, the lipoamide
           dehydrogenase component (E3) of the pyruvate
           dehydrogenase and 2-oxoglutarate dehydrogenase
           multi-enzyme complexes
          Length = 499

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 51  DKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGT 110
           +KR+ +   R   I+K       DV++IGGG  G   A+ A   G N A VEK     GT
Sbjct: 10  NKRAFSSTVRTLTINK-----SHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGT 64

>Skud_6.53 Chr6 complement(103908..105407) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 67  LNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGT 110
           +NK++  DV++IGGG  G   A+ A   G N A VEK     GT
Sbjct: 23  INKSH--DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGT 64

>Suva_6.41 Chr6 complement(74641..76140) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 64  ISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGT 110
           +  L      DV++IGGG  G   A+ A   G N A VEK     GT
Sbjct: 18  VRALTVNKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGT 64

>KLLA0D11154g Chr4 (952049..953530) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P09624 Saccharomyces cerevisiae
           YFL018C LPD1 Dihydrolipoamide dehydrogenase the
           lipoamide dehydrogenase component (E3) of the pyruvate
           dehydrogenase and 2-oxoglutarate dehydrogenase multi-
           enzyme complexes
          Length = 493

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%)

Query: 70  TNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGT 110
           T + D++VIGGG  G   A+ A   G +VA VEK     GT
Sbjct: 20  TKKHDLVVIGGGPGGYVAAIKAAQLGYDVACVEKRGRLGGT 60

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 341 ILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIP 386
           +L  F CPK+ G+LDA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 980

>KAFR0A07650 Chr1 complement(1539297..1542491) [3195 bp, 1064 aa]
           {ON} Anc_2.58 YNL192W
          Length = 1064

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 58/139 (41%), Gaps = 27/139 (19%)

Query: 149 HLLNTAPHLCKILPIMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAP 208
           H+L +      + P  I + N       YA C ++D+  G++   S   L K +  +   
Sbjct: 866 HMLTSFAQYLLLSPSYINILN------IYAFCNVHDISWGTKGAVSKKPLGKINTKE--- 916

Query: 209 MLDTTKLKAGLVYHDGTFNDSRMNSTLAVTAIE-NGSTVLNYMEVKQLLKEKGSGKIEGA 267
                         DGTF   +M   ++   I+ N S  +N ++ K    E G     GA
Sbjct: 917 --------------DGTF---KMEVLISSEEIQSNYSKYMNILQSKDASVEDGGNNNGGA 959

Query: 268 IVEDLETGKQYNIKAKVVI 286
           + E+ +TG   N+++ V+I
Sbjct: 960 LTEEQKTGYYANVRSLVII 978

>CAGL0F01947g Chr6 complement(189377..190858) [1482 bp, 493 aa] {ON}
           highly similar to uniprot|P09624 Saccharomyces
           cerevisiae YFL018c LPD1 dihydrolipoamide dehydrogenase
           precursor
          Length = 493

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 72  QFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGT 110
           Q D+++IGGG  G   A+ A   GL+ A +EK     GT
Sbjct: 22  QHDLVIIGGGPGGYVAAIKAAQLGLDTACIEKRGSLGGT 60

>TPHA0K02140 Chr11 (456578..459427) [2850 bp, 949 aa] {ON} Anc_4.34
           YHL023C
          Length = 949

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 602 ITALDFLMRRSRFAF-LDAKEAVHAVEGTVKIMGDELNWDESRRHKEIE-NTIKYIKTF 658
           IT+ + L RRS  A  L +  ++  +  +VKI GDE +++++   KE+E N+I Y   F
Sbjct: 214 ITSSNTLKRRSSLASKLSSVNSIDDLTDSVKIDGDEYDYNDTELLKELEKNSISYNDEF 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,111,075
Number of extensions: 3156976
Number of successful extensions: 9124
Number of sequences better than 10.0: 59
Number of HSP's gapped: 9267
Number of HSP's successfully gapped: 60
Length of query: 660
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 544
Effective length of database: 40,180,143
Effective search space: 21857997792
Effective search space used: 21857997792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)