Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D021605.712ON84684637590.0
NCAS0G001705.712ON103070412111e-151
NDAI0F002005.712ON110546011181e-136
TDEL0B020805.712ON102547210481e-127
KLTH0E00814g5.712ON97444310411e-126
KLLA0A00396g5.712ON101244610431e-126
TPHA0D046605.712ON104543910371e-125
Kwal_55.196455.712ON97043610221e-124
Kpol_2001.785.712ON4034049271e-116
Ecym_40095.712ON15174349921e-116
AFR296C5.712ON11694449271e-108
Smik_11.3625.712ON7214498981e-108
YKR098C (UBP11)5.712ON7174408901e-107
Suva_11.3355.712ON7244388701e-104
Skud_11.3385.712ON7124328611e-103
CAGL0H06721g5.712ON10816178731e-101
KAFR0H001505.712ON6564597931e-93
CAGL0G02563gsingletonON6314417412e-86
YIL156W (UBP7)5.712ON10712537625e-86
Suva_9.305.712ON10622527591e-85
KNAG0L022005.712ON11612517621e-85
Skud_9.125.712ON10642537502e-84
TBLA0E017605.712ON12122577482e-83
Smik_9.135.712ON10602537422e-83
SAKL0E15136g5.712ON10372457316e-82
ZYRO0B16544g5.712ON10442516648e-73
KAFR0C025908.188ON9784453853e-37
TDEL0B042208.188ON8254333815e-37
YER144C (UBP5)8.188ON8054343744e-36
Skud_4.3238.188ON9264373711e-35
KNAG0D019308.188ON9864733702e-35
Suva_2.2288.188ON9274353683e-35
NCAS0B042808.188ON9224713674e-35
CAGL0I06765g8.188ON8874443631e-34
TPHA0C027708.188ON9704643622e-34
Kpol_1032.288.188ON8824663612e-34
ZYRO0G06798g8.188ON8774403602e-34
Smik_4.3078.188ON9294373603e-34
YDR069C (DOA4)8.188ON9264513594e-34
CAGL0G05247g8.188ON9474383577e-34
TBLA0F036108.188ON11444893579e-34
Skud_5.2818.188ON8234353541e-33
AFR007W8.188ON8484133541e-33
Ecym_61848.188ON8514433541e-33
Kwal_14.20088.188ON4244383402e-33
Smik_5.3098.188ON8054383513e-33
NDAI0A036808.188ON11164443506e-33
Suva_5.2728.188ON7884483461e-32
SAKL0H18986g8.188ON8934423433e-32
KLTH0H07678g8.188ON8614403424e-32
KLLA0E10275g8.188ON7964473343e-31
NDAI0C059008.188ON8264653102e-28
NCAS0A039108.188ON7954392844e-25
KNAG0G015908.188ON6714302735e-24
TPHA0A025401.137ON12861952345e-19
NCAS0I031401.137ON12012082158e-17
Kpol_2001.541.137ON12231972151e-16
KNAG0C021801.137ON12312002141e-16
Ecym_81401.137ON12642152085e-16
Suva_6.2761.137ON12562002077e-16
AFR627C1.137ON12872132061e-15
Kwal_33.136281.137ON11601962032e-15
YJL197W (UBP12)1.137ON12542212032e-15
TDEL0C056401.137ON11782052032e-15
ZYRO0C17908g1.137ON12042102023e-15
KLTH0F03674g1.137ON11981962014e-15
Skud_10.221.137ON12552002005e-15
Smik_10.371.137ON12472001997e-15
NDAI0B004801.137ON12532021981e-14
KAFR0F015601.137ON11711991952e-14
NCAS0D023905.18ON12113801916e-14
Kpol_304.65.712ON5621991833e-13
KNAG0E012905.18ON11964011853e-13
CAGL0L01639g1.137ON11472061835e-13
NCAS0E026107.390ON7172871825e-13
TBLA0J006001.137ON14622121792e-12
SAKL0C04246g1.137ON12972141782e-12
KLLA0C03476g1.137ON12522101754e-12
TBLA0C070205.18ON12474001712e-11
KLLA0C06974g8.742ON4463931682e-11
TBLA0D010708.742ON4834041663e-11
Kpol_513.255.18ON11903971658e-11
NDAI0I025305.18ON11974121621e-10
CAGL0A04477g7.390ON7703671602e-10
CAGL0I05522g7.390ON7243771602e-10
Smik_13.5215.18ON12313871594e-10
Ecym_56715.18ON11763821585e-10
YMR223W (UBP8)8.742ON4714001556e-10
Smik_13.4318.742ON4713911531e-09
YMR304W (UBP15)5.18ON12303711541e-09
Skud_13.4785.18ON12313871541e-09
TDEL0G004105.18ON11863801523e-09
TPHA0G005608.742ON4633981493e-09
Suva_13.4955.18ON12303861513e-09
TDEL0B036708.742ON4633981468e-09
ZYRO0B03300g7.390ON8133241461e-08
KNAG0C035807.390ON7763721461e-08
AGL357W5.18ON11664001471e-08
ZYRO0D07062g5.18ON11933901433e-08
Suva_13.4078.742ON4714001413e-08
SAKL0H04994g8.742ON4544021404e-08
NDAI0E041807.390ON8272641381e-07
SAKL0H00418g5.18ON11902181381e-07
CAGL0M13783g5.18ON11962181381e-07
KAFR0I026005.18ON12132181343e-07
NCAS0A038408.202ON9171511334e-07
Kpol_1064.488.742ON4663991324e-07
CAGL0M11198g8.742ON4614111315e-07
TPHA0L022905.18ON11932191326e-07
SAKL0H18656g8.202ON7721591291e-06
Ecym_46857.390ON7782641281e-06
Kwal_26.95985.18ON11913851291e-06
Klac_YGOB_Anc_5.18b5.18ON11663781281e-06
KLTH0D12760g8.742ON4533931262e-06
Smik_2.497.390ON7451261262e-06
KNAG0G029308.742ON4592311253e-06
Kwal_26.91518.742ON4542941243e-06
Skud_13.3928.742ON4734151243e-06
TBLA0C012001.369ON5031121225e-06
Suva_2.507.390ON7501261228e-06
NDAI0C059508.202ON10801541201e-05
Skud_2.387.390ON7481241192e-05
Ecym_27171.369ON4831151182e-05
Kpol_534.231.369ON4961271182e-05
ZYRO0A05962g8.742ON4652951182e-05
KAFR0A042108.742ON4403891172e-05
KNAG0B023707.390ON7532611182e-05
NCAS0A143707.390ON7291281173e-05
TBLA0B019308.202ON10191521173e-05
YBL067C (UBP13)7.390ON7471261164e-05
AEL029W1.369ON4461111146e-05
NDAI0A016707.390ON8461231147e-05
Smik_5.3188.202ON9091561121e-04
KLTH0B09944g5.18ON11892261121e-04
TDEL0C015707.390ON7653671121e-04
CAGL0I06600g8.202ON8161521111e-04
TPHA0A025101.369ON5051121073e-04
Suva_5.2177.390ON7543201074e-04
CAGL0K10494g1.369ON4951141065e-04
AGR370W7.390ON7403171067e-04
KAFR0L017307.390ON7011291057e-04
TPHA0E008707.390ON7152291058e-04
YER151C (UBP3)8.202ON9121551059e-04
AEL242W8.540ON6132531040.001
NCAS0D006001.369ON4931131030.001
NDAI0F034102.69ON8702081040.001
NCAS0B005808.742ON4662431030.001
TDEL0A016208.202ON7951791030.001
SAKL0E13002g2.69ON7393981030.001
CAGL0J11352g2.69ON7712101020.002
KNAG0J008003.270ON7651091010.002
Kpol_1018.937.390ON7551301010.002
KNAG0C019401.369ON4991131000.002
ZYRO0B11044g8.202ON8261521010.002
Kwal_14.19578.202ON4441511000.002
Kwal_34.162681.369ON4491081000.003
KLLA0E20351g7.390ON6971371000.003
Kpol_1045.417.390ON7121301000.003
Suva_5.2808.202ON9051551000.003
YFR010W (UBP6)1.369ON499120990.003
TBLA0E025703.270ON785118990.004
ZYRO0G01188g1.369ON500128980.004
YOR124C (UBP2)5.443ON127252990.005
KAFR0C004103.270ON769226980.005
Skud_15.2865.443ON127854980.006
Skud_5.2237.390ON74865970.006
Kwal_27.108427.390ON711258970.006
Suva_8.1765.443ON127052970.007
Smik_15.3015.443ON127252970.007
Skud_14.1482.69ON776207970.007
Skud_5.2898.202ON910155970.007
TPHA0D043508.202ON854151970.007
KLLA0E01013g8.202ON774152970.008
KAFR0B023708.202ON829152970.008
ZYRO0F01276g3.270ON776187960.008
KAFR0K018107.390ON71442960.009
Skud_6.941.369ON499109950.009
TPHA0J026205.443ON122564950.012
KLTH0H13354g1.369ON495122940.013
SAKL0D10120g1.369ON49229940.014
CAGL0H10186g3.270ON778230940.014
Suva_6.831.369ON500109930.018
KLTH0H07370g8.202ON781153930.018
YPL072W (UBP16)8.540ON49977920.023
NDAI0E008108.742ON493404920.023
KNAG0B041905.443ON126230930.025
SAKL0F12430g7.390ON75451920.026
YER098W (UBP9)7.390ON754122920.029
KNAG0A054502.307ON764111920.030
CAGL0H05335g8.540ON483163910.031
ZYRO0G01606g5.443ON130533910.037
Smik_5.2447.390ON749122910.039
NDAI0H035501.369ON50229900.044
NCAS0C021108.540ON494282900.044
SAKL0H10076g8.540ON76776900.045
Smik_7.3141.369ON49936900.047
TPHA0E017105.443ON128327900.054
NCAS0H021005.443ON126930900.054
Kpol_1062.235.443ON126627900.056
TPHA0P006807.390ON727131890.058
Kpol_1016.15.443ON125158890.058
KLLA0A10791g1.369ON48430890.058
TBLA0A064705.443ON132030890.061
KNAG0A019708.540ON471157880.062
NDAI0C015505.443ON1295208890.071
TDEL0D024001.369ON49429880.072
SAKL0G02728g5.443ON123730890.072
TBLA0D006207.390ON117129890.073
KAFR0E009308.540ON498247880.079
Kpol_1055.318.202ON822156880.082
KAFR0C045201.369ON499111870.088
CAGL0K10252g5.443ON126726870.10
Ecym_55448.202ON834154870.11
AGR139C8.202ON789156870.11
NCAS0G018002.69ON875198870.11
KLLA0E02377g5.443ON122030870.11
KAFR0A069102.307ON678127870.11
Skud_16.2098.540ON50372860.12
Ecym_11668.540ON69676860.13
Ecym_62488.742ON466137860.13
TDEL0D035503.270ON78019860.14
KAFR0D050705.443ON122759850.17
SAKL0D03322g3.270ON76536850.18
TDEL0D025805.443ON127230850.18
Ecym_45145.443ON124627850.22
Kwal_55.213935.443ON123330840.23
ACL164C5.443ON138931840.23
NCAS0I016203.270ON79536840.24
KLTH0F15862g5.443ON124127840.29
TPHA0L016708.540ON52476830.30
Kpol_251.73.270ON480113830.31
TDEL0B030608.540ON734112820.36
Kpol_1024.448.540ON49677820.42
AFR551W8.742ON469108810.44
KLLA0E08801g2.307ON77123810.49
Kpol_1056.458.97ON451102800.54
KLLA0E23387g8.540ON78276800.62
NDAI0A074103.270ON81019800.63
Skud_4.1332.307ON78738800.64
Suva_4.1252.307ON79338800.74
Smik_4.1152.307ON79038790.92
Smik_16.1638.540ON50172771.6
Skud_2.1773.270ON782219771.8
KLTH0C07326g3.270ON76219762.2
YDL122W (UBP1)2.307ON80938762.2
Kwal_56.230843.270ON76219752.4
AGR023C3.270ON78019743.4
NDAI0B034302.307ON85630734.2
NDAI0G007802.307ON48678734.5
KLLA0F18700g3.270ON770144734.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D02160
         (846 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...  1452   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     471   e-151
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     435   e-136
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   408   e-127
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   405   e-126
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   406   e-126
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   404   e-125
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   398   e-124
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   361   e-116
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   386   e-116
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   361   e-108
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   350   e-108
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   347   e-107
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   339   e-104
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   336   e-103
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   340   e-101
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   310   1e-93
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   290   2e-86
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   298   5e-86
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   296   1e-85
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   298   1e-85
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   293   2e-84
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   292   2e-83
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   290   2e-83
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   286   6e-82
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   260   8e-73
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   152   3e-37
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   151   5e-37
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   148   4e-36
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   147   1e-35
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   147   2e-35
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   146   3e-35
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    145   4e-35
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   144   1e-34
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   144   2e-34
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   143   2e-34
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   143   2e-34
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   143   3e-34
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   142   4e-34
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   142   7e-34
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   142   9e-34
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   140   1e-33
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   140   1e-33
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   140   1e-33
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   135   2e-33
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   139   3e-33
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             139   6e-33
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   137   1e-32
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   136   3e-32
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   136   4e-32
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   133   3e-31
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   124   2e-28
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188    114   4e-25
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...   109   5e-24
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    95   5e-19
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    87   8e-17
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    87   1e-16
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    87   1e-16
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    85   5e-16
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    84   7e-16
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    84   1e-15
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    83   2e-15
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    83   2e-15
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    83   2e-15
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    82   3e-15
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    82   4e-15
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    82   5e-15
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    81   7e-15
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    81   1e-14
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    80   2e-14
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    78   6e-14
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...    75   3e-13
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    76   3e-13
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    75   5e-13
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    75   5e-13
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    74   2e-12
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    73   2e-12
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    72   4e-12
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    70   2e-11
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    69   2e-11
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    69   3e-11
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    68   8e-11
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    67   1e-10
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    66   2e-10
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    66   2e-10
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    66   4e-10
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    65   5e-10
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    64   6e-10
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    64   1e-09
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    64   1e-09
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    64   1e-09
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    63   3e-09
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    62   3e-09
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    63   3e-09
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    61   8e-09
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    61   1e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    61   1e-08
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    61   1e-08
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    60   3e-08
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    59   3e-08
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    59   4e-08
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    58   1e-07
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    58   1e-07
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    58   1e-07
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    56   3e-07
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    56   4e-07
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    55   4e-07
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    55   5e-07
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    55   6e-07
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    54   1e-06
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    54   1e-06
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    54   1e-06
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    54   1e-06
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    53   2e-06
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    53   2e-06
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    53   3e-06
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    52   3e-06
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    52   3e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    52   5e-06
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    52   8e-06
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    51   1e-05
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    50   2e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    50   2e-05
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    50   2e-05
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    50   2e-05
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    50   2e-05
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    50   2e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    50   3e-05
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    50   3e-05
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    49   4e-05
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    49   6e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    49   7e-05
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    48   1e-04
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    48   1e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    48   1e-04
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    47   1e-04
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    46   3e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    46   4e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   5e-04
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    45   7e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   7e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    45   8e-04
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    45   9e-04
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    45   0.001
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    44   0.001
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    45   0.001
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       44   0.001
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    44   0.001
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    44   0.001
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    44   0.002
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    44   0.002
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    44   0.002
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    43   0.002
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    44   0.002
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    43   0.002
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    43   0.003
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    43   0.003
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    43   0.003
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    43   0.003
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    43   0.003
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    43   0.004
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    42   0.004
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    43   0.005
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    42   0.005
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    42   0.006
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    42   0.006
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    42   0.006
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    42   0.007
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    42   0.007
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    42   0.007
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    42   0.007
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    42   0.007
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    42   0.008
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    42   0.008
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    42   0.008
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    42   0.009
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    41   0.009
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    41   0.012
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    41   0.013
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    41   0.014
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    41   0.014
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    40   0.018
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    40   0.018
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    40   0.023
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    40   0.023
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    40   0.025
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    40   0.026
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    40   0.029
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    40   0.030
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    40   0.031
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    40   0.037
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    40   0.039
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    39   0.044
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    39   0.044
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    39   0.045
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    39   0.047
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    39   0.054
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    39   0.054
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    39   0.056
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    39   0.058
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    39   0.058
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    39   0.058
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    39   0.061
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    39   0.062
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    39   0.071
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    39   0.072
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    39   0.072
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    39   0.073
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    39   0.079
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    39   0.082
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    38   0.088
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    38   0.10 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    38   0.11 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    38   0.11 
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      38   0.11 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    38   0.11 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    38   0.11 
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    38   0.12 
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    38   0.13 
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    38   0.13 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    38   0.14 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.17 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.18 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    37   0.18 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    37   0.22 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    37   0.23 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    37   0.23 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    37   0.24 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    37   0.29 
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    37   0.30 
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    37   0.31 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    36   0.36 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    36   0.42 
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    36   0.44 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    36   0.49 
Kpol_1056.45 s1056 complement(114032..115387) [1356 bp, 451 aa] ...    35   0.54 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    35   0.62 
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    35   0.63 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    35   0.64 
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    35   0.74 
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    35   0.92 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    34   1.6  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   1.8  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    34   2.2  
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    34   2.2  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    33   2.4  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    33   3.4  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     33   4.2  
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               33   4.5  
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    33   4.8  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    32   5.6  
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    32   9.1  

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 1452 bits (3759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/846 (86%), Positives = 735/846 (86%)

Query: 1   MESISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKGNTD 60
           MESISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKGNTD
Sbjct: 1   MESISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKGNTD 60

Query: 61  SLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESEN 120
           SLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESEN
Sbjct: 61  SLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESEN 120

Query: 121 ILQSFDVDAPSSHSQHEEDNTADSSTTIWQAPFLEPNDQLKLAIIXXXXXXXXXXXXXXX 180
           ILQSFDVDAPSSHSQHEEDNTADSSTTIWQAPFLEPNDQLKLAII               
Sbjct: 121 ILQSFDVDAPSSHSQHEEDNTADSSTTIWQAPFLEPNDQLKLAIISSESELESETEVEAE 180

Query: 181 IDINANESKYTNFINDKTINDEDTYLKHLYEECFITPHELFSILSNPXXXXXXXXXXXXX 240
           IDINANESKYTNFINDKTINDEDTYLKHLYEECFITPHELFSILSNP             
Sbjct: 181 IDINANESKYTNFINDKTINDEDTYLKHLYEECFITPHELFSILSNPSDRLKILIIDLRL 240

Query: 241 XXYFNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSLFSNPLFQKIDLFSYIIIYSDNET 300
             YFNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSLFSNPLFQKIDLFSYIIIYSDNET
Sbjct: 241 SRYFNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSLFSNPLFQKIDLFSYIIIYSDNET 300

Query: 301 TTAFESFEYNXXXXXXXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNK 360
           TTAFESFEYN             VTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNK
Sbjct: 301 TTAFESFEYNFSFFKLLMSSSMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNK 360

Query: 361 RFTEPPSWNXXXXXXXXXXXXXXXXXXXXXXXTYSTRHTQGYREXXXXXXXXXXNHRPKR 420
           RFTEPPSWN                       TYSTRHTQGYRE          NHRPKR
Sbjct: 361 RFTEPPSWNPPPVPHEIRKRPPPPPPPNLPSRTYSTRHTQGYREQQQQQQQHHHNHRPKR 420

Query: 421 IVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYK 480
           IVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYK
Sbjct: 421 IVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYK 480

Query: 481 EYIGTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLI 540
           EYIGTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLI
Sbjct: 481 EYIGTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLI 540

Query: 541 LLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIF 600
           LLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIF
Sbjct: 541 LLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIF 600

Query: 601 QGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGEN 660
           QGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGEN
Sbjct: 601 QGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGEN 660

Query: 661 AWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVT 720
           AWNCPKC                       NRSHNDLTFSEYNHN            LVT
Sbjct: 661 AWNCPKCSSSSNNNTSKRKSRGFFKFSKHKNRSHNDLTFSEYNHNSSSDDVKFSKKKLVT 720

Query: 721 RKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHF 780
           RKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHF
Sbjct: 721 RKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHF 780

Query: 781 GNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLF 840
           GNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLF
Sbjct: 781 GNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLF 840

Query: 841 YEKIIE 846
           YEKIIE
Sbjct: 841 YEKIIE 846

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  471 bits (1211), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 276/704 (39%), Positives = 377/704 (53%), Gaps = 67/704 (9%)

Query: 206  LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
            L+ L ++  IT  EL SILS P                  L  I +PN++  DP  LW++
Sbjct: 331  LQRLQKQSIITAQELLSILSCPPERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDS 390

Query: 266  RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXXXXXXXXXXXX 322
               TP+ +  +L     N LF +   F Y++ Y+D +T      F+YN            
Sbjct: 391  ATSTPIYNMETLEKLLDNELFNRRHEFEYVVYYTDMKTY-MHSDFDYNFTLFYLLTTETT 449

Query: 323  XV---TPNFLLGGFEKWEQLISSYSEQYGIETSNYIF-----------------TNNKRF 362
             +   TP +LLGG++KW+  +  Y+++Y I   +Y++                 T NK  
Sbjct: 450  NILRSTPTYLLGGYDKWKVFLHHYAKEYDINIPDYLYRPYDKALKSETPEEFEETKNKHV 509

Query: 363  TEPPSWNXXXXXXXXXXXXXXXXXXXXXXXTYSTRHTQGYREXXXXXXXXXXNHRPKRIV 422
             EPPSW                               +   +           H  + ++
Sbjct: 510  LEPPSWRPPELPVRIRKRPPPPPPALLPVPPSPPVKPRIVDDVNRPKKTLMNLHSARPLL 569

Query: 423  TRYTKYGLPHLPHSS---------------NLYVQLSISGLRNLGNTCYINSMLQCLFAT 467
                    PHL  ++               NLYV LSI+GLRNLGNTCYINSMLQCLFAT
Sbjct: 570  HERNYQIPPHLQQTTTLTRRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFAT 629

Query: 468  TAFRNLFLSNRYKEYI-GTKV--DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRP 524
              FR+LFL+++Y  ++ G+K    P +SNSF++LF+KMYLNGGC+V+P  FLK CN LRP
Sbjct: 630  RRFRDLFLTSKYSSFLNGSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRP 689

Query: 525  DLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWF 584
            DL+IPD QQDTQEFL+++LD+LH+EL SNQ  +V+E+P L+ YDT+ + V++  EYK WF
Sbjct: 690  DLKIPDDQQDTQEFLMIILDRLHDEL-SNQQEVVNEYPSLMLYDTNHLRVQHE-EYKHWF 747

Query: 585  AESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRR---KFRKLV 641
             +S+   GLS I EIFQGQ+EN L+CQRC ++S NYS F  LSL+IP          K V
Sbjct: 748  EKSVIGNGLSPIDEIFQGQIENGLQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRV 807

Query: 642  DLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFS- 700
             LEDCI++F  +EML+GENAW+CP C                          H    F  
Sbjct: 808  KLEDCINMFTNDEMLSGENAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGL 867

Query: 701  ------------------EYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSM 742
                                + +            L+T K+ +FI LP +L+IHLSRF  
Sbjct: 868  PTRPHRSLSPFRKSGSSSTNSTSKIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRF-F 926

Query: 743  SGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNP 802
              L  KN T I YP IL I LKN E  ++KLYG+VNH GNL +GHYTSL+NKEP H+LN 
Sbjct: 927  YDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNH 986

Query: 803  QRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
             +Q+W+YFDDE VK + N+ D+D  ++++SS DVYVLFYE++ E
Sbjct: 987  NQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERLYE 1030

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 96/206 (46%), Gaps = 55/206 (26%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL-----KGNTDSLDSFII 67
           S+EL + + S+Y   IK  Y QL   + +DLLE+TE LFE FL       N D+L SFI+
Sbjct: 15  SNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDALTSFIV 74

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQSF-- 125
           G +Y+ L++P S    +S N  Y  IY DLKK YE+Q +++++L +++ E E IL+    
Sbjct: 75  GCYYLFLIMPQS-IQFQSRNKSY-GIYSDLKKLYENQASMTNVLLMVKDEIETILEKTAE 132

Query: 126 --------------DVDAPSS-------HSQHEEDNTADS-------------------- 144
                             P S       HS    D    S                    
Sbjct: 133 REINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSDSDVIN 192

Query: 145 -----STTIWQAPFLEPNDQLKLAII 165
                S+ +W AP LEP DQLKLA++
Sbjct: 193 EENDMSSPLWTAPPLEPTDQLKLAVL 218

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  435 bits (1118), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/460 (49%), Positives = 302/460 (65%), Gaps = 33/460 (7%)

Query: 417  RPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
            R   ++TR  K+ +P +  S NLYV LSI+GLRNLGNTCYINSMLQCLFAT  FR+LF+S
Sbjct: 649  RESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708

Query: 477  NRYKEYIGTKV---DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533
            ++++ +I        P +SNSF++LF+KMYLNGGC+V+P  FLKTCN LRPDLRIPD QQ
Sbjct: 709  SKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQ 768

Query: 534  DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593
            DTQEFL+++LD+LH+EL SNQ  +V+E+P+L+ YD +++ V+N  EYK WF +++   GL
Sbjct: 769  DTQEFLMIILDRLHDEL-SNQQEVVNEYPNLLLYDENNLKVQNK-EYKHWFDKNVIGNGL 826

Query: 594  SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRR---KFRKLVDLEDCISLF 650
            S I  IF GQ+ENSL+CQRC  +S NYS F  LSL+IP          K V LE+CI++F
Sbjct: 827  SPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMF 886

Query: 651  IENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXN-RSHND--------LTFSE 701
              +E+L+GENAW+CPKC                       N  SHN+         T   
Sbjct: 887  TSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHT 946

Query: 702  YNHNXXXXXXXXX---------------XXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746
             +H                            L+T K+ +FI LP +L+IHLSRF    L 
Sbjct: 947  RSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD-LT 1005

Query: 747  DKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQK 806
             KNNT I YP IL I LKN E  +++LYG+VNH GNL +GHYTSL+NKEP+HDL  ++Q+
Sbjct: 1006 KKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQR 1065

Query: 807  WFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
            W+YFDDETVK++ N+ D+DK + ++SS DVYVLFYE+I E
Sbjct: 1066 WYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 88/188 (46%), Gaps = 25/188 (13%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           L+ L ++C IT  ELFSILSNP                F+   I +PNLI  DP+ LWN+
Sbjct: 368 LERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNS 427

Query: 266 RDQTPVLHRTSL-------FSNPLFQKIDLFSYIIIYSDNET--TTAFE-SFEYNXXXXX 315
           +  TP+   T+L        +  L Q    F YI+ Y+DN+T   T F+ SF +      
Sbjct: 428 KTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVT 487

Query: 316 XXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNK--------------- 360
                     P  LLGG++KW++++ SYSEQY     +Y++  ++               
Sbjct: 488 SKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDLVDS 547

Query: 361 RFTEPPSW 368
              +PPSW
Sbjct: 548 HILQPPSW 555

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 71/116 (61%), Gaps = 8/116 (6%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL------KGNTDSLDSFI 66
           S+EL + V SIY+  IK  Y QL   + +DLLE+TE L E F         N D L +FI
Sbjct: 14  SNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDVLTAFI 73

Query: 67  IGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL 122
           +G +Y+ L+IP S    +S N  Y  IY +LKK YE++ +++++L +++ E EN+L
Sbjct: 74  VGCYYLFLIIPQS-IQFQSKNKSY-GIYTELKKLYENETHMTNVLLMVKDEIENVL 127

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 143 DSSTTIWQAPFLEPNDQLKLA 163
           D ++ +W AP LEP DQLKLA
Sbjct: 213 DRASPLWTAPSLEPKDQLKLA 233

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  408 bits (1048), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/472 (47%), Positives = 293/472 (62%), Gaps = 28/472 (5%)

Query: 395  STRHTQGYREXXXXXXXXXXNHRPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNT 454
            +TR T+  R+           H  +  + R+  Y +P +  SSN YV LSI+GLRNLGNT
Sbjct: 559  TTRPTRITRKAIGSRPLHTHPHDQRLSLQRH--YSIPTIEKSSNTYVSLSITGLRNLGNT 616

Query: 455  CYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVD--PHLSNSFHILFRKMYLNGGCAVIP 512
            CYINSMLQCLFATT FR+LF+S +++E+        P LS SF+ILFRKMY+NGGC+V+P
Sbjct: 617  CYINSMLQCLFATTKFRDLFVSGKFEEFFNQNYSNRPQLSKSFNILFRKMYINGGCSVVP 676

Query: 513  VLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSM 572
              FLK  + LRPDLRIPD QQDTQEFL++ LD+LH+EL SNQ  + +E+PDL+ YD   M
Sbjct: 677  TSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRLHDEL-SNQAAVANEYPDLLLYDEHQM 735

Query: 573  DVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPN 632
            DV N  EYKKWF ES+   GL+ I  IFQGQ+EN LECQRC  +S +YS F  LSL+IP 
Sbjct: 736  DV-NGKEYKKWFEESVIGNGLAPIDHIFQGQIENILECQRCGNSSFSYSTFYVLSLAIPK 794

Query: 633  KRRKF---RKLVDLEDCISLFIENEMLTGENAWN---CPKCXXXXXXXXXXXXXXXXXXX 686
                     K V LEDCI++F  +E+L+GENAW+   C                      
Sbjct: 795  PSTSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKCGSAVTDMGPNHLKKSKKKKKSE 854

Query: 687  XXXXNRSHNDLTFSEYNHNXXX--------------XXXXXXXXXLVTRKSTSFIKLPNL 732
                 RS +   F  ++ +                          L T+K+ +FI LP +
Sbjct: 855  LGEERRSKSGF-FRIHSKSKRSKSPFRMLGSTKFPLAMEDWKSKELSTKKTLNFIFLPPV 913

Query: 733  LIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLI 792
            LIIHLSRF    L  KN+T + YP +L I LKN E  R++LY VVNH GNL +GHYTSL+
Sbjct: 914  LIIHLSRFYYD-LTKKNDTIVTYPLVLNIILKNNETARYRLYAVVNHTGNLISGHYTSLV 972

Query: 793  NKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
            NKEP H L+  RQKW+YFDDE VK++  + ++D+ + ++SSSDVYVLFYE++
Sbjct: 973  NKEPMHKLDKGRQKWYYFDDEVVKEETKHGNIDQGILKVSSSDVYVLFYERL 1024

 Score =  329 bits (844), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 199/517 (38%), Positives = 268/517 (51%), Gaps = 60/517 (11%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           L+ L ++  IT  ELF+ILS+                   +  I +P  ++ DP +LW+ 
Sbjct: 321 LERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDP 380

Query: 266 RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXXXXXXXXXXXX 322
           +  TP+ +  +L      P F +   + YI+ Y+D +T   + + +Y+            
Sbjct: 381 KTNTPISNAATLDEIIKKPAFLERGSYDYIVYYTDMKT---YMTIDYDYMFTLFYLLTAS 437

Query: 323 XVT-----PNFLLGGFEKWEQLISSYSEQYGIETSNYIF------------TNNKRFTEP 365
                   P  LLGG+EKW++++ +YS  +G+   NYI+            T++KR  E 
Sbjct: 438 PTVNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYRPYGESKKALPDTSSKRTPEL 497

Query: 366 PSWNXXXXXXXXXXXXXXXXXXXXXXXTYSTRHTQGY------------REXXXXXXXXX 413
           PSW                        T                      E         
Sbjct: 498 PSWKPPAIPPRIRKRPPPPPPISVPVPTEKPPAAPPPPIPPKVSLETHPEEPPAVDDHSV 557

Query: 414 XNHRPKRIVTRYTKYGLPHL-PHSSNLYVQ-----------------LSISGLRNLGNTC 455
              RP RI  +       H  PH   L +Q                 LSI+GLRNLGNTC
Sbjct: 558 ETTRPTRITRKAIGSRPLHTHPHDQRLSLQRHYSIPTIEKSSNTYVSLSITGLRNLGNTC 617

Query: 456 YINSMLQCLFATTAFRNLFLSNRYKEYIGTKVD--PHLSNSFHILFRKMYLNGGCAVIPV 513
           YINSMLQCLFATT FR+LF+S +++E+        P LS SF+ILFRKMY+NGGC+V+P 
Sbjct: 618 YINSMLQCLFATTKFRDLFVSGKFEEFFNQNYSNRPQLSKSFNILFRKMYINGGCSVVPT 677

Query: 514 LFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMD 573
            FLK  + LRPDLRIPD QQDTQEFL++ LD+LH+EL SNQ  + +E+PDL+ YD   MD
Sbjct: 678 SFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRLHDEL-SNQAAVANEYPDLLLYDEHQMD 736

Query: 574 VENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNK 633
           V N  EYKKWF ES+   GL+ I  IFQGQ+EN LECQRC  +S +YS F  LSL+IP  
Sbjct: 737 V-NGKEYKKWFEESVIGNGLAPIDHIFQGQIENILECQRCGNSSFSYSTFYVLSLAIPKP 795

Query: 634 RRKF---RKLVDLEDCISLFIENEMLTGENAWNCPKC 667
                   K V LEDCI++F  +E+L+GENAW+CPKC
Sbjct: 796 STSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKC 832

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 98/204 (48%), Gaps = 55/204 (26%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL-----KGNTDSLDSFII 67
           S+EL + V ++Y   IK  + Q    + +DLLE+TE LFE +L     K N D+L +FII
Sbjct: 13  SNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDALTAFII 72

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSE---------- 117
           G +Y+ L++P S    ++ N  Y +I+ DL K Y++Q N++++L +++ E          
Sbjct: 73  GCYYLYLIVPQS-IEFQTRNKSY-SIFNDLMKMYQNQANMTNVLLMVKDEVDSILDRNAR 130

Query: 118 --------------------------------SENILQSFDVDAPSSHSQHEED-----N 140
                                           +EN L   D  A S   Q  ED     N
Sbjct: 131 EFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGREDMNNLQN 190

Query: 141 TADSSTTIWQAPFLEPNDQLKLAI 164
             DSS  +W AP LEPNDQL++A+
Sbjct: 191 DEDSS-PVWTAPPLEPNDQLRIAL 213

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score =  405 bits (1041), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 216/443 (48%), Positives = 280/443 (63%), Gaps = 25/443 (5%)

Query: 425 YTKY-GLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI 483
           Y+K+  +P +  S N YV LSI+GLRN+G TCY+NSMLQCLFAT AFR+LFLS +Y+ Y 
Sbjct: 534 YSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF 593

Query: 484 GTK-VDP-HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541
             K  +P  LS  F++LF+KMY+NGGC+V+P  FLK CN LRPD RIP  QQDTQEFL+ 
Sbjct: 594 SRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLF 653

Query: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           LL QLH+EL S  +R+ +++P L+ +D   +DV+   EY  WF + +   G+S I  IFQ
Sbjct: 654 LLSQLHDEL-SESNRVANDYPGLLLHDDKKLDVDQ-KEYDTWFEKHISENGISPIDNIFQ 711

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF--RKLVDLEDCISLFIENEMLTGE 659
           GQ+EN L CQRC ++S NYS F  LSL+IP+    F  RK V LEDCI+LF  +E LT E
Sbjct: 712 GQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNE 771

Query: 660 NAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLT----------------FSEYN 703
           NAW+CPKC                        R+  + +                F + +
Sbjct: 772 NAWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQS 831

Query: 704 HNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITL 763
            +            L T K+ +FI LP +L IHLSRF    L  KNN  I YP IL+I L
Sbjct: 832 -SQQQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRF-FYDLTKKNNKVITYPLILSIVL 889

Query: 764 KNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFD 823
           KN++  +++LY + NHFGNL +GHYTSL+NK+  HDLN  +QKW+YFDDETVK+  N+ D
Sbjct: 890 KNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGD 949

Query: 824 LDKNVNRISSSDVYVLFYEKIIE 846
           +D  +  ISSSDVYVLFYEKI E
Sbjct: 950 IDAGITSISSSDVYVLFYEKIDE 972

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 94/182 (51%), Gaps = 34/182 (18%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF---LKGNT--DSLDSFII 67
           S+EL + V  +Y   I   + +L   + IDLLE+ E LFE +   L  N   D L +F+ 
Sbjct: 10  SNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVA 69

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLF----IIRSESENILQ 123
           G FYI L+IP  H++   S +   AIY DLKKYY+ + N++++L     +I S S++ ++
Sbjct: 70  GCFYIYLIIP--HSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKDEVE 127

Query: 124 SFDV-----------DAPSSHSQHEEDNTA------------DSSTTIWQAPFLEPNDQL 160
           +  +            +P +     + N+A            ++ TT+W AP LEPND L
Sbjct: 128 TARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEFENGTTMWTAPELEPNDHL 187

Query: 161 KL 162
           K+
Sbjct: 188 KV 189

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  406 bits (1043), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 282/446 (63%), Gaps = 29/446 (6%)

Query: 425  YTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIG 484
            +  + +P +  S N +V LSI+GLRN+GNTCYINSMLQCLF  + FR+LFL  +Y  Y+ 
Sbjct: 567  HVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626

Query: 485  TK-VDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLL 543
             K  +  +S  F +LFRKMYLNGGC+V+P  FLK C+ LRPD  IP  QQDTQEFL+ LL
Sbjct: 627  PKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLL 686

Query: 544  DQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQ 603
            D LH+EL S   ++ +++P+L+ +D + + V+N  EY KWF E L+N GLS I +IFQGQ
Sbjct: 687  DTLHDEL-SEPTKVANDYPNLLLHDDEKLLVDN-KEYDKWFDEGLKNNGLSPIDDIFQGQ 744

Query: 604  LENSLECQRCNYTSTNYSNFCTLSLSI-----PNKRRKFRKLVDLEDCISLFIENEMLTG 658
            +ENSL+CQRC +TS NYS F  LSL+I     P    + +K++ LEDCI+L+ ++E+LTG
Sbjct: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTG 804

Query: 659  ENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXN----------RSH---------NDLTF 699
            ENAW+CPKC                       N          RS             + 
Sbjct: 805  ENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSL 864

Query: 700  SEYNHNXXX-XXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAI 758
            S +  N             + T K+ +FI +PN+L+IHLSRF    L  KN T I YP I
Sbjct: 865  SPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRF-FYDLTKKNETMINYPLI 923

Query: 759  LTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQ 818
            L + LKN E  R++LYG++NHFGNL +GHYTSL+NK  SH++   +QKW+YFDDE VK++
Sbjct: 924  LDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKE 983

Query: 819  FNYFDLDKNVNRISSSDVYVLFYEKI 844
            FN+ D D+ +  ISS DVYVLFYE+I
Sbjct: 984  FNHGDFDRGITSISSGDVYVLFYERI 1009

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 95/186 (51%), Gaps = 36/186 (19%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF-----LKGNTDSLDSFII 67
           SDEL   V  +Y+  +K  Y +L   + I+LLE  E LFE +     ++   D L  ++I
Sbjct: 10  SDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCLCEYVI 69

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL----- 122
           G FY+ L+IP S     S+ N   +IY DLKK Y+ + N+S++L ++  + +++L     
Sbjct: 70  GSFYVFLIIPGSVQF--SARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNME 127

Query: 123 ------------QSFDVDAP------------SSHSQHEEDNTADSSTTIWQAPFLEPND 158
                       ++F V+ P            ++  +  +D+    ++T W+AP L+PND
Sbjct: 128 ILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTEWKAPQLDPND 187

Query: 159 QLKLAI 164
           +L LAI
Sbjct: 188 RLHLAI 193

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 66/165 (40%), Gaps = 4/165 (2%)

Query: 199 INDEDTYLKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFD 258
           +N+  T L    +E  I    LFS+L +                 F    + +PNL+  D
Sbjct: 302 LNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNID 361

Query: 259 PIELWNNRDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXXXXX 315
           P  L++    T +    +L    +NP+  KI  +  I+ Y+D ++     +F Y      
Sbjct: 362 PCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHL-TFNYELILFE 420

Query: 316 XXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNK 360
                     P  LLGG+E+W+  ++        + S ++F  +K
Sbjct: 421 LLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSK 465

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  404 bits (1037), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/439 (48%), Positives = 289/439 (65%), Gaps = 27/439 (6%)

Query: 430  LPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP 489
            +P +  + N YV LSI+GLRNLGNTCYI+SMLQCLFATT  R+LF++ +Y+ YI  KV  
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 490  --HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
              +LS SF ILFRKMYLNGGC+V+P  FLKTCN LRPDL+IPD QQDTQEFL+L+LD+LH
Sbjct: 669  KINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLH 728

Query: 548  NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
            +EL S +D +++++ +L+ YD + M V+  ++YKKWF  S  + G+S I +IFQGQ+ENS
Sbjct: 729  DEL-SKEDTVLNDYSNLLLYDAERMHVK-VDQYKKWFENSNLSGGVSPIDDIFQGQIENS 786

Query: 608  LECQRCNYTSTNYSNFCTLSLSIPN-KRRKFRKL--VDLEDCISLFIENEMLTGENAWNC 664
            + CQRC Y+S NYS+F  LSL+IP      F +   V LEDCI++F  +E+L+GENAW+C
Sbjct: 787  INCQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDC 846

Query: 665  PKCXXXXXXXXXXX-------XXXXXXXXXXXXNRSHNDLTFSEYN-----------HNX 706
             +C                               +S   L   +YN           H+ 
Sbjct: 847  SRCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKSRLFLLPKKYNPTSRSLSPFGRHSS 906

Query: 707  XXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNK 766
                       + T KS +FIK+P +L+IHLSRF    +  KN T +AYP IL I LKN+
Sbjct: 907  HKSSEKWKSKKMETIKSLNFIKMPKILVIHLSRF-FYDMSKKNETVVAYPLILNIVLKNE 965

Query: 767  EKCRFKLYGVVNHFGN-LNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLD 825
            E C+++LY +VNH GN + +GHYT+L+NK  +HDL    Q+W+YFDDE VK + N+ ++D
Sbjct: 966  EVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNID 1025

Query: 826  KNVNRISSSDVYVLFYEKI 844
            + VN++SSS VYVLFYEKI
Sbjct: 1026 EGVNKVSSSHVYVLFYEKI 1044

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 7/156 (4%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           +  L ++  IT  EL+SILS+P                     I +P++IK DP  LWN 
Sbjct: 338 MDRLQKQNVITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNE 397

Query: 266 RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNET--TTAFE-SFEYNXXXXXXXXX 319
             QTP+     L    +NPL  +++ F YI+ YSD  T   T ++  F +          
Sbjct: 398 ETQTPIYSFEELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSL 457

Query: 320 XXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYI 355
               V P  LLGGFEKW++++ +Y+++YGI+ + +I
Sbjct: 458 NLKQV-PTNLLGGFEKWKKVLKTYNKEYGIDITPFI 492

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 68/115 (59%), Gaps = 7/115 (6%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL-----KGNTDSLDSFII 67
           S+EL K V   YN++IK  + QL   + I++LE+T  L E +L     +   + L ++I+
Sbjct: 12  SNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECLSAYIV 71

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL 122
           G FY+ L+IP S        N    IY +LK  Y++Q N++++L I+++E ++IL
Sbjct: 72  GCFYLYLIIPNSTQF--QIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSIL 124

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 142 ADSSTTIWQAPFLEPNDQLKLAI 164
           A+ +  IW  P LEPNDQLKLA+
Sbjct: 211 AEDTAPIWHIPSLEPNDQLKLAL 233

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  398 bits (1022), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/436 (48%), Positives = 276/436 (63%), Gaps = 26/436 (5%)

Query: 430 LPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV-D 488
           +P +  SSN YV LSI+GLRN+GNTCYINSMLQCLFAT  FR+LFLS +Y++Y   +  +
Sbjct: 540 IPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSN 599

Query: 489 PH-LSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
           PH LS  F+ILF+KMY+NGGC+V+P  FLK CN LRPDL+IP  QQDTQEFL+ LL QLH
Sbjct: 600 PHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLH 659

Query: 548 NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
           +EL S  + + +++P+L+ +D +S+ V+   EY KWF  ++   G+S I  IFQGQ+EN 
Sbjct: 660 DEL-SESNHVANDYPNLLLHDDESLAVDQ-KEYDKWFESNISENGISPIDAIFQGQMENG 717

Query: 608 LECQRCNYTSTNYSNFCTLSLSIPNKRRKF--RKLVDLEDCISLFIENEMLTGENAWNCP 665
           L CQRC ++S NYS F  LSL+IP     F  +K + LEDCI+LF  +E LT ENAW+CP
Sbjct: 718 LLCQRCGHSSYNYSMFYVLSLAIPASMSSFGQKKKMRLEDCINLFTSDEKLTNENAWDCP 777

Query: 666 KCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEY-----------------NHNXXX 708
           KC                       N   N  + S +                   +   
Sbjct: 778 KCGSAVSGNGPDGDKKKRKFLSTSDNS--NGRSRSRFFKLRSKSRSRSVSPFHKPSSQSP 835

Query: 709 XXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEK 768
                    L T K+ +F+ LP++L IHLSRF +  L +KNN  I YP  L+I LKN E 
Sbjct: 836 ASEKWKSKKLSTIKTLNFVSLPSVLTIHLSRF-LYDLTNKNNKVITYPLTLSIVLKNNEV 894

Query: 769 CRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNV 828
             ++LY + NHFGNL +GHYTSL+NK+ SHDL   RQKW+YFDDE  K+  N+ ++D  +
Sbjct: 895 VNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGI 954

Query: 829 NRISSSDVYVLFYEKI 844
             +SSSDVYVLFYEKI
Sbjct: 955 TSVSSSDVYVLFYEKI 970

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 95/184 (51%), Gaps = 38/184 (20%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF-----LKGNTDSLDSFII 67
           S+EL + V  +Y   I   Y +L   + IDLLE+ E LFE +      K N++ L +F++
Sbjct: 10  SNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELLTAFVV 69

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLF----IIRSESENILQ 123
           G FYI L+IP  H++   S +   AIY DL+KYY+ + N++++L     +I S S + L+
Sbjct: 70  GCFYIYLIIP--HSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESVSRDELE 127

Query: 124 SFDV-------------------------DAPSSHSQHEEDNTADSSTTIWQAPFLEPND 158
           S  +                          A S+++  E DN  DS  T+W AP LEPND
Sbjct: 128 SAKIMRKRAYSVPHKKLSDKMQALTLSPETASSTNAGPETDNENDS--TMWTAPELEPND 185

Query: 159 QLKL 162
            LK+
Sbjct: 186 HLKV 189

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 6/103 (5%)

Query: 244 FNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSLF---SNPLFQKIDLFSYIIIYSDNET 300
           F    I +PNL+  DP+ LW+      +     L     N   + +  F +I+ Y+D +T
Sbjct: 328 FETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMKT 387

Query: 301 TTAFESFEYNXXXXXXXXXXXXXV--TPNFLLGGFEKWEQLIS 341
               + F+Y              +  TP  LLGG+E+W++ ++
Sbjct: 388 FMRLD-FDYQLVFFQMLYTSNWRISCTPKVLLGGYEQWKKFLA 429

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  361 bits (927), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 256/404 (63%), Gaps = 22/404 (5%)

Query: 460 MLQCLFATTAFRNLFLSNRYKEYIGTKVD--PHLSNSFHILFRKMYLNGGCAVIPVLFLK 517
           M+QCLF T   R+LF+S++Y++Y+  ++D   +LS SF ILF+KMYLNGGC+V+P  FLK
Sbjct: 1   MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFLK 60

Query: 518 TCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENA 577
           TCN LRPDLRIPD QQDTQEFL+L+LD+LH+EL SNQ+ +  ++PDL+ YDT  + V N 
Sbjct: 61  TCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDEL-SNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 578 NEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF 637
            EY KWF +++   GLS I  IFQGQ+EN+L CQRC + S NYS F  LSL+IP      
Sbjct: 120 -EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGT 178

Query: 638 ---RKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXX---- 690
               K V LEDCI++F  +E+L+GENAW+C  C                           
Sbjct: 179 FSRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRK 238

Query: 691 ----------NRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRF 740
                      RS   ++    + +            LVT KS +FI LP  L+IHLSRF
Sbjct: 239 SRLFLLPNINGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRF 298

Query: 741 SMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDL 800
               L  KN T + YP IL I L N E  +++LYG+VNH GNL +GHYT+L+NKE +H+L
Sbjct: 299 YYD-LSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHEL 357

Query: 801 NPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
              +QKW+YFDDE VK++ N+ ++D+ V ++SSS VYVLFYE++
Sbjct: 358 KKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERV 401

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  386 bits (992), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/434 (46%), Positives = 280/434 (64%), Gaps = 18/434 (4%)

Query: 428  YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487
            + +P + +S N YV LSI+GLRN+ NTCYINSMLQCLF+T+AFRNLFLSN+Y  Y+ +  
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146

Query: 488  DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
               +S SF++LFRKMY+NGGC+V+P  FLK CN L+PDLRIP  QQDTQEFL+ LLD+LH
Sbjct: 1147 MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKLH 1206

Query: 548  NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
            +EL S+ + + +++  L+ +D   + V++A +Y KWF ++++  GLS I ++FQGQ+EN 
Sbjct: 1207 DEL-SSIESVSNDYSHLLLHDNVRLYVDDA-QYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264

Query: 608  LECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEMLTGENAWNC 664
            L CQRC Y+S  YS F  LSL++PN   K     K + LEDCI+ F  +E+L+ +NAW+C
Sbjct: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324

Query: 665  PKCXXXXXXXX----XXXXXXXXXXXXXXXNRSHNDL--------TFSEYNHNXXXXXXX 712
            P+C                           N S + L        + SE           
Sbjct: 1325 PRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDK 1384

Query: 713  XXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFK 772
                   T KS +FI +P +L+IHLSRF +  L  KNN  ++YP IL I LKN E  +F+
Sbjct: 1385 VSNGKPATVKSLNFITMPRILVIHLSRF-IYDLTKKNNIVVSYPLILNIVLKNSEVAKFR 1443

Query: 773  LYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRIS 832
            LY +VNHFG L +GHYTSL+NKE +H+++  +QKW+YFDDE VK   N+ D D  +  +S
Sbjct: 1444 LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVS 1503

Query: 833  SSDVYVLFYEKIIE 846
            SS+VYVLFYE+I +
Sbjct: 1504 SSNVYVLFYERIFD 1517

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 94/207 (45%), Gaps = 62/207 (29%)

Query: 15  ELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL----KGNTDS-LDSFIIGY 69
           EL + V  +Y   ++  Y++L   + IDLLE+   L E +     +G  ++ + ++++G 
Sbjct: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGA 71

Query: 70  FYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENI-------- 121
           FY+ L+IP S      + N   +IY DLK++YES PN+ +++ ++ ++  ++        
Sbjct: 72  FYLYLIIPQSIEF--HTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGE 129

Query: 122 -----------------LQSFD------------VDAPSSHS---------------QHE 137
                            +QS D            ++  S+                 Q +
Sbjct: 130 GDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAFGQQQQ 189

Query: 138 EDNTADSSTTIWQAPFLEPNDQLKLAI 164
           +D   D   T+W AP LEP+DQLKLA+
Sbjct: 190 DDEWED---TVWSAPNLEPDDQLKLAV 213

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 65/165 (39%), Gaps = 5/165 (3%)

Query: 195 NDKTINDEDTYLKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNL 254
           ND  +  E++ +  LYE   I   +L S L++                Y     I + N+
Sbjct: 301 NDGVVPCENSSIMWLYESSSIKCLDLLSKLTSSERSSMLLIDLRLPKRY-EYSHILAENV 359

Query: 255 IKFDPIELWNNRDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNX 311
           I  DP  LW++    PV     L     N LF+    F+ I+ Y+DN T    + F++  
Sbjct: 360 INIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQID-FDFVF 418

Query: 312 XXXXXXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356
                       +    L GG+E+W+  +        I  S++++
Sbjct: 419 LLFRLLYLGRPQLVLKTLSGGYEQWKSFLKELKRTESIILSDFLW 463

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  361 bits (927), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/444 (45%), Positives = 274/444 (61%), Gaps = 30/444 (6%)

Query: 428  YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487
            + +P +  + N Y+ LSI+GLRN+ NTCYINSMLQCLF+TT FRNLFLSN+Y  Y+ +  
Sbjct: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787

Query: 488  DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
              ++S SF++LF+KMY+NGGC+V+P  FLK C++L+PDLRIP  QQDTQEFL+ LLD+L 
Sbjct: 788  MDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRLR 847

Query: 548  NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
            +EL S    +V+++P L+ +++  + V N  EY  WF ++ E  GLS I  IFQGQ+E+ 
Sbjct: 848  DEL-SYLAAVVNDYPQLLLHESSVLKV-NDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQ 905

Query: 608  LECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEMLTGENAWNC 664
            L CQRC+++S +YS F  LSL++PN   K     K + LEDCI+ F  +E+LTG+N W+C
Sbjct: 906  LSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDC 965

Query: 665  PKCXXXXXXXXXXXXXXXXX----------XXXXXXNRSH--------------NDLTFS 700
            PKC                                 NR H              +   F 
Sbjct: 966  PKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRSSSPFI 1025

Query: 701  EYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILT 760
                +            L T KS +FI LP +LIIHLSRF +  L  KNNT + YP IL 
Sbjct: 1026 SGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRF-VYDLTKKNNTVVTYPLILN 1084

Query: 761  ITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFN 820
            I LKN E  +++LY  +NHFG L +GHYTSL+NK+  H++   +QKW+YFDDE VK   N
Sbjct: 1085 IVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPN 1144

Query: 821  YFDLDKNVNRISSSDVYVLFYEKI 844
            + + D+ +  +SSSDVY+LFYE+I
Sbjct: 1145 HGNYDRGITSVSSSDVYLLFYERI 1168

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 88/202 (43%), Gaps = 46/202 (22%)

Query: 4   ISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF----LKGNT 59
           +S+ ++   S EL   V   Y  +++ +Y +L   + +DLLE    LFE +     +G T
Sbjct: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 60  -DSLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIR--- 115
            + L +++IG FY+ L+IP S      + N   ++Y DL+K+YE +PN+++++ ++    
Sbjct: 61  REGLMAYVIGAFYLYLIIPQSIEF--HTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKV 118

Query: 116 --------------------------------SESENILQSFDVDAPSSHSQHEEDNT-- 141
                                           + S + LQ   VD       H       
Sbjct: 119 DAVLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP 178

Query: 142 --ADSSTTIWQAPFLEPNDQLK 161
             A  + T+W AP LE ND L+
Sbjct: 179 EVAVQADTLWSAPKLEENDLLR 200

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 4/119 (3%)

Query: 244 FNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNET 300
           + L  I + +LI  DP+ LW+     P+           NPLF     FSY++ Y+DN T
Sbjct: 478 YELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHT 537

Query: 301 TTAFESFEYNXXXXXXXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNN 359
           +   + F++              +    L GG+++W   + + ++    + S++++  N
Sbjct: 538 SMNMD-FKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRAN 595

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score =  350 bits (898), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/449 (44%), Positives = 269/449 (59%), Gaps = 28/449 (6%)

Query: 417 RPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           R K+ V       LP +  S++L  QLSI+GL+N  NTCYINS++QCLF TT FR+LFL+
Sbjct: 274 REKKTVRSSALNKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT 333

Query: 477 NRYKEYIGTKVDP---HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533
            +Y+ ++ T   P    LS S ++LF+KMYLNGG A+ P  FLK C  LRPDL IPD QQ
Sbjct: 334 KKYRLFLQTDKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQ 393

Query: 534 DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593
           DTQEFL+++L +LH EL +    +   +PDL+ YD ++  V N ++Y+KW+  S+  +GL
Sbjct: 394 DTQEFLLIILARLHEELSNGT--VTEYYPDLVSYDANAFQV-NPSKYQKWYEGSVLTDGL 450

Query: 594 SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIP--------NKRRKFRKLVDLED 645
           S I  IF+GQ+EN L+CQRC  +S +YS F  LSL+IP        +K +K +    LED
Sbjct: 451 SPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIK----LED 506

Query: 646 CISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXX--XXXNRSHND------L 697
           CI+LF  +E L+G+N+W+CP C                         +RS +        
Sbjct: 507 CINLFTSDEELSGDNSWDCPNCGTTDLKTKINESTSQKKKSTFFSFHSRSRSKSPHHHHH 566

Query: 698 TFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPA 757
                + N            L T KS+ FI LP +L+IHLSRF    L  KNNT I YP 
Sbjct: 567 HHHHSHDNTEKHSKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYD-LTRKNNTVITYPL 625

Query: 758 ILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ 817
           IL + LKN +  R+KLYG VNH GNL NGHYTS +NKE +H++   RQ W  FDD+ +KQ
Sbjct: 626 ILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685

Query: 818 QFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
             ++ D +     +SSS+VYVLFYE++ E
Sbjct: 686 H-HHDDFEAGKTEVSSSEVYVLFYERMDE 713

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 9   LVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKGN-----TDSLD 63
           ++ N D++  LV ++Y   IK  Y QL       LL++   LFE +L+ +      ++L 
Sbjct: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60

Query: 64  SFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123
           +FIIG +Y+ LVIP S    ++ NN Y + Y  LK  Y+ +  +S +L I++ ES  I+ 
Sbjct: 61  AFIIGGYYLYLVIPQS-LQFQTRNNLY-SSYAKLKNDYQDEQIMSYVLKIVKEESNMIVD 118

Query: 124 SFDVDA 129
            +  D+
Sbjct: 119 RYLSDS 124

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score =  347 bits (890), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/440 (45%), Positives = 272/440 (61%), Gaps = 31/440 (7%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487
           Y LP +  S++L  +LSI+GL+N  NTCYINS++QCLF TT FR+LFL+ +Y+ ++ T  
Sbjct: 280 YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK 339

Query: 488 DP---HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLD 544
            P    LS S ++LF+KMYLNGG A+IP  FLK C  LRPDL IPD QQDTQEFL+++L 
Sbjct: 340 YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399

Query: 545 QLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQL 604
           ++H EL SN++ +V  +PDL+ YD +++ V N ++Y+KW+  ++  +GLS I  I++GQL
Sbjct: 400 RIHEEL-SNEN-VVKYYPDLVSYDANALQV-NPSKYEKWYERNVITDGLSPIDHIYRGQL 456

Query: 605 ENSLECQRCNYTSTNYSNFCTLSLSIP--------NKRRKFRKLVDLEDCISLFIENEML 656
           EN L+CQRC  +S +YS F  LSL+IP        +K RK +    LEDCI+LF  +E L
Sbjct: 457 ENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIK----LEDCINLFTGDEEL 512

Query: 657 TGENAWNCPKCXXXXXXXXXXXXXXXXXXXXX----XXNRSHNDLTFSEY---NHNXXXX 709
           +G+NAW+CP C                           +RS +      +   + +    
Sbjct: 513 SGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKN 572

Query: 710 XXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKC 769
                   L T KS  FI LP +L+IHLSRF    L  KN+T I YP IL I LKN +  
Sbjct: 573 AKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYD-LTKKNSTVITYPLILNIILKNGKVI 631

Query: 770 RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQ---FNYFDLDK 826
           R+KLYG VNH GNL NGHYTS++NKE SH++   RQ W  FDD+ ++Q     N F+  K
Sbjct: 632 RYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGK 691

Query: 827 NVNRISSSDVYVLFYEKIIE 846
               +SS +VYVLFYE++ E
Sbjct: 692 --TEMSSDEVYVLFYERMDE 709

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 9   LVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLD 63
           ++ N D++  LV  +Y   IK  Y QL       LL++   LF  +L+        ++L 
Sbjct: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60

Query: 64  SFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123
           +FIIG +Y+ L+IP S    ++ NN Y + Y  LK  Y+ +  +  +L ++R ES  I+ 
Sbjct: 61  AFIIGCYYLYLIIPQS-LQFQTRNNLY-SSYAKLKNDYQDEHVMGYVLKVVRDESTVIVD 118

Query: 124 SF 125
            +
Sbjct: 119 RY 120

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score =  339 bits (870), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/438 (44%), Positives = 260/438 (59%), Gaps = 28/438 (6%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487
           + LP + +S NL  +LSI+GLRN  NTCYINSM+QCLF+TT FR+LFL+ +YK ++  + 
Sbjct: 278 FKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEK 337

Query: 488 DP---HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLD 544
            P    LS+S ++LF+KMYLNGG A+IP  FLK C  LRPDL IPD QQDTQEFL+++L 
Sbjct: 338 YPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILA 397

Query: 545 QLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQL 604
           ++H EL +N   +   + DLI  D  ++ V N ++Y+KW  E++ ++GLS I  IFQGQ+
Sbjct: 398 RIHEELSNNN--VTKYYSDLILNDATALQV-NPSKYQKWCEETVLSDGLSPIDHIFQGQM 454

Query: 605 ENSLECQRCNYTSTNYSNFCTLSLSIPNKR----RKFRKLVDLEDCISLFIENEMLTGEN 660
           EN L+CQRC  +S +YS F  LSL+IP           K + LEDCI+ F  +E L+ +N
Sbjct: 455 ENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDDN 514

Query: 661 AWNCPKCXXXXXXXXXXXXXXXXXXXXX----XXNRSHNDLTF------------SEYNH 704
           AW+CPKC                            RS +                ++ N 
Sbjct: 515 AWDCPKCRTAEYKLKKDENLSQKKRSILFNLHSRPRSKSPRHRHHHHHHRHKNDDAKKND 574

Query: 705 NXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLK 764
           +            L T KS  FI LP +L+IHLSRF    L  KNNT I YP IL I LK
Sbjct: 575 DATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYD-LTKKNNTVITYPLILNIILK 633

Query: 765 NKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQF-NYFD 823
           N +  R+KLY  VNH GNL NGHYTS++NKE SH++   RQ W  FDD+ +KQ   +  D
Sbjct: 634 NNKVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDD 693

Query: 824 LDKNVNRISSSDVYVLFY 841
            +     ISS++VYVLFY
Sbjct: 694 FETGRTEISSNEVYVLFY 711

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 7/116 (6%)

Query: 12  NSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF---LKGN--TDSLDSFI 66
           N +++  LV  +Y+  IK +Y QL   +   LLE+   LF+ +   LK N   ++L +FI
Sbjct: 4   NPNQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFI 63

Query: 67  IGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL 122
           +G FY+ LVIP  H++   + N+  + Y  LK  Y+ +  +S +L +++ ES  I+
Sbjct: 64  VGGFYLYLVIP--HSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIV 117

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score =  336 bits (861), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/432 (44%), Positives = 263/432 (60%), Gaps = 20/432 (4%)

Query: 431 PHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP- 489
           P +  S  L  +LSI+GL+N  NTCYINS++QCLF +T FR+LFL+ +Y+ ++ T+  P 
Sbjct: 277 PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPK 336

Query: 490 --HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
              LS S + LF+KMY NGG A++P  FLK C  LRPDL IPD QQDTQEFL+++L ++H
Sbjct: 337 EVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIH 396

Query: 548 NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
            EL SN++ +   + DL+ YDT+++ V N  +Y+KW+ E++  +GLS I  IF+GQ+EN 
Sbjct: 397 EEL-SNEN-VTKYYCDLVSYDTNALQV-NPIKYQKWYEETILADGLSPIDHIFRGQMENI 453

Query: 608 LECQRCNYTSTNYSNFCTLSLSIP-NKRRKF---RKLVDLEDCISLFIENEMLTGENAWN 663
           L+CQRC  +S +YS F  LSL+IP N    F    K + LEDCI+LF  +E LTG+NAW+
Sbjct: 454 LKCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWD 513

Query: 664 CPKCXXXXXXXXXXXXXXXXXXXXX----XXNRSHNDLTFSEY----NHNXXXXXXXXXX 715
           CP+C                           +RS +      Y    + N          
Sbjct: 514 CPECRIDDSKLKTGENSSQKKRSPLFSFHSRSRSKSPHHHHHYHHHGSDNTTKNSNKWKS 573

Query: 716 XXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYG 775
             L T KS  FI LP +L+IHLSRF    L  KNN  I YP IL I LKN +  R+KLYG
Sbjct: 574 KRLTTIKSLDFIFLPPILVIHLSRFYYD-LTKKNNAVITYPLILNIILKNNKVVRYKLYG 632

Query: 776 VVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFD-LDKNVNRISSS 834
            VNH GNL  GHYTS++NKE SH++   +Q W  FDD+ + Q     D  +    ++SSS
Sbjct: 633 TVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSS 692

Query: 835 DVYVLFYEKIIE 846
           +VYVLFYE++ E
Sbjct: 693 EVYVLFYERMDE 704

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 9   LVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLD 63
           ++ N D++  LV  +Y   IK  Y QL       L+++T  LF+ +L+        ++L 
Sbjct: 1   MLLNPDQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALT 60

Query: 64  SFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123
           +FIIG +Y+ L+IP S      SN    + Y  LK  Y+ +  +S +L ++R ES +I+ 
Sbjct: 61  AFIIGGYYLYLIIPQSLQFQTRSN--LYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVD 118

Query: 124 SFDVDA 129
            +  D+
Sbjct: 119 QYLSDS 124

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score =  340 bits (873), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 214/617 (34%), Positives = 311/617 (50%), Gaps = 84/617 (13%)

Query: 130 PSSHSQHEEDNTADSSTTIWQAPFLEPNDQLKLAIIXXXXXXXXXXXXXXXI-------- 181
           P + +  +E+   +  + IW AP L+PNDQLKLA+                +        
Sbjct: 262 PGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYET 321

Query: 182 ---------------DINAN-------ESKYTNFINDKTINDEDTY----------LKHL 209
                          D++AN       +S ++ ++ D   N+   Y          L+ L
Sbjct: 322 VSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERL 381

Query: 210 YEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNNRDQT 269
            ++  IT  ELFSILSNP                     I +PN++  DP  LW+N   +
Sbjct: 382 QKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANS 441

Query: 270 PVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFE-SFEYNXXXXXXXXXXXXXVT 325
           P+   T L    +NPLF     + YI+ YSD +T   FE  + +                
Sbjct: 442 PIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSV 501

Query: 326 PNFLLGGFEKWEQLISSYSEQYGIETSNYIF-----------TNNKRFTEPPSWNXXXXX 374
           P  LLGG+EKW++++++Y  QY IE  +Y++            NN +  + P+W      
Sbjct: 502 PTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQNNAQIPDVPTWKPPPVP 561

Query: 375 XXXXXX------------------XXXXXXXXXXXXTYSTRHTQGYREXXXXXXXXXXNH 416
                                               +  + ++Q  R           + 
Sbjct: 562 VMVRKRPPPPVPVSIPIPPETPPPLPQKIKLESIEESAPSDNSQYIRPPAKLPIHALHSP 621

Query: 417 RPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           R + +  +++   +P +  +SN YV  S++GLRNLGNTCYIN MLQ LFAT   +NLF+S
Sbjct: 622 RNQTLTRKFS---IPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFIS 678

Query: 477 NRYKEYIGTKVD---PHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533
            +Y+EY     D     +SN+F  LF KMY+NGGC V+P  FLK CNFLRPDLRIPD QQ
Sbjct: 679 GKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQ 738

Query: 534 DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593
           DTQEFL+ +L++LH+EL SNQ  +++++P+L+ YD D M V+   +YKKWF +++   GL
Sbjct: 739 DTQEFLLFILNRLHDEL-SNQVNVINDYPNLLLYDDDKMMVD-KEKYKKWFDKTVVANGL 796

Query: 594 SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRR-KFRK--LVDLEDCISLF 650
           S +  +FQGQ+EN+L+CQRC Y S NYS F  LSL++P      F K   V LEDCI++F
Sbjct: 797 SPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMF 856

Query: 651 IENEMLTGENAWNCPKC 667
             +E+LTGENAW+CPKC
Sbjct: 857 TSDEVLTGENAWDCPKC 873

 Score =  145 bits (366), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            LVT K+ +FI LP +LIIHLSRF    L  KN+  ++YP +L I LKN+E  R+KLY +V
Sbjct: 955  LVTIKTINFISLPKVLIIHLSRFYYD-LTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIV 1013

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NH GNL +GHYTSL+NK+P H+L    QKW+YFDDE VK +  + ++DK + ++SS +VY
Sbjct: 1014 NHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVY 1073

Query: 838  VLFYEKI 844
            VLFYE++
Sbjct: 1074 VLFYERV 1080

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 64/118 (54%), Gaps = 6/118 (5%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLK----GNTDSLDSFIIG 68
           S +L   +  IY  +I+P + QL   R +DLLE  + + E ++       + ++  FI G
Sbjct: 9   SGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTSKAVRVFITG 68

Query: 69  YFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQSFD 126
            FYI LV+P S  M   + +   ++Y +L+  YESQ N+++++ +++ E   I +  D
Sbjct: 69  CFYIYLVMPES--MQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQCD 124

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  310 bits (793), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 251/459 (54%), Gaps = 47/459 (10%)

Query: 417 RPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           RP  I     K+ +P +  + N+   LS+ GLRN GNTCYINSM+QCLF T   R+LF+S
Sbjct: 213 RPAEI----KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268

Query: 477 NR-YKEYIGTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDT 535
              YK++I    +  +S  F  L   MY NGG +VIP  FL+  + LRPDL IP  QQDT
Sbjct: 269 EXXYKDFIKKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDT 328

Query: 536 QEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSL 595
           QEFL++LLD LH+EL            DLI  +  S D+    EY  W   +L+  G S 
Sbjct: 329 QEFLVILLDILHDELVYTD--------DLISNNYVSDDINLGKEYMPWLQNNLKANGKSP 380

Query: 596 IHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPN-KRRKFRKLVDLEDCISLFIENE 654
           I  IFQGQ+EN L+CQRC  TS NYS F  LSL+IP   +   +  V LEDCI+ F  +E
Sbjct: 381 IDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDE 440

Query: 655 MLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYN----------- 703
           +LTGENAWNCPKC                       N+S N L F + +           
Sbjct: 441 ILTGENAWNCPKC-CPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNHH 499

Query: 704 ---------HNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIA 754
                     +            L+T K  +FIKLP +L+IHLSRF  +    KNN  I 
Sbjct: 500 RHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNS-TKKNNAVIT 558

Query: 755 YPAILTITLKNK-EKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813
           YP IL I +KN  +  ++KLYG++NH G L  GHYTS++NK+ +H L+   Q+W+ FDDE
Sbjct: 559 YPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618

Query: 814 TVKQ--------QFNYFDLDKNVNRISSSDVYVLFYEKI 844
            +K+        +   F+++K  +   SS VYVLFYE+I
Sbjct: 619 VIKKLNSNNTINKKESFNIEK--DEFDSSKVYVLFYERI 655

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 14  DELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF------LKGNTDSLDSFII 67
           D+L  LV SI+   IK  Y +L   R  DLL++T  L + F            +  +F+ 
Sbjct: 28  DDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVN 87

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123
           G FY+ L+IP  + +   + N     Y+DLK  YE Q ++ ++L  ++ +S +IL+
Sbjct: 88  GSFYLFLIIP--YCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILE 141

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  290 bits (741), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/441 (36%), Positives = 246/441 (55%), Gaps = 26/441 (5%)

Query: 427 KYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK 486
           +Y LP + ++     +LS+ G+RN+GNTCY+NSMLQCLF +T FR+LFL+++++ +    
Sbjct: 194 QYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAET 253

Query: 487 VDPHLS--NSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLD 544
               LS  N   +LF+KMY NGGCA+IP  F++TC  LRPD +IP  QQDTQEFL+ +L+
Sbjct: 254 NSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLE 313

Query: 545 QLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQL 604
           +L  EL +N    V +   LI   +++  ++    Y +W+ E +    LS I  +F+G +
Sbjct: 314 RLRVEL-ANTSATVKDRS-LIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDV 371

Query: 605 ENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEMLTGENA 661
           E+ L C+ CN +++ +S+F  LSL+IP ++       K + LEDCI+LF   E+LTGEN+
Sbjct: 372 ESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLFTRKEILTGENS 431

Query: 662 WNCPKCXXXXXXXXXXXXXXXXXXXXXXXNR-------SHNDLTFSEYNH---------- 704
           W CP C                                SH +   +E N           
Sbjct: 432 WACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQLKY 491

Query: 705 -NXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITL 763
            N              T  S SF+ LP +L+IHLSRF    +  KN ++I+YP  LT+  
Sbjct: 492 DNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYD-ISKKNTSNISYPMSLTVET 550

Query: 764 KNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFD 823
            +     ++LYG +NH G+   GHYT+L+NKE +H  + + QKW  FDD+ V  + ++F 
Sbjct: 551 LDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFK 610

Query: 824 LDKNVNRISSSDVYVLFYEKI 844
               +N I+++D YVLFYE+I
Sbjct: 611 SKTEINSITNNDAYVLFYERI 631

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  298 bits (762), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 141/253 (55%), Positives = 187/253 (73%), Gaps = 15/253 (5%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483
           Y +P +  S N+YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S++YK Y+    
Sbjct: 591 YNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIR 650

Query: 484 --GTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541
             G+   P LSNS  +LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++
Sbjct: 651 SNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 710

Query: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           LLD+LH+EL S+Q  + +++P+L+ Y+ D++ V N NEYK WF +++   G+S I +IFQ
Sbjct: 711 LLDRLHDEL-SDQQHVANDYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQ 768

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENE 654
           GQ+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F  +E
Sbjct: 769 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDE 828

Query: 655 MLTGENAWNCPKC 667
           +L+GENAW+CP+C
Sbjct: 829 VLSGENAWDCPRC 841

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            L T K+ +F+ LP +L+IHLSRF    L  KNNT + YP IL I LKN +  ++KL+GVV
Sbjct: 946  LTTVKTINFVTLPKILVIHLSRFYYD-LTKKNNTVVTYPLILNIILKNNDTMKYKLFGVV 1004

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NH G L +GHYTSL+NK+  H++N  R KW+YFDDE VK    +   DKN+ +ISSSDVY
Sbjct: 1005 NHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-DKNL-KISSSDVY 1062

Query: 838  VLFYEKI 844
            VLFYE++
Sbjct: 1063 VLFYERV 1069

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 98/193 (50%), Gaps = 42/193 (21%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLDSFII 67
           S+EL + V  +Y+  IK  Y QL   + +DLLE+TE LFE +L         D+L +FII
Sbjct: 22  SNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDALTAFII 81

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ---- 123
           G +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E   +L     
Sbjct: 82  GCYYVFLIIPQS-LQFQTRNKSY-SIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVK 139

Query: 124 -----------------------------SFDVDAPSSHSQHE--EDNTADSSTTIWQAP 152
                                        S D  AP  H       ++ A+ S+ +W AP
Sbjct: 140 HGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTEDDAEQSSPVWTAP 199

Query: 153 FLEPNDQLKLAII 165
            LEPNDQLKLA++
Sbjct: 200 NLEPNDQLKLALL 212

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 8/155 (5%)

Query: 209 LYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNNRDQ 268
           L ++  IT  ELFSILSN                   +  I +PNL+  DP  LW+ +  
Sbjct: 308 LQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTN 367

Query: 269 TPV----LHRTSLFSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXX---XXXXXXXXX 321
           TP+    +    L  N  F   + F YI+ Y+D +T     +F+Y               
Sbjct: 368 TPIYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTI-NFDYAFIFFYLMLTSQKTP 426

Query: 322 XXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356
               P  LLGG+EKW++ + SY+++Y I   +Y++
Sbjct: 427 LTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDYLY 461

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score =  296 bits (759), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 143/252 (56%), Positives = 187/252 (74%), Gaps = 14/252 (5%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483
           Y +P +  SSN YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S++YK Y+    
Sbjct: 584 YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643

Query: 484 GTKV-DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILL 542
           G ++  P LSNS ++LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++L
Sbjct: 644 GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703

Query: 543 LDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQG 602
           LD+LH+EL SNQ  + +++P+L+ YD D + V N  EYK WF +++   G+S I +IFQG
Sbjct: 704 LDRLHDEL-SNQPHVANDYPNLLLYDADGLKVSNK-EYKHWFDKNVIGNGISPIDDIFQG 761

Query: 603 QLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENEM 655
           Q+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F  +E+
Sbjct: 762 QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEV 821

Query: 656 LTGENAWNCPKC 667
           L+GENAW+CP+C
Sbjct: 822 LSGENAWDCPRC 833

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 99/153 (64%), Gaps = 4/153 (2%)

Query: 692  RSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNT 751
            RSH++  F+  + N            L T K+ +F+ LP +L+IHLSRF    L  KNNT
Sbjct: 912  RSHSNTPFAN-SSNDGNNFNDFKNKKLTTVKTINFVTLPKILVIHLSRFYYD-LTKKNNT 969

Query: 752  DIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFD 811
             I YP IL I LKN +  +++L+GVVNH G L +GHYTSL+NK+  H+++  R KW+YFD
Sbjct: 970  VITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFD 1029

Query: 812  DETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
            DE VK    +   DK++ +ISSSD YVLFYE++
Sbjct: 1030 DEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 124/445 (27%), Positives = 184/445 (41%), Gaps = 106/445 (23%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLDSFII 67
           S+EL + V  +Y+  IK  Y QL   + +DLLE+TE LFE +L         D+L +F+I
Sbjct: 13  SNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDALTAFVI 72

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ---- 123
           G +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E   +L     
Sbjct: 73  GCYYVFLIIPQS-LQFQTRNKSY-SIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVK 130

Query: 124 -----------------------------SFDVDAPSSH----SQHEEDNTADSSTTIWQ 150
                                        S D   P  H    S  EED  AD S+ +W 
Sbjct: 131 HVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEED--ADQSSPVWT 188

Query: 151 APFLEPNDQLKLAIIXXXXXXXXXXXXXXXIDINANES------KYTNFINDKT------ 198
           AP LEPNDQLKLA++                     +S       YT+  ND T      
Sbjct: 189 APNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDNDGTSASSDQ 248

Query: 199 ----------------------INDEDTY------------------LKHLYEECFITPH 218
                                 + D DT+                  L+ L ++  IT  
Sbjct: 249 PFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAP 308

Query: 219 ELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNNRDQTPVLH----R 274
           ELF+ILSN                   L  I +PNL+K DP  LW+ +   PV       
Sbjct: 309 ELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILE 368

Query: 275 TSLFSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXX---XXXXXXXXXXXVTPNFLLG 331
             L  N  F   D F Y++ YSD +T     +F+Y+                  P  LLG
Sbjct: 369 QLLEGNEHFINRDKFQYVVCYSDVKTFMTM-NFDYSFIFFYLLLTSQKTRLATVPTALLG 427

Query: 332 GFEKWEQLISSYSEQYGIETSNYIF 356
           G+EKW++ + +Y++QY I   +Y++
Sbjct: 428 GYEKWKKTLHTYAQQYHISIDDYLY 452

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  298 bits (762), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 188/251 (74%), Gaps = 13/251 (5%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483
           Y +P +  + N+YV LSI+GLRNLGNTCYINSM+QCLFAT +FRNLF+S +YKE++    
Sbjct: 673 YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732

Query: 484 ----GTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFL 539
                    P +S +F+ILF+KMYLNGGC+V+P+ FLK+C+ LRPD +IPD QQDT EFL
Sbjct: 733 PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792

Query: 540 ILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEI 599
           +L+LD+LH+EL SNQD +V+E+PDLI YD   ++V+N  EYKKWF +S+   GLS I +I
Sbjct: 793 MLILDRLHDEL-SNQDAVVNEYPDLILYDEKKLNVQN-KEYKKWFDKSVIGNGLSPIDDI 850

Query: 600 FQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEML 656
           FQGQ+ENSL CQRC ++S NYS F  LSL+IP          K V LE+C++++  +E+L
Sbjct: 851 FQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVL 910

Query: 657 TGENAWNCPKC 667
           +GENAW+CP C
Sbjct: 911 SGENAWDCPNC 921

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (70%), Gaps = 1/127 (0%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            L T K+ +FI++P  LIIHLSRF    L  KN+T + YP IL I LK+ E  ++KLYGVV
Sbjct: 1036 LFTIKTLNFIRMPRTLIIHLSRFYYD-LTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVV 1094

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NH GNL +GHYTS+++K+  H LN     W+YFDDE VK++  + D+   V +ISSSDVY
Sbjct: 1095 NHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVY 1154

Query: 838  VLFYEKI 844
            VLFYE+I
Sbjct: 1155 VLFYERI 1161

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           L+ L ++  IT  ELFSILSN                 +N   I +PN +  DP  LWN+
Sbjct: 389 LERLQKQSIITAPELFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNS 448

Query: 266 RDQTPVLHRTSLFS---NPLFQKIDLFSYIIIYSDNETTTAFESFEYNXX---XXXXXXX 319
               P+   T L S   NPLF + D F Y++ +SD +T     +F+Y+            
Sbjct: 449 NSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMKL-NFDYHFTFFYLLNTARG 507

Query: 320 XXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNKRFTE 364
                 P  LLGG+EKW+++I  Y +QY I  ++Y+     R TE
Sbjct: 508 KPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLV----RITE 548

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 7/117 (5%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLK-----GNTDSLDSFII 67
           SDEL + VV +Y   I     QL   R IDLLE+TE L+E +L       N D+L SFI 
Sbjct: 19  SDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFIN 78

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQS 124
           G FY+ LV+P S      + N    +Y D++  YESQ N++++L +++ E + +L+S
Sbjct: 79  GCFYVYLVMPQSIQF--HTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (85%)

Query: 143 DSSTTIWQAPFLEPNDQLKLA 163
           D S+ +W+AP LEPNDQLKLA
Sbjct: 222 DQSSPLWRAPQLEPNDQLKLA 242

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  293 bits (750), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 188/253 (74%), Gaps = 15/253 (5%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483
           Y +P +  SSN+YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S  YK Y+    
Sbjct: 583 YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642

Query: 484 GTKV--DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541
           G++      LSNS ++LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++
Sbjct: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702

Query: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           LLD+LH+EL SNQ  + +++P+L+ Y+ D++ V N NEYK WF +++   G+S I +IFQ
Sbjct: 703 LLDRLHDEL-SNQQHVANDYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQ 760

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENE 654
           GQ+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F ++E
Sbjct: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820

Query: 655 MLTGENAWNCPKC 667
           +L+GENAW+CP+C
Sbjct: 821 VLSGENAWDCPRC 833

 Score =  132 bits (333), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            L T K+ +F+ LP +L+IHLSRF    L  KN+T I YP IL I LKN E  +++L+GVV
Sbjct: 938  LTTVKTINFVTLPKILVIHLSRFYYD-LTKKNSTVITYPLILNIILKNNETMKYRLFGVV 996

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NH G L +GHYTSL+NK+  H ++  R KW+YFDDE VK   N    DKN+ +ISSSDVY
Sbjct: 997  NHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD-NKHGSDKNL-KISSSDVY 1054

Query: 838  VLFYEKI 844
            VLFYE++
Sbjct: 1055 VLFYERV 1061

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 102/195 (52%), Gaps = 46/195 (23%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLDSFII 67
           S+EL + V  +Y+  IK  Y QL   + +DLLE+TE L+E +L         D+L +FII
Sbjct: 13  SNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDALTAFII 72

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL----- 122
           G +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E   +L     
Sbjct: 73  GCYYVFLIIPQS-LQFQTRNKSY-SIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVK 130

Query: 123 ------------QSFDVDA----------------PSSH----SQHEEDNTADSSTTIWQ 150
                       ++F V A                P  H    S  EED  A+ S+ +W 
Sbjct: 131 HAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEED--AEQSSPVWT 188

Query: 151 APFLEPNDQLKLAII 165
           AP LEPNDQLKLA++
Sbjct: 189 APNLEPNDQLKLALL 203

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 72/155 (46%), Gaps = 8/155 (5%)

Query: 209 LYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNNRDQ 268
           L ++  IT  ELFSILSN                   +  I +PNL+K DP  LW+ +  
Sbjct: 299 LQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTN 358

Query: 269 TPVLH----RTSLFSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXX---XXXXXXXXX 321
           TPV         L  N +F   D F Y++ Y+D +T   + +F+Y               
Sbjct: 359 TPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTF-MYMNFDYVFIFFYLMLTSQKTH 417

Query: 322 XXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356
               P  LLGG+EKW++ + +Y+++Y +   +Y++
Sbjct: 418 LTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLY 452

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  292 bits (748), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 143/257 (55%), Positives = 191/257 (74%), Gaps = 9/257 (3%)

Query: 416 HRPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           H+    + R+  + +P L  S N YV LSI+GLRNLGNTCYINSMLQCLFATT FRN+FL
Sbjct: 725 HKQNGAIHRH--FSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFL 782

Query: 476 SNRYKEYIGTKV--DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533
           S++Y++Y+   +  +  LS SF++LF+KMY+NGGC+V+P  FLKTCN LRPDLRIPD QQ
Sbjct: 783 SHKYEKYMDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQ 842

Query: 534 DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593
           DTQEFL+L+LD+LH+EL SNQ  +  ++PDL++YD D M+V+   +Y KW+ ES+++ GL
Sbjct: 843 DTQEFLMLILDRLHDEL-SNQHEVKLDYPDLVDYDVDDMEVQ-PGQYIKWYNESVKSNGL 900

Query: 594 SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKR-RKFRKL--VDLEDCISLF 650
           S I  +FQGQ E+ L CQRC  +S  YS F  LSL+IP      F K+  V+LEDCI +F
Sbjct: 901 SPIDHVFQGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMF 960

Query: 651 IENEMLTGENAWNCPKC 667
             +E+L+ ENAW+CP+C
Sbjct: 961 TNDEILSDENAWDCPRC 977

 Score =  148 bits (373), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            +VT KS +F+K P +L+IHLSRF    L  KNNT I YP  L I+LKN E  R+KLYG+V
Sbjct: 1086 MVTIKSVNFVKAPRILVIHLSRFYYD-LTKKNNTVITYPLHLNISLKNGEVARYKLYGLV 1144

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NH G L +GHYTSL+NK+  H+L  ++QKWFYFDDE VK++ N+ D++  V  ISSS VY
Sbjct: 1145 NHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSISSSHVY 1204

Query: 838  VLFYEKI 844
            VLFY++I
Sbjct: 1205 VLFYQRI 1211

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 77/157 (49%), Gaps = 7/157 (4%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           L+H+ ++  IT  ELFS+LSN                 F    I +PN+++ +P  LW++
Sbjct: 485 LEHIQKQDVITCPELFSLLSNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDD 544

Query: 266 RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXXX---XXXXXX 319
              TPV     L    +NPLF K D F Y++ YSD +T     +F+Y             
Sbjct: 545 TTNTPVYTAEKLEQIINNPLFSKRDTFKYVVYYSDMKTYMNM-TFDYLFTLFYLLVTCTS 603

Query: 320 XXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356
                 P  LLGG+EKW ++I+SY  QY I  ++Y++
Sbjct: 604 KPVKSLPTSLLGGYEKWYKVINSYVNQYSITMNDYVY 640

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 69/117 (58%), Gaps = 7/117 (5%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKGNTDS-----LDSFII 67
           SDEL + V  IYN++ K  Y QL   + IDLL+++  LFE + K   DS     L +FI+
Sbjct: 15  SDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDALSAFIV 74

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQS 124
           G FY+  +IP S   +  + N +  +Y +LK  YE + N++++L ++++E   IL S
Sbjct: 75  GSFYMYFIIPQSTQFL--TKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  290 bits (742), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 183/253 (72%), Gaps = 15/253 (5%)

Query: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487
           Y +P +  + N+YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S+ YK Y+    
Sbjct: 580 YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639

Query: 488 D------PHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541
                  P LSNS  +LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++
Sbjct: 640 SNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699

Query: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           LLD+LH+EL SNQ  + +++P+L+ Y+ D + V N NEYK WF +++   G+S I +IFQ
Sbjct: 700 LLDRLHDEL-SNQQHVANDYPNLLLYNADVLKVSN-NEYKHWFDKNVIGNGISPIDDIFQ 757

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENE 654
           GQ+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F  +E
Sbjct: 758 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817

Query: 655 MLTGENAWNCPKC 667
           +L+GENAW+CP+C
Sbjct: 818 VLSGENAWDCPRC 830

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            + T K+ +F+ LP +L+IHLSRF    L  KNNT I YP IL I LKN +  +++L+GVV
Sbjct: 935  MTTVKTINFVTLPKILVIHLSRFYYD-LTKKNNTVITYPLILNIILKNNDTMKYRLFGVV 993

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NH G L +GHYTSL+NK+  H ++  R KW+YFDDE VK    +   DKN+ +ISSSDVY
Sbjct: 994  NHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVY 1051

Query: 838  VLFYEKI 844
            VLFYE++
Sbjct: 1052 VLFYERV 1058

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 97/193 (50%), Gaps = 42/193 (21%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLDSFII 67
           SDEL + V  +Y+  IK  Y QL   + +DLLE+TE LFE +L         D+L +F+I
Sbjct: 13  SDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDALTAFVI 72

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ---- 123
           G +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E   +L     
Sbjct: 73  GCYYVFLIIPQS-LQFQTRNKSY-SIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVK 130

Query: 124 -----------------------------SFDVDAPSSHSQHEE--DNTADSSTTIWQAP 152
                                        S D   P  H+      ++  D S+ +W AP
Sbjct: 131 HVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSSPVWTAP 190

Query: 153 FLEPNDQLKLAII 165
            LEPNDQLKLA++
Sbjct: 191 NLEPNDQLKLALL 203

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 79/181 (43%), Gaps = 10/181 (5%)

Query: 182 DINANESKYTNFINDKTINDEDTYLKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXX 241
           ++  +  ++ N  ND  I   D     L ++  IT  ELFSILSN               
Sbjct: 276 NLKEDNDEFLNVENDGFIQSLDI----LQKQSIITAPELFSILSNRVEREKVLLIDLRIP 331

Query: 242 XYFNLQTIRSPNLIKFDPIELWNNRDQTPVLH----RTSLFSNPLFQKIDLFSYIIIYSD 297
               +  I +PNL+K DP  LW+ +  TPV         L  N  F   D F YI+ YSD
Sbjct: 332 QRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSD 391

Query: 298 NET--TTAFESFEYNXXXXXXXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYI 355
            +T  T  F+                    P  LLGG+EKW++ + SY+++Y I   +Y+
Sbjct: 392 VKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYL 451

Query: 356 F 356
           +
Sbjct: 452 Y 452

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  286 bits (731), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 184/245 (75%), Gaps = 9/245 (3%)

Query: 429 GLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI--GTK 486
            +P +  SSN+YV LSI+GLRNLG+TCYINSMLQCLFAT  FR++FLS +Y +YI  G  
Sbjct: 596 SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYI 655

Query: 487 VDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQL 546
               +S SFH+LF+KMY+NGGC+V+P  FLK CN +RPD +IP+ QQDTQEFL+ LLDQL
Sbjct: 656 HRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQL 715

Query: 547 HNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLEN 606
           H+EL S+ +++ +++P L+ +D D++ V+   EY KWF +S+   GLS I  IFQGQ+EN
Sbjct: 716 HDEL-SDPEQVANDYPQLLLHDDDNLQVD-GKEYDKWFEDSISKNGLSPIDSIFQGQMEN 773

Query: 607 SLECQRCNYTSTNYSNFCTLSLSIPNKRR----KFRKLVDLEDCISLFIENEMLTGENAW 662
            L+CQRC ++S NYS F  LSL+IP        K +K++ LEDCI+LF  +E+L+GENAW
Sbjct: 774 CLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL-LEDCINLFTSDEVLSGENAW 832

Query: 663 NCPKC 667
           +CP+C
Sbjct: 833 DCPRC 837

 Score =  148 bits (373), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 93/127 (73%), Gaps = 1/127 (0%)

Query: 718  LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVV 777
            L T K+ +FI +P +L+IHLSRF    L  KN+T I YP IL I LKN E  +++LYG+V
Sbjct: 910  LTTIKTFNFITMPPILVIHLSRF-FYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIV 968

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
            NHFGNL +GHYTSL+NK+  H++   +QKW+YFDDE VKQ  N+ D D  +  +SSSDVY
Sbjct: 969  NHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVY 1028

Query: 838  VLFYEKI 844
            VLFYE+I
Sbjct: 1029 VLFYERI 1035

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 99/193 (51%), Gaps = 43/193 (22%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF----LKGNT-DSLDSFII 67
           S+EL + V  +Y   IK  Y +L   + IDLLE+ E LFE +     +GN  D+L +FII
Sbjct: 10  SNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDALTAFII 69

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL-QSFD 126
           G FY+ L+IP S     + N  Y  IY DL+KYY+ + +++++L ++  + + IL +S D
Sbjct: 70  GSFYVYLIIPQS-IQFHTRNKSY-GIYVDLRKYYQDETSMTNVLLMVTKKVDAILCKSRD 127

Query: 127 VD--------APSSHSQ------------------------HEED---NTADSSTTIWQA 151
            D        A S  SQ                         E D   N AD  TTIW A
Sbjct: 128 FDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDYTTIWSA 187

Query: 152 PFLEPNDQLKLAI 164
           P LEP+DQLKLA+
Sbjct: 188 PKLEPDDQLKLAL 200

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 52/115 (45%), Gaps = 8/115 (6%)

Query: 249 IRSPNLIKFDPIELWNNRDQTPVLHRTSL----FSNPLFQKIDLFSYIIIYSDNETTTAF 304
           I +PNLI  DP +LW+   + P+     L     S   FQ    F YI+ Y+D +T    
Sbjct: 362 IVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNI 421

Query: 305 ESFEYNX---XXXXXXXXXXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356
           + F+Y                   P  LLG +E+W+  I  Y++ + I T +Y+F
Sbjct: 422 D-FDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLF 475

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  260 bits (664), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 176/251 (70%), Gaps = 9/251 (3%)

Query: 424 RYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI 483
           R  ++ +P +  S+N YV LSI+GLRNLG TCYINSMLQCLFAT  FR+LF  + Y+ + 
Sbjct: 577 RQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF 636

Query: 484 GTKVD--PHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541
             +++    LS SF +L RKMY+NGGC+V+P  FLK CNFLRPD  IPD QQD QEFL+L
Sbjct: 637 NPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLML 696

Query: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
            +D+LH+EL SNQ  +++ HP+L+ YD ++  V+   EYK+WF  SL N   S I +IFQ
Sbjct: 697 TIDRLHDEL-SNQTEVLNAHPELLLYDAETSKVQK-EEYKQWFENSLINTKFSPIDKIFQ 754

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-----VDLEDCISLFIENEML 656
           GQLEN L C++C Y+S +YS F  LSL+IP     F        V+LEDCI++F  +E++
Sbjct: 755 GQLENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVM 814

Query: 657 TGENAWNCPKC 667
           + ENAW+CPKC
Sbjct: 815 SRENAWDCPKC 825

 Score =  142 bits (357), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 1/123 (0%)

Query: 722  KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFG 781
            ++T+F+ LP +L+IHLSRF    L  KN T I YP IL I LKN E  +++LY VVNH G
Sbjct: 922  RATNFVTLPPVLVIHLSRFYYD-LTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980

Query: 782  NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            NL +GHYTSL+NK   HDL   RQ+W+YFDDE VK + ++ +L + VN++SS DVYVLFY
Sbjct: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040

Query: 842  EKI 844
            E+I
Sbjct: 1041 ERI 1043

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 91/198 (45%), Gaps = 50/198 (25%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL-----KGNTDSLDSFII 67
           S EL +LV  IY   IKP Y  L      DL+++T  L+E F      +   D+L ++II
Sbjct: 13  SSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYII 72

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQS--- 124
           G +++ L+IP S      + N    ++  LKK YE+Q N++++L +++ E +++L     
Sbjct: 73  GCYFLYLIIPQSTQF--QARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDFR 130

Query: 125 --FDVDAPSSHSQHEEDNTADSSTT----------------------------------- 147
              DV+   + S    DN  DS  +                                   
Sbjct: 131 KLKDVERKRAFSS--PDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSHDTGNV 188

Query: 148 -IWQAPFLEPNDQLKLAI 164
            +W+AP LEPNDQLKLA+
Sbjct: 189 PLWKAPNLEPNDQLKLAL 206

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 79/181 (43%), Gaps = 19/181 (10%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           +K L ++  IT  ELFSILSN                 +    I +PN++  DP  LW+ 
Sbjct: 320 MKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDV 379

Query: 266 RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXX---XXXXXXX 319
             +TPV   + L     N +F K   F +I+ Y+D +T    + F+Y             
Sbjct: 380 NTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMD-FDYLFVFYNLVVASQE 438

Query: 320 XXXXVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF------------TNNKRFTEPPS 367
                 P++LLGG+EKW+ ++  Y  Q+GI   +Y++            + N +  EP  
Sbjct: 439 VSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVP 498

Query: 368 W 368
           W
Sbjct: 499 W 499

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 134/445 (30%), Positives = 194/445 (43%), Gaps = 119/445 (26%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHIL 498
           I GL N+GN+CY+N ++QC+  T     +FL+N Y+++I      G+K    L+ +F  L
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKG--VLAKNFARL 661

Query: 499 FRKMYLNGGCAVI------------PVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQL 546
              MY++   + I            P  F   C  +    R    QQD+QEF   LLD L
Sbjct: 662 IHTMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLDGL 720

Query: 547 HNELKSNQDRLVSEHPDLIEYDTDSMDVENANE-YKKWFAESLENE-----GLSLIHEIF 600
           H +L  NQ      +P L E    S++ E   E      A S+E E       S+I ++F
Sbjct: 721 HEDL--NQ---CGGNPPLKEL---SLEAERLRENLSLRIASSIEWERYLTTDFSVIVDLF 772

Query: 601 QGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGEN 660
           QGQ  + LEC+ C++TST Y +F  LS+ +P K     + +DL DC + F + E L  + 
Sbjct: 773 QGQYASRLECKVCHHTSTTYQSFSVLSVPLPKKFDPQTRKIDLIDCFNEFTKIENLEVDE 832

Query: 661 AWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVT 720
            W+CP C                                                    +
Sbjct: 833 QWSCPTCKKKQP-----------------------------------------------S 845

Query: 721 RKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT--------------LKNK 766
            K  +  +LP  LIIHL RF    +L+KNN+ I YP  L +T              + N+
Sbjct: 846 TKKLTITRLPRNLIIHLKRF--DNMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPGVSNE 903

Query: 767 EKCR-------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQF 819
              R       ++LYGV  HFG+L  GHYT+ ++K   +        W+YFDD T     
Sbjct: 904 LPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDDTT----- 951

Query: 820 NYFDLDKNVNRISSSDVYVLFYEKI 844
            Y  L  +   ISSS  YVLFY ++
Sbjct: 952 -YRPLKNDKEPISSS-AYVLFYTRV 974

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  151 bits (381), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 122/433 (28%), Positives = 180/433 (41%), Gaps = 109/433 (25%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHILFR 500
           GL N+GN+CYIN ++QCL  T    N+FL+  Y+ +I      G+K    L+  F  L  
Sbjct: 464 GLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNSRLGSK--GVLAKYFAKLTH 521

Query: 501 KMYLNG-------GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL-KS 552
            MY N        G  V P+ F   C  +    R    QQD QEF   LLD LH +L + 
Sbjct: 522 SMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR-ESGQQDCQEFCQFLLDGLHEDLNQC 580

Query: 553 NQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQR 612
             +  + E  D  E   + + +  A+   +W  E       S+I ++FQGQ  + L CQ 
Sbjct: 581 GGNPPLKELSDEAEKMREKLSLRIASSI-EW--ERFLTTDFSVIVDLFQGQYASQLRCQV 637

Query: 613 CNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXX 672
           C  TST Y  F  LS+ +P+      K  ++ DC   F + E L  +  W+CP+C     
Sbjct: 638 CGLTSTTYQPFSVLSVPVPHA-----KSCNIIDCFKEFTKVEKLETDEQWSCPRCKKKQP 692

Query: 673 XXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNL 732
                                                          + K  +  +LP  
Sbjct: 693 -----------------------------------------------STKKLTITRLPRN 705

Query: 733 LIIHLSRFSMSGLLDKNNTDIAYPAILTIT------------------LKNKEKC---RF 771
           LIIHL RF    +++KNN  + YP  L +T                  L  + +     +
Sbjct: 706 LIIHLKRF--DNMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGVTEELPTRGQSPPFNY 763

Query: 772 KLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRI 831
           KLYG+ +H G+L  GHYTS ++K P       ++ W YFDD +       F   +N    
Sbjct: 764 KLYGIASHVGSLYGGHYTSYVDKGP-------KRGWCYFDDTS-------FRPVRNATEC 809

Query: 832 SSSDVYVLFYEKI 844
            + + YVLFY ++
Sbjct: 810 ITPNAYVLFYHRV 822

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  148 bits (374), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 127/434 (29%), Positives = 182/434 (41%), Gaps = 108/434 (24%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHIL 498
           I GL N+GN CY+N +LQCL  T     +FL N Y  +I      G+K    L+ +F IL
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKG--LLAKNFAIL 502

Query: 499 FRKMYLNGG-----CAVIPV---LFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
              M+ +G         IPV    F K C  + P +    +QQD QEF   LLD LH +L
Sbjct: 503 VNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHEDL 561

Query: 551 KSNQDRL-VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
             N  +  + +  D  E   + M +  A+   +W  E       S I ++FQGQ  + L+
Sbjct: 562 NQNGSKKHLKQLSDEEERMREKMSIRKASAL-EW--ERFLLTDFSAIIDLFQGQYASRLQ 618

Query: 610 CQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXX 669
           CQ C +TST Y  F  LS+ +P       K  ++ DC   F + E L  +  W+CPKC  
Sbjct: 619 CQVCEHTSTTYQTFSVLSVPVPRV-----KTCNILDCFREFTKCERLGVDEQWSCPKCLK 673

Query: 670 XXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL 729
                                                             + K     +L
Sbjct: 674 KQP-----------------------------------------------STKQLKITRL 686

Query: 730 PNLLIIHLSRFSMSGLLDKNNTDIAYP----------------AILTITLKNKEKC---R 770
           P  LII+L RF     ++KNN  + YP                AI+   +  + +    R
Sbjct: 687 PKKLIINLKRF--DNQMNKNNVFVQYPYSLDLTPYWARDFNHEAIVNEDIPTRGQVPPFR 744

Query: 771 FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNR 830
           ++LYGV  H G+L  GHYTS + K P       ++ W++FDD        Y  +  +   
Sbjct: 745 YRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSL------YRPITFSTEF 791

Query: 831 ISSSDVYVLFYEKI 844
           I+ S  YVLFYE+I
Sbjct: 792 ITPS-AYVLFYERI 804

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/437 (27%), Positives = 188/437 (43%), Gaps = 115/437 (26%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL NLGN+CY+N ++QC+  T     +FL + Y ++I      G+K  +  + +   H++
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 499 FRKMY-LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRL 557
           +++    +   ++ P+ F   C  +    +    QQD QEF   LLD LH +L  NQ   
Sbjct: 623 YKEQVDASKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDL--NQ--- 676

Query: 558 VSEHPDLIEYDTD--------SMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
              +P L E   +        S+ + ++ E++++          S+I ++FQGQ  + L+
Sbjct: 677 CGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDF-----SVIVDLFQGQYASRLK 731

Query: 610 CQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXX 669
           C+ C +TST Y  F  LS+ IP  R+  +  + +EDC   F + E L  +  W CP C  
Sbjct: 732 CKICGHTSTTYQPFTVLSIPIP--RKVPQNEITIEDCFKEFTKCENLEVDEQWLCPHCKK 789

Query: 670 XXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL 729
                                                             + K  +  +L
Sbjct: 790 RQP-----------------------------------------------STKQLTVTRL 802

Query: 730 PNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT--------------LKNKE-------- 767
           P  LIIHL RF    LL+KNN  + YP +L +T              + + E        
Sbjct: 803 PRNLIIHLKRF--DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPVRGQIP 860

Query: 768 KCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKN 827
             +++LYGV  HFG L  GHYT+ + K         R+ W YFDD   K         KN
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKG-------LRKGWLYFDDTKFKPV-------KN 906

Query: 828 VNRISSSDVYVLFYEKI 844
              +++S+ YVLFY ++
Sbjct: 907 KTDVTNSNAYVLFYHRV 923

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 128/473 (27%), Positives = 196/473 (41%), Gaps = 122/473 (25%)

Query: 420 RIVTRYTKYGLP----------HLPHSSNLYVQLS-ISGLRNLGNTCYINSMLQCLFATT 468
           +IVT  +K  LP          H+  S+     L  + GL N+GN+CY+N ++QCL    
Sbjct: 583 KIVTASSKSHLPNNSILTSTGNHVAESTGPQFDLDFMVGLENMGNSCYLNCIIQCLLGNN 642

Query: 469 AFRNLFLSNRYKEYI------GTKVDPHLSNSFHILFRKMYLN------GG--CAVIPVL 514
               +FL N +++Y+      G+K    L+  F  L   MY N      GG    V P  
Sbjct: 643 ELIKIFLDNSFEKYVNLNSKLGSKG--VLARYFSRLIHTMYNNARTIKHGGKHAPVKPAQ 700

Query: 515 FLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL-KSNQDRLVSEHPDLIE--YDTDS 571
           F   C  +    +    QQD QEF   LLD LH +L +   ++ ++E  +  E   +  S
Sbjct: 701 FKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDLNQCGGNKRLAELTEEAENLREKLS 759

Query: 572 MDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
           + + ++ E++++          S+I ++FQGQ  + L+C+ C  TST Y  F  LS+ +P
Sbjct: 760 LRIASSIEWERFLTTDF-----SVIGDLFQGQYASRLQCKTCGKTSTTYQPFSVLSIPVP 814

Query: 632 NKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXN 691
           +K      ++   DC   F + E L  +  W+CP+C                        
Sbjct: 815 SKHISKCSII---DCFDEFTKVENLEVDEQWSCPRCKSKQP------------------- 852

Query: 692 RSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNT 751
                                       + K  +  +LP  LIIHL RF     L+KNN 
Sbjct: 853 ----------------------------STKKLTITRLPRNLIIHLKRF--DNRLNKNNI 882

Query: 752 DIAYPAILTITL--------------------KNKEKCRFKLYGVVNHFGNLNNGHYTSL 791
            + YP  L +T                       K    +KLYGV  HFG+L  GHYT+ 
Sbjct: 883 LVQYPFTLDLTTFWANDFDGKLPLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAY 942

Query: 792 INKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
           ++K         +  W+YFDD + +         KN     +S  YVLFY++I
Sbjct: 943 VDKG-------IKNGWYYFDDTSCRPI-------KNSMEPITSSAYVLFYKRI 981

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 125/435 (28%), Positives = 185/435 (42%), Gaps = 111/435 (25%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL NLGN+CY+N ++QC+  T     +FL + Y ++I      G+K  +  + +   H++
Sbjct: 564 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 623

Query: 499 FRKMYLNGGC-AVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRL 557
           ++K   +    ++ P+ F   C  +    +    QQD QEF   LLD LH +L  NQ   
Sbjct: 624 YKKQVDSSKKDSISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDL--NQ--- 677

Query: 558 VSEHPDLIEYDTDSMDVENANEYKKW-FAESLENE-----GLSLIHEIFQGQLENSLECQ 611
              +P L E    S + E   E      A S+E E       S+I ++FQGQ  + L+C+
Sbjct: 678 CGSNPPLKEL---SQEAETRRERLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCK 734

Query: 612 RCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXX 671
            CN+TST Y  F  LS+ IP K  + +  + +EDC   F + E L  +  W CP C    
Sbjct: 735 TCNHTSTTYQPFTVLSIPIPKKNSQNK--ITIEDCFKEFTKCENLEIDEQWLCPHCEKRQ 792

Query: 672 XXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPN 731
                                                           + K  +  +LP 
Sbjct: 793 P-----------------------------------------------STKQLTITRLPR 805

Query: 732 LLIIHLSRFSMSGLLDKNNTDIAYPAILTIT--------------LKNKE--------KC 769
            LIIHL RF    LL+KNN  + YP +L +T              + + E          
Sbjct: 806 NLIIHLKRF--DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPF 863

Query: 770 RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVN 829
           +++LYGV  HFG L  GHYTS + K  S       + W YFDD   +         KN  
Sbjct: 864 KYELYGVACHFGTLYGGHYTSYVKKGLS-------RGWLYFDDTKYRPA-------KNQT 909

Query: 830 RISSSDVYVLFYEKI 844
              +S+ YVLFY ++
Sbjct: 910 DAINSNAYVLFYHRV 924

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 138/471 (29%), Positives = 199/471 (42%), Gaps = 139/471 (29%)

Query: 426 TKYGLPHLP--HSSNLYVQLS-ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEY 482
           TK G+P+    H+++  + L  I GL+N+GN+CY+N ++QCL  T     +FL+N Y+ +
Sbjct: 536 TKTGIPNKSALHTNDKMLDLDFIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERH 595

Query: 483 I------GTK-----------------VDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTC 519
           I      G+K                  +P L N++    R          +  LF K C
Sbjct: 596 INLNSKLGSKGVLAKYFARLIHLMHNHANPKLKNNY---VRPAQFKMAVGSVNTLF-KNC 651

Query: 520 NFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANE 579
           +           QQD QEF   LLD LH +L  NQ      +P L E    S   +N  +
Sbjct: 652 S-----------QQDCQEFCQFLLDGLHEDL--NQ---CGSNPPLKEL--SSAAEKNREK 693

Query: 580 YKKWFAESLENE-----GLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKR 634
                A S+E E       S+I ++FQGQ  + L+C+ C +TST Y  F  LS+ IP   
Sbjct: 694 LSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLQCEVCKHTSTTYQPFSVLSVPIPRVP 753

Query: 635 RKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSH 694
           +  +  V++ DC   F + E+L  +  W CP C                        RS 
Sbjct: 754 KGVK--VNILDCFKDFTKLELLDTDEQWLCPTC--------------------KKKQRST 791

Query: 695 NDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIA 754
             LT +                           +LP  LIIHL RF  +   + N  D  
Sbjct: 792 KKLTIT---------------------------RLPRNLIIHLKRFDNNLNKNNNFID-- 822

Query: 755 YPAILTIT------------------LKNKEKC---RFKLYGVVNHFGNLNNGHYTSLIN 793
           YP IL +T                  L  + +    ++KLYGV +HFG+L  GHYT+ ++
Sbjct: 823 YPFILDLTQFWVDDFDGKLPPGVRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVD 882

Query: 794 KEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
           K P H        W+YFDD       NY  + KN N   +S  Y+LFY +I
Sbjct: 883 KGPKHG-------WYYFDDT------NYRSI-KNKNEPITSSAYLLFYHRI 919

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 130/444 (29%), Positives = 183/444 (41%), Gaps = 130/444 (29%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHILFR 500
           GL N+GN+CYIN ++QC+FATT    +FL+  Y ++I      G+K    LS++F  L +
Sbjct: 526 GLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKG--VLSHNFAKLLK 583

Query: 501 KMYLNGGC--------AVIPVLFLKTC---NFLRPDLRIPDVQQDTQEFLILLLDQLHNE 549
            MY             AV  + F   C   N L  D      QQD  EF   LLD LH +
Sbjct: 584 DMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDAS----QQDCLEFCQFLLDGLHED 639

Query: 550 LKSNQDRLVSEHPDLIEYDTD--------SMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           L  NQ      +P L E   +        S+ V ++ E++++          S+I ++FQ
Sbjct: 640 L--NQ---CGANPPLKELSPEAEKMRENLSLRVASSIEWERYLTTD-----FSIIVDLFQ 689

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENA 661
           GQ  + L C+ CN TST Y  F  LS+ +P+      K   L DC   F + E L  +  
Sbjct: 690 GQYASQLRCKVCNRTSTTYQAFSVLSVPVPSG-----KSCGLLDCFIEFTKTENLEVDEQ 744

Query: 662 WNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTR 721
           W CP C                                                    + 
Sbjct: 745 WFCPSCKKKQP-----------------------------------------------ST 757

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT--------------LKNKE 767
           K  +  +LP  LIIHL RF    +++KNN  + YP IL +T              + ++ 
Sbjct: 758 KKLTITRLPRNLIIHLKRF--DNMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGITDEI 815

Query: 768 KCR-------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFN 820
             R       ++LYG   HFG L  GHYTS ++K P        + W YFDD TV +   
Sbjct: 816 PARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGP-------EKGWIYFDD-TVYRPVR 867

Query: 821 YFDLDKNVNRISSSDVYVLFYEKI 844
           +       N   S   YVLFY +I
Sbjct: 868 F------QNEFISPSAYVLFYHRI 885

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 126/464 (27%), Positives = 191/464 (41%), Gaps = 129/464 (27%)

Query: 430 LPHLPHSSNLYVQLSIS--------GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKE 481
           LP LP +S+     + S        GL N+GN+CY+N ++QCL ++  F  +FL+N Y++
Sbjct: 584 LPQLPSASDTLKSYTNSDKDYDFSIGLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEK 643

Query: 482 YIGTK----VDPHLSNSFHILFRKMYLNGG--------CAVIPVLFLKTCNFLRPDLRIP 529
           +I  K        L+ +F  L   MY  G           V P  F   C  +    R  
Sbjct: 644 HINLKSKLGSKGVLARNFARLINTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-S 702

Query: 530 DVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTD--------SMDVENANEYK 581
           D+QQD+QEF   LLD LH +L  NQ      +P L E   +        S+ + ++ E++
Sbjct: 703 DLQQDSQEFCQFLLDGLHEDL--NQ---CGANPPLKELSPNAEKMREKLSLRIASSIEWE 757

Query: 582 KWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLV 641
           ++          S+I + FQGQ  + L C+ C  TST Y  F  LS+ +P       K  
Sbjct: 758 RYLTTD-----FSVIVDQFQGQYASQLRCKVCGGTSTTYQAFSVLSVPVPRG-----KSC 807

Query: 642 DLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSE 701
           ++ DC + F + E L  +  W CP C                                  
Sbjct: 808 NIIDCFNEFTKVENLETDELWACPHCKKKQP----------------------------- 838

Query: 702 YNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTI 761
                             + K  +  +LP  LIIHL RF    +L+KNN  + YP +L +
Sbjct: 839 ------------------STKKLTITRLPRNLIIHLKRF--DNMLNKNNIFVKYPFLLDL 878

Query: 762 T------------------LKNKEKC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDL 800
           T                  L  + +     +KL  V  HFG+L  GHYTS ++K      
Sbjct: 879 TPYWANDFDGRLPPGVTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK------ 932

Query: 801 NPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
              +  W YFDD  ++   N ++         +S+ YVLFY ++
Sbjct: 933 --GKFGWRYFDDTKIRPLKNSYE-------CITSNAYVLFYHRV 967

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 125/466 (26%), Positives = 196/466 (42%), Gaps = 129/466 (27%)

Query: 429 GLPHLPHS-SNLYVQLS--------ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRY 479
            LP LPH  +  Y  L+          GL N+GN+CY+N ++QCL +T     +FL+N Y
Sbjct: 493 ALPQLPHHMTGTYQNLNQPKLDLDFTVGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSY 552

Query: 480 KEYI------GTK--VDPHLSNSFHILFR----KMYLNGGCAVIPVLFLKTCNFLRPDLR 527
           +++I      G+K  +  + +   H ++R    K  L     + P+ F   C  +   L 
Sbjct: 553 EKHINLNSKLGSKGVLAKYFARLVHTMYREGSFKRPLEKNKPIQPIQFKMACGSIN-SLF 611

Query: 528 IPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTD--------SMDVENANE 579
             + QQD+QEF   LLD LH +L  NQ      +P L E   D        SM + ++ E
Sbjct: 612 KDNTQQDSQEFCQFLLDGLHEDL--NQ---CGANPPLKELSEDAEKMREKLSMRIASSIE 666

Query: 580 YKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRK 639
           ++++          S+I ++FQGQ  + L+C+ C  TST Y  F  LS+ +P+       
Sbjct: 667 WERFLTTD-----FSVIVDLFQGQYASQLKCKVCGCTSTTYQTFSVLSVPVPHVSS---- 717

Query: 640 LVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTF 699
              + DC + F + E L  +  W+CP C                                
Sbjct: 718 -CHILDCFNEFTKVEKLGTDELWSCPTCKKKQP--------------------------- 749

Query: 700 SEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAIL 759
                               + K  +  +LP  LIIHL RF    +++KNN  + YP +L
Sbjct: 750 --------------------STKKLTITRLPRNLIIHLKRF--DNMMNKNNVFVKYPFLL 787

Query: 760 TIT------------------LKNKEKC---RFKLYGVVNHFGNLNNGHYTSLINKEPSH 798
            +T                  L  + +    R+KL  V +H G+L  GHYT+ +NK    
Sbjct: 788 DLTPYWANDFDGRLPPGVTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNK---- 843

Query: 799 DLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
            +N   + W YFDD + +         KN     + + YVLFY ++
Sbjct: 844 GIN---RGWHYFDDTSYRP-------IKNETECITPNAYVLFYHRV 879

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 124/440 (28%), Positives = 186/440 (42%), Gaps = 123/440 (27%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL N+GN+CYIN ++QCL  T    N+FL+N Y+ +I      G+K  +  H +   H +
Sbjct: 516 GLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQM 575

Query: 499 -----FRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSN 553
                F+K   N   AV P  F   C  +    R    QQD+QEF   LLD LH +L  N
Sbjct: 576 HQSAAFKKSDKNK--AVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDL--N 630

Query: 554 QDRLVSEHPDLIEYDTD--------SMDVENANEYKKWFAESLENEGLSLIHEIFQGQLE 605
           Q      +P L E   +        SM + ++ E++++          S+I ++FQGQ  
Sbjct: 631 Q---CGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRD-----FSVIVDLFQGQYA 682

Query: 606 NSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCP 665
           + L C+ CN+TST Y  F  L+  +P+ +  +     L DC   F + E L  +  W CP
Sbjct: 683 SQLRCKVCNHTSTTYQPFSILAAPVPHAKSCY-----LLDCFKEFTKLEQLEKDEEWLCP 737

Query: 666 KCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTS 725
            C                                                    + K  +
Sbjct: 738 YCKKKQP-----------------------------------------------STKKLT 750

Query: 726 FIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT------------------LKNKE 767
             +LP  LIIHL RF    LL+KNN  + YP  L +T                  L ++ 
Sbjct: 751 ITRLPRNLIIHLKRF--DNLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDELPSRG 808

Query: 768 KC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDL 824
           +    ++KLY V +H G+L  GHYT+ ++K     LN   + W+YFDD   +        
Sbjct: 809 QVAPFKYKLYAVASHSGSLYGGHYTAYVDK----GLN---KGWYYFDDTGYRPM------ 855

Query: 825 DKNVNRISSSDVYVLFYEKI 844
            +      +S+ YVLFY ++
Sbjct: 856 -RTPTECITSNAYVLFYHRV 874

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 117/437 (26%), Positives = 185/437 (42%), Gaps = 115/437 (26%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL NLGN+CY+N ++QC+  T     +FL + Y ++I      G+K  +  + +   H++
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 625

Query: 499 FRKMY-LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRL 557
           +++    +   ++ P+ F   C  +    +    QQD QEF   LLD LH +L  NQ   
Sbjct: 626 YKEQVDSSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDL--NQ--- 679

Query: 558 VSEHPDLIEYDTD--------SMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
              +P L E   +        S+ + ++ E++++          S+I ++FQGQ  + L 
Sbjct: 680 CGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDF-----SVIVDLFQGQYASRLR 734

Query: 610 CQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXX 669
           C+ CN+TST Y  F  LS+ IP K  + +  + +EDC   F + E L  E  W CP C  
Sbjct: 735 CKVCNHTSTTYQPFTVLSIPIPKKNSQNK--ITIEDCFKEFTKCENLEVEEQWLCPHCKQ 792

Query: 670 XXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL 729
                                                             + K  +  +L
Sbjct: 793 RQP-----------------------------------------------STKQLTVTRL 805

Query: 730 PNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT--------------LKNKE-------- 767
           P  LI+HL RF     L+KNN  + YP +L +T              + + E        
Sbjct: 806 PRNLIVHLKRF--DNFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 863

Query: 768 KCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKN 827
             +++LYGV  HFG L  GHYT+ + K         ++ W YFDD   K         KN
Sbjct: 864 PFKYELYGVACHFGTLYGGHYTAYVKKG-------LKKGWLYFDDTKYKPV-------KN 909

Query: 828 VNRISSSDVYVLFYEKI 844
                +S+ YVLFY ++
Sbjct: 910 QTDAINSNAYVLFYHRV 926

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 56/132 (42%), Gaps = 26/132 (19%)

Query: 186 NESKYTNFINDKTINDEDTYLKHLYEEC-------FITPHEL----FSILSNPXXXXXXX 234
           N +K  NFI   ++     YL    EEC        ITP  L    FS  ++        
Sbjct: 154 NIAKIKNFIKS-SVRQRKLYLDQ--EECSMMGTGSIITPSHLNSLIFSSTNSTSSQMETL 210

Query: 235 XXXXXXXXYFNLQTIRSPNLIKFDPIEL---WNNRDQTPVLHRTSLFSNP-----LFQKI 286
                    FN   I S N+I  +PI     +++ D    L R SL ++P     LFQ  
Sbjct: 211 LIDIRSRLEFNKSHIDSKNIICLEPISFKMSYSDHD----LERKSLITSPNDEIKLFQSR 266

Query: 287 DLFSYIIIYSDN 298
           +LF +I++Y+D+
Sbjct: 267 NLFKFIVLYTDS 278

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 122/451 (27%), Positives = 193/451 (42%), Gaps = 117/451 (25%)

Query: 434 PHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK- 486
           P SS+ Y      GL NLGN+CY+N ++QC+  T     +FL + Y ++I      G+K 
Sbjct: 550 PTSSHNYDLDFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKG 609

Query: 487 -VDPHLSNSFHILFRKMYLNGG--CAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLL 543
            +  + +   H+++++  ++G    ++ P+ F   C  +    +    QQD QEF   LL
Sbjct: 610 ILAKYFARLVHMMYKEQ-VDGSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLL 667

Query: 544 DQLHNELKSNQDRLVSEHPDLIEYDTD--------SMDVENANEYKKWFAESLENEGLSL 595
           D LH +L  NQ      +P L E   +        S+ + ++ E++++          S+
Sbjct: 668 DGLHEDL--NQ---CGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTD-----FSV 717

Query: 596 IHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEM 655
           I ++FQGQ  + L+C+ C++TST Y  F  LS+ IP K    R  + +EDC   F + E 
Sbjct: 718 IVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNS--RNNITIEDCFREFTKCEN 775

Query: 656 LTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXX 715
           L  +  W CP C                                                
Sbjct: 776 LEVDEQWLCPHCEKRQP------------------------------------------- 792

Query: 716 XXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT------------- 762
               + K  +  +LP  LI+HL RF    LL+KNN  + YP +L +T             
Sbjct: 793 ----STKQLTITRLPRNLIVHLKRF--DNLLNKNNDFVIYPFLLDLTPFWANDFDGVFPP 846

Query: 763 -LKNKE--------KCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813
            + + E          +++LYGV  HFG L  GHYT+ + K         ++ W YFDD 
Sbjct: 847 GVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKG-------LKKGWLYFDDT 899

Query: 814 TVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
             K   N  D         +S+ YVLFY ++
Sbjct: 900 KYKPVKNKAD-------AINSNAYVLFYHRV 923

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 122/438 (27%), Positives = 187/438 (42%), Gaps = 117/438 (26%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL N+GN+CY+N +LQC+  T     +FL+N Y+++I      G+K  +  + +   HI+
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHIM 643

Query: 499 FRKMYLNGGCAVI--PVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDR 556
            +  Y     A I  P  F      +    R  + QQD QEF   LLD LH +L  NQ  
Sbjct: 644 HQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTN-QQDCQEFCQFLLDGLHEDL--NQ-- 698

Query: 557 LVSEHPDLIEYDTD--------SMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSL 608
               +P L E   +        S+ + ++ E++++   +      S+I ++FQGQ  + L
Sbjct: 699 -CGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTN-----FSVIIDLFQGQYASRL 752

Query: 609 ECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCX 668
           +C  C+ TST Y  F  LS+ +P   +     V+L DC + F + E L  +  WNCP C 
Sbjct: 753 KCSVCSNTSTTYQPFSVLSVPLPTGTKSS---VNLMDCFNEFTKCEKLEHDEYWNCPTCK 809

Query: 669 XXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIK 728
                                                              + K  +  +
Sbjct: 810 KKQP-----------------------------------------------STKQLTITR 822

Query: 729 LPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-------------------LKNKEKC 769
           LP  LIIHL RF     ++KN   I YP  L +T                   L  + + 
Sbjct: 823 LPRNLIIHLKRF--DNRMNKNTKLIDYPFNLDLTSFWANDKDDRLPPGVSIDELPARGQI 880

Query: 770 ---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDK 826
              ++ LY V NHFG+L  GHYTS +NK  S       + W+YFDD+        + L K
Sbjct: 881 PPFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQN-------YRLVK 926

Query: 827 NVNRISSSDVYVLFYEKI 844
             + + +S+ YVLFY ++
Sbjct: 927 KTSEVVNSNAYVLFYRRV 944

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score =  142 bits (357), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 131/489 (26%), Positives = 202/489 (41%), Gaps = 142/489 (29%)

Query: 416  HRPKRIVTRYTKYGLPHLPHSSNLYVQLSISG------------LRNLGNTCYINSMLQC 463
            H P    +     GL H P+++ + +  S +G            L N+GN+CY+N ++QC
Sbjct: 693  HYPTSNSSSNQNNGLTHHPNNTTMTISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQC 752

Query: 464  LFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHILFRKMYLNGGCA-------- 509
            L        +FL+N Y+++I      G+K    L+ SF  L   MY NG  +        
Sbjct: 753  LLNNHELTKMFLNNSYEKHININSKLGSKGI--LAKSFARLVHSMYQNGTLSIKNHSNKK 810

Query: 510  ---VIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
               V P+ F   C  +    +  + QQD QEF   LLD LH +L  NQ      +P L E
Sbjct: 811  NPPVQPITFKTACGSINSLFKGSN-QQDCQEFCQFLLDGLHEDL--NQ---CGANPPLKE 864

Query: 567  YDTD--------SMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTST 618
              T+        S+ + ++ E++++          S+I +++QGQ  + L+CQ C  TST
Sbjct: 865  LSTEAERMREKLSLRIASSIEWERFLTTD-----FSVIIDLYQGQYASQLKCQVCGTTST 919

Query: 619  NYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXX 678
             Y  F  LS+ +P       K + L DC + F + E L  +  W+C +C           
Sbjct: 920  TYQTFSVLSVPVPK-----NKSIHLLDCFNEFTKTEFLGKDELWSCTECKKKQP------ 968

Query: 679  XXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLS 738
                                                     + K+ +  +LP  LIIHL 
Sbjct: 969  -----------------------------------------STKTLTITRLPKNLIIHLK 987

Query: 739  RFSMSGLLDKNNTDIAYPAILTIT------------------LKNKEKC---RFKLYGVV 777
            RF    +L KNN  + YP IL +T                  L  + +    +++L GV 
Sbjct: 988  RF--DNMLHKNNVFVKYPLILDLTNYWANDFDGKLPPGVTEELPARGQIPPFKYELSGVA 1045

Query: 778  NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
             H G+L  GHYT+ +NK         +  W+YFDD TV +   Y       + + + + Y
Sbjct: 1046 LHMGSLYGGHYTAYVNKG-------LKNGWYYFDD-TVYRSIKY------SSEMITQNAY 1091

Query: 838  VLFYEKIIE 846
            VLF   IIE
Sbjct: 1092 VLF---IIE 1097

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 121/435 (27%), Positives = 180/435 (41%), Gaps = 110/435 (25%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHIL 498
           I GL N+GN CY+N +LQCL  T     +FL N Y  +I      G+K    L+ ++  L
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKG--LLAKNYATL 520

Query: 499 FRKMYLNGG--------CAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
              M+ +G           V  + F K C  +   +    +QQD QEF   LLD LH +L
Sbjct: 521 VHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN-SIYSDSMQQDCQEFCQFLLDGLHEDL 579

Query: 551 KSNQDRL-VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
             N  +  + +  +  E   +SM +  A+   +W  E       S I ++FQGQ  + L+
Sbjct: 580 NQNGGKKHLKQLSEQEERMRESMSIRKASAL-EW--ERFLLTDFSAIIDLFQGQYASRLQ 636

Query: 610 CQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXX 669
           CQ C +TST Y  F  LS+ +P  R       ++ DC   F + E L  +  W+C KC  
Sbjct: 637 CQACEHTSTTYQTFSVLSVPVPRIR-----TCNILDCFREFTKCEKLGVDEQWSCSKCLK 691

Query: 670 XXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL 729
                                                             + K     +L
Sbjct: 692 KQP-----------------------------------------------STKQLKITRL 704

Query: 730 PNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-----------LKNKE--------KCR 770
           P  LII+L RF     ++KNN  + YP  L +T           + N++          R
Sbjct: 705 PKKLIINLKRF--DNQMNKNNVFVQYPCFLDLTPYWARDFNHESIVNEDIPTRGQIPPFR 762

Query: 771 FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDET-VKQQFNYFDLDKNVN 829
           ++LYGV  H G+L  GHYTS + K P       ++ W++FDD      +FN        +
Sbjct: 763 YRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWYFFDDSVYCPIRFN--------D 807

Query: 830 RISSSDVYVLFYEKI 844
              + + YVLFYE+I
Sbjct: 808 EFITPNAYVLFYERI 822

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 114/413 (27%), Positives = 173/413 (41%), Gaps = 114/413 (27%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL N GN+CY++ ++QCL  T     +FL+N Y+ +I      G+K  +  + S   H +
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQM 548

Query: 499 F------RKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKS 552
           +      RK   N   AVIP  F   C  +    +  + QQD QEF   LLD LH +L  
Sbjct: 549 YQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL-- 605

Query: 553 NQDRLVSEHPDLIEYDTDS--------MDVENANEYKKWFAESLENEGLSLIHEIFQGQL 604
           NQ      +P L E   ++        M + +A E++++          S+I ++FQGQ 
Sbjct: 606 NQ---CGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDF-----SVIVDLFQGQY 657

Query: 605 ENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
            + L+C+ C  TST Y  F  LS+ +P+ R        L DC + F + E L  E  W+C
Sbjct: 658 ASQLQCKVCQRTSTTYQPFSVLSVPVPSTR-----TCTLTDCFTEFTKIETLEQEEQWSC 712

Query: 665 PKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKST 724
           P C                                                    + K  
Sbjct: 713 PSCKKRQP-----------------------------------------------STKKI 725

Query: 725 SFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-----------------LKNKE 767
           +  +LP  LIIHL RF    +L+KNN  ++YP++L +T                 L ++ 
Sbjct: 726 TITRLPRNLIIHLKRF--DNMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELPSRG 783

Query: 768 KC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ 817
           +     ++LYG+  H G L  GHYT+ +NK            W Y+DD   +Q
Sbjct: 784 QVPPFNYQLYGIACHDGTLRAGHYTAYVNKGAVLG-------WCYYDDTNWRQ 829

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 121/443 (27%), Positives = 182/443 (41%), Gaps = 126/443 (28%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHILFR 500
           GL N GN+CY++ ++QCL  T     +FL+N Y+ +I      G+K    L+  F  L  
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSK--GVLARYFSQLIH 544

Query: 501 KMYLNGG----------CAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
           +MY  G            AV+P  F   C  +    R    QQD QEF   LLD LH +L
Sbjct: 545 QMYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHEDL 603

Query: 551 KSNQDRLVSEHPDLIEYDTDS--------MDVENANEYKKWFAESLENEGLSLIHEIFQG 602
             NQ      +P L E    +        M + ++ E++++          S+I ++FQG
Sbjct: 604 --NQ---CGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTDF-----SVIVDLFQG 653

Query: 603 QLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAW 662
           Q  + L C+ C  TST Y  F  LS+ +P+ R+       + DC + F + E L  +  W
Sbjct: 654 QYASQLRCKVCGRTSTTYQPFSVLSVPVPSSRQ-----CTIIDCFTEFTKVETLDLDEQW 708

Query: 663 NCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRK 722
           +CP C                                                    + K
Sbjct: 709 SCPDCKKRQP-----------------------------------------------STK 721

Query: 723 STSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT------------------LK 764
             +  +LP  LIIHL RF    +L+KNN  ++Y A+L +T                  L 
Sbjct: 722 KITITRLPRNLIIHLKRF--DNMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELP 779

Query: 765 NKEKC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNY 821
           ++ +     ++LYGV  H G L  GHYT+ +NK  +         W Y+DD   +Q    
Sbjct: 780 SRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNKGATLG-------WCYYDDTNWRQ---- 828

Query: 822 FDLDKNVNRISSSDVYVLFYEKI 844
               ++ N   S + YVLFY +I
Sbjct: 829 ---IRSSNEYISQNAYVLFYHRI 848

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/438 (26%), Positives = 177/438 (40%), Gaps = 116/438 (26%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL NLGN+CY+N ++QCL  T     +FL + YK ++      G+K  +  + S   H +
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNM 116

Query: 499 FRKMYLNGGC---------AVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNE 549
            ++     G          AV P+ F   C  +    +    QQD QEF   LLD LH +
Sbjct: 117 QQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKTTS-QQDCQEFCQFLLDGLHED 175

Query: 550 LKSNQD----RLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLE 605
           L         + +SE  + I  +   M + ++ E++++          S+I ++FQGQ  
Sbjct: 176 LNQCGGNPALKELSEEAEAIR-EKLCMRIASSIEWERYLTTD-----FSVIVDLFQGQYA 229

Query: 606 NSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCP 665
           + L C+ C  TST Y  F  LS+ +P   R      +L DC   F + E L  +  W+CP
Sbjct: 230 SQLMCKVCGRTSTTYQPFSVLSVPVPRGAR-----CNLLDCFEEFTKIETLEKDEQWSCP 284

Query: 666 KCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTS 725
           +C                                                    + K  +
Sbjct: 285 RCKVKQP-----------------------------------------------STKKIT 297

Query: 726 FIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-----------------LKNKEK 768
             +LP  LIIHL RF    LL KNN  ++YP  L +T                 L  + +
Sbjct: 298 ITRLPRNLIIHLKRF--DNLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGVAELPTRGQ 355

Query: 769 C---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLD 825
                + LY V  HFG L  GHYT+ +NKE        +  W YFDD   ++        
Sbjct: 356 TPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWRKA------- 401

Query: 826 KNVNRISSSDVYVLFYEK 843
           K+ +   ++  YVLFY +
Sbjct: 402 KSEDECITTSAYVLFYHR 419

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 123/438 (28%), Positives = 179/438 (40%), Gaps = 116/438 (26%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHIL 498
           I GL N GN CY+N +LQCL  T     +FL N Y  +I      G+K    L+ +F  L
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSK--GLLAKNFATL 502

Query: 499 FRKMYLNGG--------CAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
            R M+ N            V  + F K C  +   +    +QQD QEF   LLD LH +L
Sbjct: 503 VRNMHRNSAFMPVNSRTTPVQTIQFKKICGHIN-SIYSDSMQQDCQEFCQFLLDGLHEDL 561

Query: 551 KSNQDRLVSEHPDLI----EYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLEN 606
             N  +   EH   +    E   + M +  A+   +W  E       S I ++FQGQ  +
Sbjct: 562 NQNGGK---EHLKQLTEEEEQKREKMTIRKASAL-EW--ERFLLTDFSAIIDLFQGQYAS 615

Query: 607 SLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPK 666
            L+CQ C+ TST Y  F  LS+ +P          ++ DC   F + E L  +  W+CP+
Sbjct: 616 RLQCQACDRTSTTYQTFSVLSVPVPRI-----TTCNILDCFREFTKCEKLGIDELWSCPR 670

Query: 667 CXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSF 726
           C                                                    + K    
Sbjct: 671 CLKKQP-----------------------------------------------STKQLKI 683

Query: 727 IKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-----------LKNKE-------- 767
            +LP  LII+L RF     ++KNN  + YP  L +T           + N++        
Sbjct: 684 TRLPKKLIINLKRF--DNQMNKNNVFVQYPYFLDLTPYWARDFNHEAIVNEDIPTRGQIP 741

Query: 768 KCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ-QFNYFDLDK 826
             R++LYGV  H G+L  GHYTS + K P       ++ W++FDD   +  +FN      
Sbjct: 742 PFRYRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSIYRPIRFN------ 788

Query: 827 NVNRISSSDVYVLFYEKI 844
             +   + + YVLFYE+I
Sbjct: 789 --DEFITPNAYVLFYERI 804

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 128/444 (28%), Positives = 186/444 (41%), Gaps = 120/444 (27%)

Query: 445  ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFH 496
            I GL+N+GN+CY+N ++QCL  T     +FL+  ++ YI      G+K  +  +LS   H
Sbjct: 746  IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 497  ILFRKMYL----------NGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQL 546
            +++    L          +G   + P+ F   C  +  +L     QQD QEF   LLD L
Sbjct: 806  LMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSIN-NLFKNCSQQDCQEFCQFLLDAL 864

Query: 547  HNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENE-----GLSLIHEIFQ 601
            H +L  NQ      +P L E  T +  +      +   A S+E E       S+I ++FQ
Sbjct: 865  HEDL--NQ---CGSNPPLKELSTKAESMREKLSLR--IASSIEWERYLTTDFSVIVDLFQ 917

Query: 602  GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENA 661
            GQ  + L+C+ C +TST Y  F  LS+ IP K+      ++L DC   F + E L  +  
Sbjct: 918  GQYASRLQCKTCIHTSTTYQPFSVLSVPIPKKKN-----LNLLDCFKDFTKIENLEVDEQ 972

Query: 662  WNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTR 721
            W CP C                                                    + 
Sbjct: 973  WFCPNCKSKQP-----------------------------------------------ST 985

Query: 722  KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT------------------L 763
            K  +  +LP  LIIHL RF  +   + N  D  YP IL +T                  L
Sbjct: 986  KKLTITRLPRNLIIHLKRFDNNLNKNNNLID--YPFILDLTQFWADDFDGELPPGVTDEL 1043

Query: 764  KNKEKC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFN 820
              + +    +++LYG   HFG+L  GHYT+ +NK         R  W+YFDD       N
Sbjct: 1044 PKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKG-------IRNGWYYFDDT------N 1090

Query: 821  YFDLDKNVNRISSSDVYVLFYEKI 844
            Y  + KN     SS+ YVLFY +I
Sbjct: 1091 YRPI-KNEREPISSNAYVLFYHRI 1113

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 122/448 (27%), Positives = 183/448 (40%), Gaps = 108/448 (24%)

Query: 431 PHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------G 484
           P + +S+ ++    I GL N+GN CY+N +LQCL  T     +FL N Y  +I      G
Sbjct: 414 PPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFDNMRG 473

Query: 485 TKVDPHLSNSFHILFRKMYLNGG--------CAVIPVLFLKTCNFLRPDLRIPDVQQDTQ 536
           +K    L+ +F  L   M+ +G           V  + F KTC  +   +    +QQD Q
Sbjct: 474 SKG--LLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHIN-SIYSDSMQQDCQ 530

Query: 537 EFLILLLDQLHNELKSNQDRL-VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSL 595
           EF   LLD LH +L  N  +  + +  +  E   ++M +  A+   +W  E       S 
Sbjct: 531 EFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTRENMSIRKASAL-EW--ERFLLTDFSA 587

Query: 596 IHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEM 655
           + ++FQGQ  + L+CQ C +TST Y  F  LS+ +P          ++ DC   F + E 
Sbjct: 588 VIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRI-----MTCNVLDCFREFTKCEK 642

Query: 656 LTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXX 715
           L     W+C +C                                                
Sbjct: 643 LGIGEQWSCSRCLKKQP------------------------------------------- 659

Query: 716 XXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLK-----NKEKC- 769
               + K     +LP  LII+L RF     + KNN  + YP  L +T       N E   
Sbjct: 660 ----STKQLKITRLPKKLIINLKRF--DNQMHKNNVFVQYPCFLDLTPYWARDFNHEAII 713

Query: 770 -------------RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVK 816
                        R++LYGV  H G+L  GHYTS + K P       ++ W++FDD    
Sbjct: 714 DEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWYFFDD---- 762

Query: 817 QQFNYFDLDKNVNRISSSDVYVLFYEKI 844
                + L +  N   + + YVLFYE+I
Sbjct: 763 ---TIYRLIRFNNEFITPNAYVLFYERI 787

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 119/442 (26%), Positives = 187/442 (42%), Gaps = 119/442 (26%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL NLGN+CY+N ++QCL  T     +FL++ YK +I      G+K  +  + S   H +
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHNM 583

Query: 499 FRK------------MYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQL 546
           +R+            +  +   AV P+ F   C  +    R    QQD QEF   LLD L
Sbjct: 584 YRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFRDCS-QQDCQEFCQFLLDGL 642

Query: 547 HNELK--SNQDRL--VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQG 602
           H +L       RL  +SE  + I  +  SM + ++ E++++          S+I ++FQG
Sbjct: 643 HEDLNQCGGNPRLKELSEEAEKIR-EKLSMRIASSIEWERYLTTD-----FSVIVDLFQG 696

Query: 603 QLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAW 662
           Q  + L+CQ C  TST Y  F  LS+ +P+      K  ++ DC   F + E L  +  W
Sbjct: 697 QYASQLKCQVCGRTSTTYQPFSVLSVPLPS-----LKSCNILDCFQEFTKVETLEKDEQW 751

Query: 663 NCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRK 722
           +CP C                                                    + K
Sbjct: 752 SCPDCKKRQP-----------------------------------------------STK 764

Query: 723 STSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-----------------LKN 765
             +  +LP  LIIHL RF    +++KNN  ++YP  L +T                 L  
Sbjct: 765 KITITRLPRNLIIHLKRF--DNMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPGVTELPT 822

Query: 766 KEKC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYF 822
           + +     +KLY V +H G L  GHYT+ ++K         ++ W YFDD   ++     
Sbjct: 823 RGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKG-------SQRGWCYFDDTNWRR----- 870

Query: 823 DLDKNVNRISSSDVYVLFYEKI 844
              ++ N   +S+ YVLFY ++
Sbjct: 871 --SRSDNECITSNAYVLFYHRV 890

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 118/440 (26%), Positives = 178/440 (40%), Gaps = 122/440 (27%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFHIL 498
           GL NLGN+CY+N ++QCL  T     +FL + YK ++      G+K  +  + S   H +
Sbjct: 496 GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTM 555

Query: 499 FRKMY-----LNGG--CAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELK 551
            ++        N G   AV P+ F   C  +    R    QQD QEF   LLD LH +L 
Sbjct: 556 QQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFRS-SSQQDCQEFCQFLLDGLHEDL- 613

Query: 552 SNQDRLVSEHPDLIEYDTDS--------MDVENANEYKKWFAESLENEGLSLIHEIFQGQ 603
            NQ      +P L E   ++        M + ++ E++++          S+I ++FQGQ
Sbjct: 614 -NQ---CGGNPALKELSEEAEGIREKLCMRIASSIEWERYLTTD-----FSVIVDLFQGQ 664

Query: 604 LENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWN 663
             + L C+ C  TST Y  F  LS+ +P+  +      D+ DC   F + E L  +  W+
Sbjct: 665 YASQLTCKVCGRTSTTYQPFSVLSVPVPSGSK-----CDIIDCFKEFTKVETLEKDEQWS 719

Query: 664 CPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKS 723
           CP+C                                                    + K 
Sbjct: 720 CPRCKCKQP-----------------------------------------------STKK 732

Query: 724 TSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT-----------------LKNK 766
            +  +LP  L+IHL RF    LL KNN  ++YP  L +T                 L  +
Sbjct: 733 ITITRLPRNLVIHLKRF--DNLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAELPTR 790

Query: 767 EKC---RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFD 823
            +     + LY V  HFG L  GHYTS ++K         +  W YFDD + ++      
Sbjct: 791 GQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRKA----- 838

Query: 824 LDKNVNRISSSDVYVLFYEK 843
             K+     +   YVLFY +
Sbjct: 839 --KSQGECITLSAYVLFYHR 856

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 249 IRSPNLIKFDPIELWNNRDQTPVLHRTSLFSNP-----LFQKIDLFSYIIIYSDNETTTA 303
           I++  ++  +PI   ++   T +  R SL ++P     LFQ+ D F YI+IY+D    T 
Sbjct: 194 IKTDKIMCIEPISFKDSYSDTEITRR-SLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQ 252

Query: 304 F 304
           F
Sbjct: 253 F 253

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 121/447 (27%), Positives = 176/447 (39%), Gaps = 134/447 (29%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVDPHLSNSFHILFR 500
           GL NLGN+CY+N ++QCL        +FL+N Y++++      G+K    L+N F  L +
Sbjct: 433 GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSK--GLLANYFSQLVQ 490

Query: 501 KMYLNG-----------GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNE 549
           KMY  G             AV P  F   C  +   L     QQD QEF   LLD LH +
Sbjct: 491 KMYQQGKLQAYNNTNMESTAVHPTQFKLACGSIN-SLFKGKQQQDCQEFCQFLLDGLHED 549

Query: 550 LKSNQDRLVSEHPDLIEY--------DTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           L  NQ      +P L E         +T  M + +A E++++          S+I ++FQ
Sbjct: 550 L--NQ---CGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTD-----FSVIVDLFQ 599

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENA 661
           GQ  + L C+ C +TST Y  F  LS+ +P  R        + DC   F + E L  +  
Sbjct: 600 GQYASQLRCKICAHTSTTYQAFSVLSVPVPRARS-----CTIYDCFKEFTKLETLEKDEL 654

Query: 662 WNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTR 721
           W CP C                                                    + 
Sbjct: 655 WYCPYCKQRQP-----------------------------------------------ST 667

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT------------------- 762
           K     +LPN LIIHL RF    +++KNN  + YP  L +T                   
Sbjct: 668 KQIIITRLPNNLIIHLKRF--DNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSL 725

Query: 763 --LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDD---ETVKQ 817
                K    ++L+ V +H G L  GHYTS ++K         R  W  FDD     +++
Sbjct: 726 PLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWRKIRR 777

Query: 818 QFNYFDLDKNVNRISSSDVYVLFYEKI 844
           +  Y           + + YVLFY ++
Sbjct: 778 KDEYI----------TPNAYVLFYRRV 794

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 122/465 (26%), Positives = 185/465 (39%), Gaps = 122/465 (26%)

Query: 430 LPHLPHSSN---LYVQLSI---SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRY---- 479
           LP LP ++N   +  +L +   +GL N+ N+CY+N ++QCL +T     L+L+N +    
Sbjct: 436 LPLLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQI 495

Query: 480 --KEYIGTKVDPHLSNSFHILFRKMYLNGGC---------AVIPVLFLKTCNFLRPDLRI 528
             +  +G+K    LS +F  L + MY               V P+ F   C  +   +  
Sbjct: 496 NVENKLGSKG--FLSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYA 552

Query: 529 PDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDT------DSMDVENANEYKK 582
              +QD QEF   LLD LH +L  NQ    S +P   E         +S+ +  A+E + 
Sbjct: 553 ESTEQDCQEFCEFLLDGLHEDL--NQ---CSGNPRPKELSANEAELRESLSMRIASEIE- 606

Query: 583 WFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVD 642
           W  ES      S I  +FQGQ  + L+C  C +TST Y  F  LS+ +P+      +  +
Sbjct: 607 W--ESFLTTNFSPIINLFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPSMVFSNGQTCN 664

Query: 643 LEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEY 702
           + DC   F + E L  +  W CPKC                                   
Sbjct: 665 ILDCFKEFTKCERLDNDEKWFCPKCRRKQ------------------------------- 693

Query: 703 NHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT 762
                           ++ K     +LP  LIIH  RF     ++KNN  + YP  L +T
Sbjct: 694 ----------------ISTKQLKITRLPKNLIIHFKRF--DNFMNKNNIFVQYPYQLDLT 735

Query: 763 ---------------------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLN 801
                                       ++KL  V  H GNL +GHYT+ ++K       
Sbjct: 736 SLWVNDYDGKLPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKG------ 789

Query: 802 PQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
              + WF FDD + +         K      + D Y+LFY++I E
Sbjct: 790 -LYRGWFRFDDASYRPV-------KFGTEFLTPDAYLLFYQRIYE 826

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 114/439 (25%), Positives = 171/439 (38%), Gaps = 112/439 (25%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTK--VDPHLSNSFH 496
           I GL N+ N+CY+N ++QCL +      + L+N + ++I      G+K  +  H +    
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 497 ILFRKMYLNGGCAVIPVLF---LKTCNFLRPDLRIPDV-----QQDTQEFLILLLDQLHN 548
            +  +    G       LF   +KT +F      +  +     QQD QEF   LLD LH 
Sbjct: 488 DMHSQQVKTGRS-----LFSYPVKTIDFKNACASVSSIYSGSQQQDCQEFCEFLLDGLHE 542

Query: 549 EL-KSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
           +L +   +    E  D  E   + + +  A+    W  E+  +   SLI ++F GQ  + 
Sbjct: 543 DLNQCGGNPPARELTDQEERLREGLCMRVASSMA-W--ENFLHNNFSLIIDLFAGQYGSQ 599

Query: 608 LECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKC 667
           L C  C YTST Y  F  LS+ +P   R  R    + DC   F + E L  +  W CP+C
Sbjct: 600 LRCCVCQYTSTTYQPFTLLSVPVPLSSRVSR--CSIIDCFQEFTKCERLDKDEEWFCPQC 657

Query: 668 XXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFI 727
                                                               + K     
Sbjct: 658 KRKQP-----------------------------------------------STKQLKIT 670

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTIT--------------------LKNKE 767
           +LP  LIIH  RF    +++KNN  I YP  L +T                     K  +
Sbjct: 671 RLPKNLIIHFKRF--DNMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGMTNSLLTKGGQ 728

Query: 768 KCRFK--LYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLD 825
              FK  L  V  H G L +GHYT+ +NK P  D+      W+YFDD + +       + 
Sbjct: 729 VGPFKYQLNAVACHMGTLGSGHYTAYVNKGP--DVG-----WYYFDDSSHR-------IV 774

Query: 826 KNVNRISSSDVYVLFYEKI 844
           K      + D Y+LFY ++
Sbjct: 775 KIATEYMNPDAYLLFYHRV 793

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score =  109 bits (273), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 111/430 (25%), Positives = 173/430 (40%), Gaps = 114/430 (26%)

Query: 435 HSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT-KVDPHLSN 493
           H  N      I G++N GN CY+N ++QCL     F N FL N    Y+GT  V+  L +
Sbjct: 333 HKPNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDN---AYLGTINVNSRLGH 389

Query: 494 SFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDV---------------QQDTQEF 538
                 + + +     +I   F  +   ++P + I +                Q D  EF
Sbjct: 390 ------QGLVVKNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYGKYQQHDCSEF 443

Query: 539 LILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEG-LSLIH 597
            + LL+++H +  SN  R   ++ D       +M V++  E     A +L  +G  S I 
Sbjct: 444 CLRLLEEIHED--SNWGR--PQNSDA------AMQVDDYRE-----AWNLYRKGNSSYIV 488

Query: 598 EIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLT 657
           + F+GQ+++ L CQ C   S NY  F  L+L IP        +  + DC+    +  +LT
Sbjct: 489 DTFKGQIKSQLTCQVCQTQSNNYEPFSILNLPIP-----LVSMCHIYDCMKELFKVHVLT 543

Query: 658 GENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXX 717
           G++ W C  C                        ++H+ L                    
Sbjct: 544 GDDRWYCSTC----------------------KTKTHSTL-------------------- 561

Query: 718 LVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNK--EKCR--FKL 773
                 T+   +P +LIIH +RF    LL+K    + YP +L ++  N    KC   +KL
Sbjct: 562 -----GTTITNVPEVLIIHFNRF--DNLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKL 614

Query: 774 YGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISS 833
             V  H G L +GHYT+   K   +        W++FDD   K   N            S
Sbjct: 615 VAVACHTGTLFSGHYTAYCFKNSENG-------WYHFDDTQCKPVSN--------GECIS 659

Query: 834 SDVYVLFYEK 843
              Y+LFY+K
Sbjct: 660 QSAYLLFYQK 669

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 95/195 (48%), Gaps = 15/195 (7%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIG----TKVDPHLSNSFHILFRKM 502
           GL NLGNTCY+NS LQCL      R+ F    YK  I          +++N+F  L + +
Sbjct: 399 GLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQNL 458

Query: 503 YLNG---GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVS 559
           Y N      +  P  F  T       +     QQD+QEFL  LLD LH +L   +D+   
Sbjct: 459 YKNQFIPSASYAPSQFKLTIGHYN-QMFSGYFQQDSQEFLAFLLDGLHEDLNRIKDKPYV 517

Query: 560 EHPDLIEYDTDSMDVENANEYKKWFAESLE---NEGLSLIHEIFQGQLENSLECQRCNYT 616
           E P L     D  DV + N   +  A++LE       S+I ++F G  +++L+C  CN+ 
Sbjct: 518 EKPSL----ADGSDVNDYNIIARLAADTLEAHLKRNDSIIIDLFVGLYKSTLKCPVCNHV 573

Query: 617 STNYSNFCTLSLSIP 631
           S  +  +C L+L IP
Sbjct: 574 SITFDPYCDLTLPIP 588

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 84/218 (38%), Gaps = 75/218 (34%)

Query: 634  RRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRS 693
            + K  K + LED ++LF   E+L   ++W CPKC                        + 
Sbjct: 955  QDKEEKNITLEDSLNLFERAEVLGINDSWYCPKC------------------------KH 990

Query: 694  HNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRFSMSGLL-DKN 749
            H                          R+++  I+L   P++L IHL RF   G   DK 
Sbjct: 991  H--------------------------RQASKQIQLWSTPDILTIHLKRFETQGSFSDKI 1024

Query: 750  NTDIAYPA---ILTITLKNKEKCRFKLYGVV---NHFGNLNNGHYTSLINKEPSHDLNPQ 803
            +  + +P     L+  + +K   +  +Y ++   NH+G L  GHYT+ I        N  
Sbjct: 1025 DDVVDFPINGLDLSKHILDKSTSQLNIYDLIAVDNHYGGLGGGHYTAYIK-------NLI 1077

Query: 804  RQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
              KW+YFDD  V +            R  +   Y+LFY
Sbjct: 1078 DNKWYYFDDSRVSETV--------PERSVAGSAYLLFY 1107

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 100/208 (48%), Gaps = 19/208 (9%)

Query: 438 NLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT----KVDPHLSN 493
           +L   L I+GL NLGNTCY+NS LQC+     FR  FL + Y++ + T        H++ 
Sbjct: 313 DLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAE 372

Query: 494 SFHILFRKMY---LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
           +F  L R ++   L    A  P  F  T       +    +QQD+QEFL  LLD LH +L
Sbjct: 373 AFSELIRCLFGDKLVQFSAYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDL 431

Query: 551 KSNQDRLVSEHPDLIEYDTDSMDVENANEYKK-----WFAESLENEGLSLIHEIFQGQLE 605
                +   E P L      + D+ +    KK     W A  L N+  S+I ++F G  +
Sbjct: 432 NRIDKKPYVEKPSL----PSTADLNDFRIVKKLADDTWKAHLLRND--SVITDLFVGLYK 485

Query: 606 NSLECQRCNYTSTNYSNFCTLSLSIPNK 633
           ++LEC  C   S  +  +  L+L +P K
Sbjct: 486 STLECPECQNISITFDPYNDLTLPLPVK 513

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 85/213 (39%), Gaps = 75/213 (35%)

Query: 639  KLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLT 698
            K + L DC++LF + E+L+  ++W CP C                        + H    
Sbjct: 894  KEITLNDCLNLFSKPEILSLNDSWYCPTC------------------------KEH---- 925

Query: 699  FSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDIA 754
                                  R++T  I+L   P++L+IHL RF +     DK +  + 
Sbjct: 926  ----------------------RQATKQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQ 963

Query: 755  YPAI---LTITLKNKEKCRFKLYGVV---NHFGNLNNGHYTSLINKEPSHDLNPQRQKWF 808
            +P     ++  L  K+  R  +Y ++   NH+G L  GHYT+          N    KW+
Sbjct: 964  FPITDFDISEHLVYKDDPRGNVYDLIAVDNHYGGLGGGHYTAYAK-------NSTDGKWY 1016

Query: 809  YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            YFDD  V +           N I+ +  Y+LFY
Sbjct: 1017 YFDDSRVTETVAE-------NSITGA-AYLLFY 1041

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 95/197 (48%), Gaps = 19/197 (9%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK----VDPHLSNSFHILFRKM 502
           GL NLGNTCY+NS LQCL      R+ FL   +++ I          H++ SF IL + +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNL 402

Query: 503 Y---LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVS 559
           +   L    +  P  F  T       +    +QQD+QEF+  LLD LH +L    ++ V 
Sbjct: 403 FKDELLPSLSYSPTTFKSTVGHFN-SMFSGYLQQDSQEFIAFLLDGLHEDLNRITNKPVV 461

Query: 560 EHPDLIEYDTDSMDVENANEYKK-----WFAESLENEGLSLIHEIFQGQLENSLECQRCN 614
           E P L   D    DV N    KK     W +  L N+  S+I +IF G  +++L C  C+
Sbjct: 462 EKPSLKPED----DVSNQEVIKKLADDTWNSHLLRND--SIITDIFVGLYKSTLHCPECD 515

Query: 615 YTSTNYSNFCTLSLSIP 631
             S  +  +  L+L +P
Sbjct: 516 NLSVTFDPYNDLTLPLP 532

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 89/225 (39%), Gaps = 71/225 (31%)

Query: 626  LSLSIPNKRRKF--RKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXX 683
            ++L    K+R+    K + L+DC++LF + E+L   ++W CP C                
Sbjct: 892  IALEDERKKRQMDGEKKITLDDCLNLFAKKEVLGMNDSWYCPTC---------------- 935

Query: 684  XXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRF-SM 742
                    + H   T                       K       P++L+IHL RF + 
Sbjct: 936  --------KEHRQAT-----------------------KQLQLWSTPDILLIHLKRFENQ 964

Query: 743  SGLLDKNNTDIAYPAI---LTITLKNKEKCRFKLYGVV---NHFGNLNNGHYTSLINKEP 796
            S   DK +  + +P     L+  + N ++ +  +Y +V   NH+G L  GHYT+ +    
Sbjct: 965  SSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLVSVDNHYGGLGGGHYTAYVK--- 1021

Query: 797  SHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
                N   +KW+YFDD  V +            R  +   Y+LFY
Sbjct: 1022 ----NFVDKKWYYFDDSRVTETV--------PERSIAGSAYLLFY 1054

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 100/200 (50%), Gaps = 24/200 (12%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT----KVDPHLSNSFHILFRKM 502
           GL NLGNTCY+NS LQCL      R+ F+ N +++ I          H++ SFH L + +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHGLIQSL 381

Query: 503 YLNGGCAVIPV-LFLKTCNFLRPDLRIPDV-----QQDTQEFLILLLDQLHNELKSNQDR 556
           +   G ++ P   ++   +F    +    +     QQD+QEFL  LLD LH +L    ++
Sbjct: 382 F---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQQQDSQEFLAFLLDSLHEDLNRIVEK 438

Query: 557 LVSEHPDLIEYDTDSMDVENANEYKK-----WFAESLENEGLSLIHEIFQGQLENSLECQ 611
              E P L   D    D+ + +  KK     W +  + N+  S+I +IF G  +++LEC 
Sbjct: 439 PYVEKPSLKPGD----DINDFDTIKKLANETWKSHLMRND--SIITDIFVGMYKSTLECP 492

Query: 612 RCNYTSTNYSNFCTLSLSIP 631
            C+  S  +  +  L+L +P
Sbjct: 493 ECSNVSITFDPYNDLTLPLP 512

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 82/209 (39%), Gaps = 75/209 (35%)

Query: 643  LEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEY 702
            L+DC++LF + E+L   ++W CP C                        + H        
Sbjct: 895  LKDCLNLFSKKEVLGMSDSWYCPNC------------------------KEH-------- 922

Query: 703  NHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDIAYPA- 757
                              R++T  I+L   P++ +IHL RF +     DK +  I +P  
Sbjct: 923  ------------------RQATKKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIE 964

Query: 758  --ILTITLKNKEKCRFKLYGVV---NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
               ++  L  K+  R  +Y ++   NH+G +  GHYT+ +        N   Q W+YFDD
Sbjct: 965  DLDMSEYLVYKDDPRGSVYDLIAVDNHYGGMGGGHYTAYVK-------NLTDQNWYYFDD 1017

Query: 813  ETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
              V +         +  +  +   Y+LFY
Sbjct: 1018 SRVSK--------TSPEKSIAGSAYLLFY 1038

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 105/215 (48%), Gaps = 27/215 (12%)

Query: 436 SSNLYV--QLSIS----GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP 489
           +SN Y+  Q++ S    GL NLGNTCY+NS LQCL     F++ FL N Y++ I    +P
Sbjct: 333 ASNYYIYNQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVD-NP 391

Query: 490 -----HLSNSFHILFRKMYL---NGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541
                H++ +F  L + ++    N   +  P  F  T   L   +     QQD+QEFL  
Sbjct: 392 LGHKGHIAWAFGTLIQSLFGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAF 450

Query: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKK-----WFAESLENEGLSLI 596
           LLD LH +L    D+   E P+L   D    DV      KK     W    L N+  S+I
Sbjct: 451 LLDGLHEDLNRIVDKPYVEKPELNPTD----DVTEFETIKKLADDTWLKHKLRND--SVI 504

Query: 597 HEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
            ++F G  +++L C  C   ST +  +  L+L +P
Sbjct: 505 LDLFVGLYKSTLICPTCKKVSTTFDPYNDLTLPLP 539

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 113/313 (36%), Gaps = 104/313 (33%)

Query: 565  IEYDTDSMDVENANEYKKWFAESLENEGLSLI----HEIFQGQLENSLECQRCNYTSTNY 620
            IE   D+ D++ A        ES E   L L+    ++I + +L  +     C + S +Y
Sbjct: 848  IEVSIDNQDLQKA--------ESSEEHSLDLVADTLNDIPREKLIKAQNAIICEWNSKSY 899

Query: 621  SNFCTLSLSI--------PN------KRRK---FRKLVDLEDCISLFIENEMLTGENAWN 663
                  SL +        PN      KR +     K + L DC++LF   E+L   ++W 
Sbjct: 900  DEVFNSSLKVNWDSPGEVPNTELEASKRERNAQEEKKITLHDCLTLFSTPEVLGATDSWY 959

Query: 664  CPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKS 723
            CP C                        + H                          R++
Sbjct: 960  CPSC------------------------KEH--------------------------RQA 969

Query: 724  TSFIKL---PNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLK-------NKEKCRFKL 773
            T  I+L   P++L+IHL RF           DI +  I  + +        +K+   + L
Sbjct: 970  TKQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDL 1029

Query: 774  YGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISS 833
              V NH+G L  GHYT+ +        N    KW+YFDD  V +            R  +
Sbjct: 1030 IAVDNHYGGLGGGHYTAYVK-------NFLDNKWYYFDDSRVNETV--------PERSIA 1074

Query: 834  SDVYVLFYEKIIE 846
               Y+LFY +  E
Sbjct: 1075 GSAYLLFYRRRTE 1087

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 98/200 (49%), Gaps = 20/200 (10%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP-----HLSNSFHILFR 500
           +GL NLGNTCY+NS LQCL      R+ FL N Y++ I  + +P     +++ +F  L +
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEE-NPLGYHGYVARAFSDLIQ 419

Query: 501 KMYLNG------GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQ 554
           K++ N         A  P +F  T       +    +QQD+QEFL  LLD LH +L    
Sbjct: 420 KLFQNKLNIMQRNGAFPPTMFKSTIGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNRII 478

Query: 555 DRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE---NEGLSLIHEIFQGQLENSLECQ 611
            +   E P L   D    DV + N  KK   ++ E       S+I ++F G  +++L C 
Sbjct: 479 KKAYIEKPSLSPDD----DVNDWNVIKKLADDTWELHLKRNRSVITDLFVGMYKSTLYCP 534

Query: 612 RCNYTSTNYSNFCTLSLSIP 631
            C   ST +  +  ++L +P
Sbjct: 535 ECKDVSTTFDPYNDVTLPLP 554

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 84/213 (39%), Gaps = 75/213 (35%)

Query: 639  KLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLT 698
            + + L DC+ LF + E+L   ++W CP C                        + H    
Sbjct: 959  RTITLNDCLQLFSKPEILGLNDSWYCPTC------------------------KEH---- 990

Query: 699  FSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDIA 754
                                  R++T  I+L   P++L+IHL RF S     DK +  + 
Sbjct: 991  ----------------------RQATKQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVN 1028

Query: 755  YPAI---LTITLKNKEKCR---FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWF 808
            +P     L+  +  K+  R   + LY V NH+G L  GHYT+ +        N    KW+
Sbjct: 1029 FPITDLDLSEHVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVK-------NFMDNKWY 1081

Query: 809  YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            YFDD  V +           N ++ S  Y+LFY
Sbjct: 1082 YFDDSRVTETVPE-------NSVAGS-AYLLFY 1106

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 102/213 (47%), Gaps = 17/213 (7%)

Query: 432 HLPHSSNLYVQLSIS----GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487
           H P +  +Y QL  S    GL NLGNTCY+NS LQCL     F++ FL N Y++ +  + 
Sbjct: 328 HWPSNFYVYNQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIE- 386

Query: 488 DP-----HLSNSFHILFRKMYLNGGCAVI---PVLFLKTCNFLRPDLRIPDVQQDTQEFL 539
           +P     H++ +F  + + ++     A     P  F  T   L   +     QQD+QEFL
Sbjct: 387 NPLGHKGHIAWAFASMVQALFGKRHSAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFL 445

Query: 540 ILLLDQLHNELKSNQDRLVSEHPDLIEY-DTDSMDVENANEYKKWFAESLENEGLSLIHE 598
             LLD LH +L    ++   E P+L    DT    V        W    L N+  S+I +
Sbjct: 446 AFLLDGLHEDLNRIIEKPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKLRND--SVITD 503

Query: 599 IFQGQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
           +F G  +++L C  C  TS  +  +  L+L +P
Sbjct: 504 LFVGLYKSTLICPVCKKTSVTFDPYNDLTLPLP 536

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 81/221 (36%), Gaps = 70/221 (31%)

Query: 633  KRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNR 692
            +R    K + L DC++LF   E+L   ++W CP C                        +
Sbjct: 954  RRASGEKKITLHDCLTLFSTPEVLGATDSWFCPNC------------------------K 989

Query: 693  SHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRF-SMSGLLDKNNT 751
             H   T                       K       P++L+IHL RF +     DK   
Sbjct: 990  EHRQAT-----------------------KQIELWNAPDILLIHLKRFENQRSFSDKIAD 1026

Query: 752  DIAYPAI-LTIT----LKNKEKCR-FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQ 805
             + +P   L +T     KN++K   + L  V NH+G L  GHYT+ +             
Sbjct: 1027 TVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGGLGGGHYTAYVKN--------IDG 1078

Query: 806  KWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
            KW+YFDD  V +            R  +   Y+LFY + +E
Sbjct: 1079 KWYYFDDSRVSETL--------PERSIAGSAYLLFYRRRVE 1111

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 93/196 (47%), Gaps = 11/196 (5%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK----VDPHLSNSFHILF 499
            I GL NLGN+CY+NS LQCL      R+ FL   +++ I T         ++ +F  L 
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 500 RKMYLNGGCAV---IPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDR 556
           + ++ +   A+    P  F K+       +    +QQD+QE L  LLD LH +L     +
Sbjct: 356 KSLFDDKASALQAFSPRAF-KSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMKK 414

Query: 557 LVSEHPDLIEY-DTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNY 615
              E P+L    D + +DV        W    L NE  S+I ++F G  +++L C  C+ 
Sbjct: 415 PFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNE--SVIVDLFVGLYKSTLTCPACDR 472

Query: 616 TSTNYSNFCTLSLSIP 631
            S  +  F  L+L +P
Sbjct: 473 VSVTFDPFSDLTLPLP 488

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 77/216 (35%), Gaps = 75/216 (34%)

Query: 641  VDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFS 700
            + L DC+ LF ++E+L   ++W CP C                        + H      
Sbjct: 872  ISLTDCLELFSKSEVLGAADSWYCPNC------------------------KEH------ 901

Query: 701  EYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRFSMSGLLDKNNTDIAYPA 757
                                R++T  I+L   P++L IHL RF          +D+    
Sbjct: 902  --------------------RQATKQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFP 941

Query: 758  ILTITLKNKEKCR-------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYF 810
            I  + +     C        + L  V NH+G L  GHYT+ +        N    KW+YF
Sbjct: 942  ITGLDMSEHLVCHDPNQNSMYDLIAVDNHYGGLGGGHYTAYVK-------NFMDGKWYYF 994

Query: 811  DDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
            DD  V +            R  S   Y+LFY + IE
Sbjct: 995  DDSRVSE--------TEAERAISGAAYLLFYRRRIE 1022

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 105/221 (47%), Gaps = 24/221 (10%)

Query: 429 GLPHLPHSSNLYVQL----SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIG 484
           G  H P +   Y +L      +GL NLGNTCY+NS LQCL      R+ FL + Y++ I 
Sbjct: 343 GNHHWPSNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEIN 402

Query: 485 TKVDP-----HLSNSFHILFRKMYLN------GGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533
            + +P     +++ +F  L +K++ N         A  P +F  T       +    +QQ
Sbjct: 403 EE-NPLGYHGYVARAFSDLVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFN-SMFSGYMQQ 460

Query: 534 DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE---N 590
           D+QEFL  LLD LH +L     +  +E P L   D    DV + N  KK   ++ E    
Sbjct: 461 DSQEFLAFLLDSLHEDLNRIIKKEYTEKPSLSPGD----DVNDWNVVKKLADDTWEMHLK 516

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
              S+I ++F G  +++L C  C   S  +  +  ++L +P
Sbjct: 517 RNCSVITDLFVGMYKSTLYCPECQNVSITFDPYNDVTLPLP 557

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 95/242 (39%), Gaps = 88/242 (36%)

Query: 619  NYSNFCTLSLSIPNKRRKFRKL---------VDLEDCISLFIENEMLTGENAWNCPKCXX 669
            N+ N  TL    PNK  +  KL         + L+DC+ LF + E+L   ++W CP C  
Sbjct: 935  NWENPATL----PNKELENAKLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTC-- 988

Query: 670  XXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL 729
                                  + H                          R++T  I+L
Sbjct: 989  ----------------------KEH--------------------------RQATKQIQL 1000

Query: 730  ---PNLLIIHLSRF-SMSGLLDKNNTDIAYPAI---LTITLKNKEKCR---FKLYGVVNH 779
               P++L+IHL RF S     DK +  + +P     L+  +  K+  R   + LY V NH
Sbjct: 1001 WNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLYAVDNH 1060

Query: 780  FGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVL 839
            +G L  GHYT+ +        N    KW+YFDD  V +           N I+ S  Y+L
Sbjct: 1061 YGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTET-------APENSIAGS-AYLL 1105

Query: 840  FY 841
            FY
Sbjct: 1106 FY 1107

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 97/205 (47%), Gaps = 27/205 (13%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT----KVDPHLSNSFHILF 499
            I+GL NLGNTCY+NS LQCL      R+ FL + +   I +        +++ +F +L 
Sbjct: 300 GITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSLLV 359

Query: 500 RKMYLNG-GCAVIPV-------LFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELK 551
           + ++    G A           + +  CN +        +QQD+QEFL  LLD LH +L 
Sbjct: 360 KSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGY----MQQDSQEFLAFLLDGLHEDLN 415

Query: 552 SNQDRLVSEHPDLIEYDTDSMDVENANEYKK-----WFAESLENEGLSLIHEIFQGQLEN 606
              D+   E P L    + + DV + +  KK     W    L N+  S++ ++F    E+
Sbjct: 416 RVHDKPYIEKPSL----SPNSDVTDRDTIKKLAEDTWKMHLLRND--SIVTDLFVALYES 469

Query: 607 SLECQRCNYTSTNYSNFCTLSLSIP 631
           +LEC  C   S  +  +  L+L +P
Sbjct: 470 TLECPECRNVSITFDPYNDLTLPLP 494

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 87/219 (39%), Gaps = 78/219 (35%)

Query: 638  RKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDL 697
            ++ + L DC+ LF + E+L+  ++W CP C                        + H   
Sbjct: 867  KRAISLHDCLKLFSKKEVLSMNDSWYCPTC------------------------KDH--- 899

Query: 698  TFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDI 753
                                   R++T  I+L   P++L+IHL RF +     DK +  +
Sbjct: 900  -----------------------RQATKQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTV 936

Query: 754  AYPAILTITL------KNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKW 807
             +P I ++ +      ++     + L  V NHFG L  GHYT+ +             KW
Sbjct: 937  HFP-IKSLDMTEHLVHEDPRGSIYDLIAVDNHFGGLGGGHYTAYVKT---------NDKW 986

Query: 808  FYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
            FYFDD  V +        K  + I+ S  Y+LFY +  E
Sbjct: 987  FYFDDSRVTET-------KPESSIAGS-AYLLFYLRRTE 1017

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 102/210 (48%), Gaps = 20/210 (9%)

Query: 439 LYVQLS----ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT----KVDPH 490
           +Y QL+    I+GL NLGNTCY+NS LQCL      R+ FL N +++ I          +
Sbjct: 282 MYNQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGY 341

Query: 491 LSNSFHILFRKMY----LNGGCAVIPVL----FLKTCNFLRPDLRIPDVQQDTQEFLILL 542
           ++ +F  L + ++    L+ G  + P      F  T       +    +QQD+QEF+  L
Sbjct: 342 VARAFSGLVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFL 400

Query: 543 LDQLHNELKSNQDRLVSEHPDL-IEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           LD LH +L    D+   E P L  E D++  +V        W      N+  S+I ++F 
Sbjct: 401 LDGLHEDLNRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRND--SVITDLFV 458

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
           G  E++L+C  CN  S  +  +  L+L +P
Sbjct: 459 GLYESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 87/219 (39%), Gaps = 75/219 (34%)

Query: 633  KRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNR 692
            ++++  K + L DC+ LF + E+L   ++W CP C                        +
Sbjct: 872  RQQEEEKKITLHDCLKLFSKREVLGMNDSWYCPSC------------------------K 907

Query: 693  SHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDK 748
             H                          R++T  I+L   P++L+IHL RF ++    DK
Sbjct: 908  EH--------------------------RQATKQIQLWDTPDVLLIHLKRFENLRSFSDK 941

Query: 749  NNTDIAYPAI---LTITLKNKEKCRFKLYGVV---NHFGNLNNGHYTSLINKEPSHDLNP 802
             +  + +P     ++  L NK   R  +Y +V   NH+G L  GHYT+          N 
Sbjct: 942  IDEVVHFPITGLDMSPYLVNKGDPRGTIYDLVAVDNHYGGLGGGHYTAYAK-------NV 994

Query: 803  QRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
               KW+YFDD  V +            R  +S  Y+LFY
Sbjct: 995  DDSKWYYFDDSRVTE--------TTPERGIASSAYLLFY 1025

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 100/196 (51%), Gaps = 11/196 (5%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK----VDPHLSNSFHILF 499
             +GL NLGN+CY+NS LQCL      ++ FL   Y+E + T+        ++ +F  L 
Sbjct: 332 GTTGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALI 391

Query: 500 RKMY---LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDR 556
           + ++    +   A  P  F K+    +  +    +QQD+QEFL  LLD LH +L    ++
Sbjct: 392 KSLFDERSSSAFAFSPREF-KSIIGQQNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEK 450

Query: 557 LVSEHPDL-IEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNY 615
              E P+L  + D ++ +V +    K W    L N+  S+I ++F G  +++L C  C+ 
Sbjct: 451 PFVEKPELSPDEDVNNREVIHRLASKTWDKHKLRND--SVILDLFVGLYKSTLTCPVCDK 508

Query: 616 TSTNYSNFCTLSLSIP 631
           TS  +  +  L+L +P
Sbjct: 509 TSVTFDPYSDLTLPLP 524

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 89/225 (39%), Gaps = 77/225 (34%)

Query: 633  KRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNR 692
            ++ +  + + L DC+ LF + E+L+  ++W CP C                        R
Sbjct: 895  RQHEGERRISLFDCLKLFSKPEVLSAADSWYCPTC------------------------R 930

Query: 693  SHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDK 748
             H                          R++T  I+L   P++L IHL RF S     DK
Sbjct: 931  EH--------------------------RQATKQIQLWNSPDILTIHLKRFESRHSFSDK 964

Query: 749  NNTDIAYPAILTITLKNKEKCR-------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLN 801
             +  + +P I  + + +   C        + L  V NH+G L  GHYT+          N
Sbjct: 965  ISDVVDFP-ICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGGLGGGHYTAFAK-------N 1016

Query: 802  PQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846
            P   KW+YFDD  V +     D + +V    S   Y+LFY + +E
Sbjct: 1017 PVDGKWYYFDDSRVSET----DPETSV----SGAAYLLFYRRRVE 1053

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 96/200 (48%), Gaps = 20/200 (10%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP-----HLSNSFHILFR 500
           +GL NLGNTCY+NS LQCL      R+ FL N Y+  I  + +P     +++ +F  L +
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEE-NPLGYHGYVARAFSDLVQ 422

Query: 501 KMYLNG------GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQ 554
           K++ N         A  P +F  T       +    +QQD+QEFL  LLD LH +L    
Sbjct: 423 KLFHNKLSSMQRNAAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNRII 481

Query: 555 DRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE---NEGLSLIHEIFQGQLENSLECQ 611
            +   E P L   D    DV + N  KK   ++ E       S+I ++F G  +++L C 
Sbjct: 482 KKAYIEKPSLSPDD----DVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGLYKSTLYCP 537

Query: 612 RCNYTSTNYSNFCTLSLSIP 631
            C   S  +  +  ++L +P
Sbjct: 538 ECKNVSITFDPYNDVTLPLP 557

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 87/213 (40%), Gaps = 75/213 (35%)

Query: 639  KLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLT 698
            +++ L+DC+ LF + E+L   ++W CP C                        + H    
Sbjct: 962  RIITLDDCLQLFSKPEILGLNDSWYCPTC------------------------KEH---- 993

Query: 699  FSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDIA 754
                                  R++T  I+L   P++L++HL RF S     DK +  + 
Sbjct: 994  ----------------------RQATKQIQLWNTPDILLVHLKRFESQRSFSDKIDATVN 1031

Query: 755  YPAI---LTITLKNKEKCR---FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWF 808
            +P     L+  + +K+  R   + LY V NH+G L  GHYT+ +        N    KW+
Sbjct: 1032 FPVTALDLSKHVVHKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVK-------NFADSKWY 1084

Query: 809  YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            YFDD  V +           N IS S  Y+LFY
Sbjct: 1085 YFDDSRVTETVPE-------NSISGS-AYLLFY 1109

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 97/200 (48%), Gaps = 20/200 (10%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP-----HLSNSFHILFR 500
           +GL NLGNTCY+NS LQCL      R+ FL + Y+  I  + +P     +++ +F  L +
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEE-NPLGYHGYVARAFSDLIQ 422

Query: 501 KMYLN------GGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQ 554
           K++ N         A  P +F  T       +    +QQD+QEFL  LLD LH +L    
Sbjct: 423 KIFQNRLSVMQRNGAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNRII 481

Query: 555 DRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE---NEGLSLIHEIFQGQLENSLECQ 611
            +   E P L   D    DV++ N  KK   ++ E       S+I ++F G  +++L C 
Sbjct: 482 KKEYIEKPSLSPGD----DVDDWNVVKKLADDTWEMHLKRNCSVITDLFVGMYKSTLYCP 537

Query: 612 RCNYTSTNYSNFCTLSLSIP 631
            C   S  +  +  ++L +P
Sbjct: 538 ECKNVSITFDPYNDVTLPLP 557

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 85/214 (39%), Gaps = 75/214 (35%)

Query: 638  RKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDL 697
             + + L+DC+ LF + E+L   ++W CP C                        + H   
Sbjct: 955  ERTITLDDCLQLFSKPEILGLSDSWYCPTC------------------------KEH--- 987

Query: 698  TFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDI 753
                                   R++T  I+L   P++L+IHL RF S     DK +  +
Sbjct: 988  -----------------------RQATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATV 1024

Query: 754  AYPAI---LTITLKNKEKCR---FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKW 807
             +P     L+  +  K+  R   + LY V NH+G L  GHYT+ +        N    KW
Sbjct: 1025 NFPITDLDLSKNVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVK-------NFANNKW 1077

Query: 808  FYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            +YFDD  V +           N I+ S  Y+LFY
Sbjct: 1078 YYFDDSRVTETVPE-------NSIAGS-AYLLFY 1103

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 94/202 (46%), Gaps = 11/202 (5%)

Query: 438 NLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT----KVDPHLSN 493
           NL       GL NLGNTCY+NS LQC+     FR+ FL   +++ +          +++ 
Sbjct: 322 NLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMAR 381

Query: 494 SFHILFRKMY---LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
           +F  L + ++   +    A  P  F  T       +    +QQD+QEFL  LLD LH +L
Sbjct: 382 AFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDL 440

Query: 551 KSNQDRLVSEHPDL-IEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
                +   E P L +  + +  DV        W A  L N+  S+I ++F    +++L+
Sbjct: 441 NRIDKKPYVEKPSLPLTANLNDFDVVKRLADDTWKAHLLRND--SVITDLFVAMYKSTLK 498

Query: 610 CQRCNYTSTNYSNFCTLSLSIP 631
           C  C  TS  +  +  L+L +P
Sbjct: 499 CPECQNTSVTFDPYNDLTLPLP 520

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 77/193 (39%), Gaps = 67/193 (34%)

Query: 633  KRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNR 692
            + ++  + + L+DC+ LF + E+L+  ++W CP C                        +
Sbjct: 931  RDKQEERHITLDDCLKLFSKPEILSSNDSWYCPHC------------------------K 966

Query: 693  SHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDK 748
             H                          R++T  I+L   P++L+IHL RF +     DK
Sbjct: 967  EH--------------------------RQATKQIELWNTPDILLIHLKRFENQRSFSDK 1000

Query: 749  NNTDIAYPAI---LTITLKNKEKCRFKLYGVV---NHFGNLNNGHYTSLINKEPSHDLNP 802
                + +P     ++  L  KE  R  +Y ++   NH+G L  GHYT+          N 
Sbjct: 1001 IVDTVFFPITDFDISEHLVYKEDPRGNVYDLIAVDNHYGGLGGGHYTAYAK-------NA 1053

Query: 803  QRQKWFYFDDETV 815
               KW+YFDD  V
Sbjct: 1054 NDNKWYYFDDSRV 1066

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 90/199 (45%), Gaps = 20/199 (10%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNR------------YKEYIGTKVDPHLSNS 494
           GL NLGNTCY+NS LQCL      R+ FL +             YK Y+       + N 
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQNL 383

Query: 495 FHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQ 554
           F     K   N      P  F  T       +    +QQD+QEFL  LLD LH +L    
Sbjct: 384 FGDTITKQGTNSSFG--PNHFKSTVGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDLNRII 440

Query: 555 DRLVSEHPDLIEYD--TDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQR 612
           ++  +E P L E D   D   +++  + + W    L N+  S+I ++F G  +++LEC  
Sbjct: 441 NKPSTEKPSLKEGDDYNDPAVIKSLAD-ETWKMHLLRND--SVITDLFVGMYKSTLECPE 497

Query: 613 CNYTSTNYSNFCTLSLSIP 631
           C   S  +  +  L+L +P
Sbjct: 498 CTNVSITFDPYSDLTLPLP 516

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 88/213 (41%), Gaps = 75/213 (35%)

Query: 639  KLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLT 698
            K + L DC++LF + E+L   ++W CP C                        + H    
Sbjct: 870  KEITLNDCLNLFSKREVLGLNDSWYCPHC------------------------KEH---- 901

Query: 699  FSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDIA 754
                                  R+++  I+L   P++L+IHL RF +     DK +  + 
Sbjct: 902  ----------------------RQASKRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVN 939

Query: 755  YPA---ILTITLKNKEKCR---FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWF 808
            +P     ++  L +K+  R   + LY V NH+G L  GHYT+ +        N    KW+
Sbjct: 940  FPIENLDMSPYLVHKDDPRGTVYDLYAVDNHYGGLGGGHYTAYVK-------NFIDNKWY 992

Query: 809  YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            YFDD  V +     D +K+V    S   Y+LFY
Sbjct: 993  YFDDSRVYET----DPEKSV----SGSAYLLFY 1017

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 140/380 (36%), Gaps = 117/380 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L        Y     +   ++S  +  ++ +   
Sbjct: 208 GFRNQGATCYLNSLLQSYFFTKYFRKLV-------YQIPTENESPNDSVPLALQRAFYQL 260

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + IP+  L+       D      Q D QE   +L+D+L N +K               
Sbjct: 261 QVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTP------------ 308

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    ++E+F G++++ ++C   +Y S+   +F  L
Sbjct: 309 -------VEGK------------------LNELFVGKMKSYIKCINVDYESSRVEDFWDL 343

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N       L  LE+    +IE E++ GEN +                        
Sbjct: 344 QLNVKN-------LKGLEESFKNYIEIELMNGENQY------------------------ 372

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                 +  D    +                    K   F   P +L + L RF      
Sbjct: 373 ------AAQDFGLQD------------------AEKGVIFESFPPILHLQLKRFEYDFNY 408

Query: 744 GLLDKNNTDIAYPAILTIT--------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKE 795
             L K N    +P  + ++         +NKE C++ L+GV+ H G+++ GHY ++I   
Sbjct: 409 DQLIKINDRYEFPESIDVSPYMDKKALRENKESCKYTLHGVLVHTGDISTGHYYAMIKP- 467

Query: 796 PSHDLNPQRQKWFYFDDETV 815
              DL  Q   W+ FDDE V
Sbjct: 468 ---DLQDQ---WYRFDDEKV 481

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 99/199 (49%), Gaps = 49/199 (24%)

Query: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQL---FEYFLKGNT--DSLDSFII 67
           S EL + V  IY + IKP+  QL   + IDLLE+T  L   F +FL      D+L ++I+
Sbjct: 16  STELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIV 75

Query: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL----- 122
           G +Y+ L+IP S    ++ N  Y ++Y D K  Y+++ N++++  ++R+E ++IL     
Sbjct: 76  GCYYLYLIIPQS-TQFQTKNKSY-SMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQ 133

Query: 123 ------------QSFDV--DAPSSHSQHE----EDNTA-------------------DSS 145
                       ++F V  D P  ++  E    E  ++                   D S
Sbjct: 134 EPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPMELDDS 193

Query: 146 TTIWQAPFLEPNDQLKLAI 164
           T +W AP L PNDQLKLA+
Sbjct: 194 TPLWTAPSLNPNDQLKLAL 212

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 70/156 (44%), Gaps = 7/156 (4%)

Query: 206 LKHLYEECFITPHELFSILSNPXXXXXXXXXXXXXXXYFNLQTIRSPNLIKFDPIELWNN 265
           L+ L ++  IT  ELFSILS+P                     I + N I  DP  LW+ 
Sbjct: 306 LERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDF 365

Query: 266 RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNXXXXXXXXXXXX 322
            +  P+   T L    ++ LF     F+Y++ Y+D +T     +F+YN            
Sbjct: 366 ENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKI-NFDYNFTLFYLLTSSRT 424

Query: 323 XVT---PNFLLGGFEKWEQLISSYSEQYGIETSNYI 355
            V    P  LLGG EKW+++I +Y  + GI   NY+
Sbjct: 425 SVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYL 460

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 94/401 (23%), Positives = 152/401 (37%), Gaps = 124/401 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G +N G TCY+NS+LQ  F T  FR L         I T +D   +NS  +  ++ +   
Sbjct: 204 GFKNQGATCYLNSLLQSYFFTKYFRRLVYE------IPTDMDSP-NNSVPLALQRAFYQL 256

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  L+       D      Q D QE   +L+D+L N +K        E P    
Sbjct: 257 QVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRMK--------ETP---- 304

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    ++E+F G++++ ++C   +Y S+   +F  L
Sbjct: 305 -------VEGK------------------LNELFVGKMKSYIKCINVDYESSRVEDFWDL 339

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N       L  LE+  S +IE E++ GEN +                        
Sbjct: 340 QLNVKN-------LKGLEESFSNYIEIELMNGENQY------------------------ 368

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                 +  D    +                    K   F   P +L + L RF      
Sbjct: 369 ------AAQDYGLQD------------------AEKGVIFESFPPVLHLQLKRFEYDFNY 404

Query: 744 GLLDKNNTDIAYPAILTIT---------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINK 794
             L K N    +P  + ++         L NKE C + L+GV+ H G+++ GHY ++I  
Sbjct: 405 DQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEACIYNLHGVLVHAGDISTGHYYTMIRP 464

Query: 795 EPSHDLNPQRQKWFYFDDETV-----KQQFNY-FDLDKNVN 829
             S        +W+ FDD+ V     KQ F+  F LD+ ++
Sbjct: 465 GVS-------DEWYRFDDDKVWRVTKKQAFDENFGLDRLID 498

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 95/206 (46%), Gaps = 17/206 (8%)

Query: 438 NLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT----KVDPHLSN 493
           N      I GL NLGNTCY+NS LQCL      R+ F    Y++ I        +  ++ 
Sbjct: 281 NPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVAT 340

Query: 494 SFHILFRKMY-----LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHN 548
           +F  L + +Y          +  P  F  T       +    +QQD+QEFL  LLD LH 
Sbjct: 341 AFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQAN-SMFAGYMQQDSQEFLAFLLDSLHE 399

Query: 549 ELKSNQDRLVSEHPDLIEYDTDSMDVENANEY---KKWFAESLENEGLSLIHEIFQGQLE 605
           +L    D+   E P L    ++ +  ENA +    K W A    N+  S+I+++F G  +
Sbjct: 400 DLNRIHDKPYIEKPTL--ETSEELADENAVKQLAKKTWDAHLARND--SVINDLFVGMYK 455

Query: 606 NSLECQRCNYTSTNYSNFCTLSLSIP 631
           ++L+C  C   S  +  +  L+L +P
Sbjct: 456 STLKCPTCKNISITFDPYNDLTLPLP 481

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 78/211 (36%), Gaps = 69/211 (32%)

Query: 640 LVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTF 699
           ++ L+ C+ LF + E+L   ++W CPKC                        + H   T 
Sbjct: 844 IITLDSCLKLFSKPEVLGINDSWYCPKC------------------------KEHRQAT- 878

Query: 700 SEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRF-SMSGLLDKNNTDIAYP-- 756
                                 K       P +L+IHL RF +     DK +  + +P  
Sbjct: 879 ----------------------KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIE 916

Query: 757 ----AILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
                   +    ++ C + L+ V NH+G L  GHYTS +        N    +W+YFDD
Sbjct: 917 GLDMTPYVVDSVVEDGCIYDLFAVDNHYGGLGGGHYTSYVK-------NNIDNRWYYFDD 969

Query: 813 ETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
             V       D  K+V    +   Y+LFY K
Sbjct: 970 SRVSST----DPKKSV----AGSAYLLFYCK 992

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 116/287 (40%), Gaps = 72/287 (25%)

Query: 570 DSMDVENANEYKKW----FAESLE--NEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNF 623
           DSM  ++A+E+  +    F++ L+  N+  + I+EIFQG L N + C  C+  ++    F
Sbjct: 405 DSMMHQDAHEFLNFMLNDFSDRLDRDNQAKNFINEIFQGTLTNKVRCLTCDNVTSREEAF 464

Query: 624 CTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXX 683
             L + +     K     D++  +  + + EML G N +NC +C                
Sbjct: 465 LDLPIEV-----KENGDTDIQRVLKYYSQREMLNGSNKFNCSQCCALQE----------- 508

Query: 684 XXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS 743
                                                 ++    KLP+ LI+HL RF  S
Sbjct: 509 ------------------------------------AERAVELKKLPDTLILHLKRFKYS 532

Query: 744 GLLDKNN---TDIAYPAILTI--TLKNKEKCRFKLYGVVNHFGNLNN-GHYTSLINKEPS 797
                N    + + YP IL +    K  +  +++L G+V H G+    GHY +L   E  
Sbjct: 533 EQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDGPQMGHYVALCKTE-- 590

Query: 798 HDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
                 +  W ++DDETV+       L    +  + S  YVLFY+K+
Sbjct: 591 ------KYGWLFYDDETVESVSEETVLKFIGDEKTQSTAYVLFYKKL 631

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFR 471
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 95/212 (44%), Gaps = 40/212 (18%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIG----TKVDPHLSNSF----HIL 498
           GL NLGNTCY+NS LQCL     F   FL N Y++ I          +++N+F    H L
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGKLIHKL 474

Query: 499 FRKMYLNGGC--------AVIPVLFLKT---CNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
           F +  ++           +  P  F  T   CN +        +QQD+QEFL  +LD LH
Sbjct: 475 FEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGY----LQQDSQEFLAFILDGLH 530

Query: 548 NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYK--------KWFAESLENEGLSLIHEI 599
            +L     +   E P L E         N  +YK         W A    N+  S++ ++
Sbjct: 531 EDLNRILKKPFVEKPSLPEN-------SNYKDYKVIKKLADDTWEAHLKRND--SIVTDL 581

Query: 600 FQGQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
           F G  +++L+C  C+  S  +  +  L+L +P
Sbjct: 582 FVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLP 613

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 85/214 (39%), Gaps = 75/214 (35%)

Query: 638  RKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDL 697
             K + L+DC+ LF + E+L  +++W CP C                        + H   
Sbjct: 1067 EKTILLDDCLRLFSKPEILGLQDSWYCPTC------------------------KDH--- 1099

Query: 698  TFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF-SMSGLLDKNNTDI 753
                                   R++T  I+L   P++L+IHL RF +     DK +  +
Sbjct: 1100 -----------------------RQATKQIELWNTPDILLIHLKRFENQRSFSDKIDAVV 1136

Query: 754  AYPAI---LT--ITLKNKEKCR-FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKW 807
             +P     LT  I   ++EK   + L  V NH+G L  GHYT+ +        N   QKW
Sbjct: 1137 NFPITDLDLTPHIVCTDQEKSNIYDLIAVDNHYGGLGGGHYTAYVK-------NFVDQKW 1189

Query: 808  FYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
            +YFDD  V           +  R  S   Y+LFY
Sbjct: 1190 YYFDDSRVSL--------ADPQRSISGSAYLLFY 1215

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 103/214 (48%), Gaps = 27/214 (12%)

Query: 439 LYVQLSIS----GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK----VDPH 490
           +Y +LS S    GL NLG+TC+INS+LQCL   T  R+ FL N +   + T+        
Sbjct: 340 VYNRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGR 399

Query: 491 LSNSFHILFRKMYLNGGCAVIPVL----FLKTCNFLRPDLRIPDVQQDTQEFLILLLDQL 546
           ++ +F  + + ++ +   A  P      F  T  + RP L  P VQQD+ E +  LL  L
Sbjct: 400 VAGAFAEVVQALFGD-KIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGAL 457

Query: 547 HNEL-KSNQDRLVSEHPDLIEYDTD---SMDVENANEYKK-----WFAESLENEGLSLIH 597
           H +L ++ +   V +  +          S    N    ++     W    L+N+  S+I 
Sbjct: 458 HEDLNRAPEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQND--SVIT 515

Query: 598 EIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
           ++F G L+++L C  C  +S  + + CT  L++P
Sbjct: 516 DLFAGMLKSTLTCLTCRRSSVTF-DPCT-ELAVP 547

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 84/224 (37%), Gaps = 92/224 (41%)

Query: 643  LEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEY 702
            LEDC+ LF   E+L   ++W CP C                                   
Sbjct: 935  LEDCLDLFTAPEVLNTADSWYCPACKKL-------------------------------- 962

Query: 703  NHNXXXXXXXXXXXXLVTRKSTSFIKL---PNLLIIHLSRF----SMSGLLDKNNTDIAY 755
                              R++T  I+L   P +L++HL RF    S +G L  NNT + +
Sbjct: 963  ------------------RQATRQIELWSTPEILLVHLKRFESHYSSTGKL--NNT-VHF 1001

Query: 756  PAILTITLKNKEKCR----------------FKLYGVVNHFGNLNNGHYTSLINKEPSHD 799
            P +  + +     CR                + L  V NHFG L +GHYT+ +       
Sbjct: 1002 P-LTGLDMSPHLPCRDGDGDGDGDDGGRENVYDLIAVDNHFGGLGSGHYTAYVK------ 1054

Query: 800  LNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
             NP   KW+ FDD  V++         +   ++SS  Y+LFY +
Sbjct: 1055 -NPVDDKWYLFDDSEVRE--------VDAESVASSFGYLLFYRR 1089

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 97/210 (46%), Gaps = 21/210 (10%)

Query: 435 HSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI------GTKVD 488
           H + L     I GL NLGNTCY+NS LQCL         FL   Y+  I      G K D
Sbjct: 328 HYNKLNAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGD 387

Query: 489 PHLSNSF-HILFRKMYLNGGCAVI--PVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQ 545
             ++++F H+L+     + G +    P  F  T       L     QQD+QEFL  LLD 
Sbjct: 388 --VAHAFGHLLYSLFAPSYGQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDG 444

Query: 546 LHNELKSNQDRLVSEHPDLIE----YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601
           LH +L    ++     P+        DTD + +  AN +     + ++    S+I ++F 
Sbjct: 445 LHEDLNRVIEKPYVNKPEFPNDGQIDDTDQIVLLAANMW-----DYIKKRNDSVIMDLFV 499

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIP 631
           G  +++L C  CN+ S  +  +  L+L +P
Sbjct: 500 GLYKSTLVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 83/228 (36%), Gaps = 73/228 (32%)

Query: 626  LSLSIPNKRRKF--RKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXX 683
            LSLS   K R    +  + L+ C+ LF + E+L   ++W CP C                
Sbjct: 885  LSLSEVRKTRAQTEKSSITLDSCLRLFSQPEILGSADSWYCPNC---------------- 928

Query: 684  XXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRF-SM 742
                    + H   +                       K       P++L+IHL RF + 
Sbjct: 929  --------KQHTQAS-----------------------KQIELWNTPDILLIHLKRFENQ 957

Query: 743  SGLLDKNNTDIAYPAILTITL-------KNKEKCRFKLYGVVNHFGNLNNGHYTSLINKE 795
                DK +  + +P I  + +       K  E   + L  V NH+G L  GHYT+     
Sbjct: 958  RSFSDKIDATVKFP-IEGLDMSPYLSYKKEGENDVYDLIAVDNHYGGLGGGHYTAYCR-- 1014

Query: 796  PSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
                 N    KW+YFDD  V +           N I+ S  Y+LFY +
Sbjct: 1015 -----NFIDGKWYYFDDSRVNEV-------SPENSIAGS-AYLLFYRR 1049

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/400 (21%), Positives = 150/400 (37%), Gaps = 123/400 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR+L        Y     D + ++S  +  ++ +   
Sbjct: 260 GFRNQGATCYLNSLLQSYFFTKYFRDLV-------YQIPTADENPNDSVALALQRAFYQL 312

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  L+       D      Q D QE   +L+D+L + +K               
Sbjct: 313 QVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMKGT------------- 359

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                               S+E +    + ++F G++++ ++C   +Y S+   +F  +
Sbjct: 360 --------------------SVEGK----LTDVFVGKMKSYIKCVNIDYESSRVEDFWDI 395

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++       + L  L +    +IE E++ GEN +                        
Sbjct: 396 QLNV-------KGLEGLANAFENYIEVELMDGENQY------------------------ 424

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                 +  D    +                   +K   F   P +L + L RF      
Sbjct: 425 ------AAQDYGLQD------------------AKKGVVFESFPEVLHLQLKRFEYDFNY 460

Query: 744 GLLDKNNTDIAYPAILTIT--------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKE 795
             L K N    +P  + ++         K K    + L+GV+ H G+++ GHY ++I  +
Sbjct: 461 DQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNNYNLHGVLVHTGDISTGHYYAMI--K 518

Query: 796 PSHDLNPQRQKWFYFDDETV----KQQFNYFDLDKNVNRI 831
           P+ D      KW+ FDDE V    K+Q   FD +  +NR+
Sbjct: 519 PTTD-----DKWYRFDDEKVWRVTKKQV--FDENFGLNRL 551

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 90/393 (22%), Positives = 139/393 (35%), Gaps = 119/393 (30%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI----GTKVDPHLSNSFHILF 499
            + GL N+G+TC+++S++Q +     F    LS+++        GTK    +S +   + 
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKC---VSCALDEIA 187

Query: 500 RKMYLNG-GCAVIPVLFLKTCNFLRPDLRI-----PDVQQDTQEFLILLLDQLHNELKSN 553
              Y NG G      +     N L     I        QQD  E+   LL+QLH +    
Sbjct: 188 CDFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHTD---- 243

Query: 554 QDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRC 613
                                     + + F  S   +   + H IFQG L+N+L+C +C
Sbjct: 244 --------------------------HARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQC 277

Query: 614 NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXX 673
            ++ T       LSL I N  +       LEDC+  F   E LT +  + C  C      
Sbjct: 278 GFSKTTIDPIMDLSLEIKNNPK-------LEDCLDHFQREETLT-DFHYECQSCKQNQGV 329

Query: 674 XXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLL 733
                                                           K  +  K PN+L
Sbjct: 330 V-----------------------------------------------KQLTLHKAPNVL 342

Query: 734 IIHLSRF--SMSGLLDKNNTDIAYPAILTITLKNK---------EKCRFKLYGVVNHFGN 782
           +I L RF   ++G   K N  + +P  L + LK               + L  VV+H G 
Sbjct: 343 VIQLKRFEHQLNGQSAKLNDRVQFP--LHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQGT 400

Query: 783 LNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           ++ GHYT++   E          +WF F+D  V
Sbjct: 401 VDQGHYTTVSKTEDG--------QWFKFNDSVV 425

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 94/404 (23%), Positives = 152/404 (37%), Gaps = 111/404 (27%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI--LFRK 501
            + GL N+G+TCY++S+LQCL     F +L +   +  Y   + DP    S  I  +  +
Sbjct: 135 GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQ-DPMKCMSCAIDNIISE 193

Query: 502 MYLNGGC----AVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRL 557
            Y N        ++ +L    C++          QQD  EFL  +L+Q+HN+ K N+   
Sbjct: 194 TYGNKKTTPNEGLVDIL---NCSWRVNKNLAGYTQQDAHEFLQFILNQMHNDYKLNEI-- 248

Query: 558 VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLI----HEIFQGQLENSLECQRC 613
                    +DT+  ++ N  ++K     +   E L L     H IFQG L++ + C  C
Sbjct: 249 ---------HDTNKQEM-NGTDFKTMVNGNSSKEHLHLCNCLPHTIFQGFLKSIISCSEC 298

Query: 614 NYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXX 672
              S T    +  LSL +  K         L +C+  F   E L  +  +NC KC     
Sbjct: 299 KAQSQTTIDPYMDLSLDVKGKST-------LYECLESFHRTERL-HDFTYNCKKC----- 345

Query: 673 XXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNL 732
                             N+S +                          +  S +KL  +
Sbjct: 346 ------------------NKSQD------------------------ANRQLSILKLAPI 363

Query: 733 LIIHLSRFS--MSGLLDKNNTDIAYPAILTI-------------------TLKNKEKCRF 771
           ++I L RF   ++G   K N  + +P  L +                   T K+     +
Sbjct: 364 MVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNEKTNKSTPDMIY 423

Query: 772 KLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           +L G+V H G +N GHY +                W+ F+D  V
Sbjct: 424 ELTGIVTHRGTVNEGHYITYTKTADG--------VWYQFNDSVV 459

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 88/397 (22%), Positives = 150/397 (37%), Gaps = 123/397 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L         I T  + + ++S  +  ++ +   
Sbjct: 205 GFRNQGATCYLNSLLQSYFFTKYFRKLVYG------IPTNGE-NPNDSVPLALQRAFYQL 257

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  L+       D      Q D QE   +L+D+L N +K               
Sbjct: 258 QVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKGT------------- 304

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                 +VE                    ++EIF G++++ + C+  +Y S+   +F  +
Sbjct: 305 ------NVEGK------------------LNEIFVGKMKSYIRCKNVDYESSRVEDFWDI 340

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N +        L++    +IE E++ GEN +  P                     
Sbjct: 341 QLNVKNFK-------SLQESFENYIEVELMNGENQYAAP--------------------- 372

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                    D    +                    K   F   P +L + L RF      
Sbjct: 373 ---------DFGLQD------------------AYKGVVFESFPAVLHLQLKRFEYDFNY 405

Query: 744 GLLDKNNTDIAYPAILTIT-LKNKEKCR-------FKLYGVVNHFGNLNNGHYTSLINKE 795
             L K N    +P  + +    +KE  +       +KL+GV+ H G+++ GHY ++I  +
Sbjct: 406 DQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKNYKLHGVLVHTGDISTGHYYAMI--K 463

Query: 796 PSHDLNPQRQKWFYFDDETV-----KQQFNY-FDLDK 826
           P+ +      +W+ FDDE V     KQ F+  F LD+
Sbjct: 464 PTLE-----DQWYRFDDEKVWKVDKKQVFDENFGLDR 495

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 93/412 (22%), Positives = 152/412 (36%), Gaps = 123/412 (29%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L     YK  I T+ +   ++S  +  ++ +   
Sbjct: 202 GFRNQGATCYLNSLLQSYFFTKYFRKLV----YK--IPTESETP-NSSVPLALQRAFYQL 254

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + IP+  L+       D      Q D QE   +L+D+L N +                
Sbjct: 255 QVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM---------------- 298

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                                +E +    + E+F G++++ ++C    Y S+   +F  L
Sbjct: 299 -----------------LGTPVEGK----LSELFVGKMKSYIKCVNVEYESSRVEDFWDL 337

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N       L  L+D    +IE E++ GEN +                        
Sbjct: 338 QLNVKN-------LKCLKDSFENYIEIELMNGENQY------------------------ 366

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746
                 +  D    +                    K   F   P +L + L RF      
Sbjct: 367 ------AAQDFGLQD------------------AEKGVIFESFPPILHLQLKRFEYDFNF 402

Query: 747 D---KNNTDIAYPAILTIT--------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKE 795
           D   K N    +P     +          N E C + L+GV+ H G+++ GHY ++I   
Sbjct: 403 DQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCIYNLHGVLVHTGDISTGHYYAMIKP- 461

Query: 796 PSHDLNPQRQKWFYFDDETV----KQQFNYFDLDKNVNRISSSDVYVLFYEK 843
              DL  Q   W+ FDDE V    K+Q   F+ +  ++R S  D+  +  E+
Sbjct: 462 ---DLEDQ---WYRFDDEKVWKVTKKQV--FEENFGLDRRSEDDLKCMTREQ 505

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/367 (23%), Positives = 136/367 (37%), Gaps = 102/367 (27%)

Query: 491 LSNSFHILFRKMYLNGGCAVIPVLF---LKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
           L + F  +    YL G   V P  F   LK  N L   +    + QD  EFLI LL+++ 
Sbjct: 400 LKDIFECITEHSYLTG--VVTPSAFIEMLKRENVLFSSM----MHQDAHEFLIFLLNEIS 453

Query: 548 NEL-KSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLEN 606
           + L K N++ L S+  D  +   +S  V+N                   + +IFQG L N
Sbjct: 454 DFLDKQNKNALNSKIYDSSQGRRNSGTVKN------------------FVSDIFQGTLTN 495

Query: 607 SLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPK 666
            ++C  C+ T+     F    + +     +    +D+++ +  F + EML G N + C +
Sbjct: 496 RIKCLTCDNTTARDEPFLDFPIEV-----QENVDIDIQEILESFHQKEMLHGPNKFYCDE 550

Query: 667 CXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSF 726
           C                                                      +    
Sbjct: 551 CCGLQE-----------------------------------------------AERVVGL 563

Query: 727 IKLPNLLIIHLSRFSMS-------GLLDKNNTDIAYPAILTI--TLKNKEKCRFKLYGVV 777
            +LP  L +HL RF  S        L DK    ++YP  L +  T        ++L G+V
Sbjct: 564 KQLPKTLALHLKRFKYSEQQNSNIKLFDK----VSYPLDLKVSSTFNPSISKNYELSGIV 619

Query: 778 NHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDV 836
            H G    +GHY SL   E        +  W  FDDETV+       L    ++ + +  
Sbjct: 620 VHMGGGPQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKDTMTTA 671

Query: 837 YVLFYEK 843
           YVLFY++
Sbjct: 672 YVLFYQE 678

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYL 504
           I G  N GNTCY NS+LQCL+    FRN  L  RY   +G    P    S     RK+ +
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRNDML--RYP--LG---QPKSGKS-----RKLEM 196

Query: 505 NGGCAVIPVLFLKTCNFLRPDLRIP 529
            G   + P +FL      RP   +P
Sbjct: 197 PG---LKPRMFLPEHFEPRPTQEVP 218

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/377 (23%), Positives = 141/377 (37%), Gaps = 109/377 (28%)

Query: 486 KVDPH-----LSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLI 540
           K  PH     L +    +    YL+G   V P  F+K      P L    +QQD  EFL 
Sbjct: 368 KDQPHFLYYALKDIMECITENRYLSG--VVSPAEFVKLLKRQNP-LFNSTMQQDAHEFLN 424

Query: 541 LLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEI- 599
            LL+ +                            + A +YK  + +S   E   + H+  
Sbjct: 425 FLLNNIS---------------------------DFAGKYKSNYLKSSNEEECEISHDFV 457

Query: 600 ---FQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEML 656
              F+G L N ++C  C+  S N   F    + I N      + ++++D    F + E+L
Sbjct: 458 KDQFEGVLLNRIKCLTCDCVSANEEPFLDFPIEIQND-----EAINIQDTFRSFYQREIL 512

Query: 657 TGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXX 716
            G N + C +C                                                 
Sbjct: 513 CGPNKFYCNECCGLQE-------------------------------------------- 528

Query: 717 XLVTRKSTSFIKLPNLLIIHLSRFSMSGLLD-KNNTDIAYPAILTI-TLKNKEKCR-FKL 773
                K+  F KLP  L +HL RF   G+++ K    I YP  LT+ +  +   C+ ++L
Sbjct: 529 ---AEKTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYEL 585

Query: 774 YGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVK---QQFNYFDLDKNVN 829
            GVV H G +  +GHY S+   E        +  W  +DDET++   ++     + +  N
Sbjct: 586 TGVVLHVGASPTHGHYVSICKHE--------KYGWLMYDDETIESIPEEAVTSHVGEPNN 637

Query: 830 RISSSDVYVLFYEKIIE 846
            I++   YVLFY + I+
Sbjct: 638 PITA---YVLFYSEKIQ 651

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLS--NRYKEYIGTKVDPHLSNSFHILFRKMYL 504
           G  N G+TCY NS+LQC++    FR   L    RY      +V+      FH L  + Y+
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRYPLKSRVRVE-----EFHSLHERNYI 176

Query: 505 N 505
           N
Sbjct: 177 N 177

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 142/387 (36%), Gaps = 124/387 (32%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L         I T+ +   +NS  +  ++ +   
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFRKLVYE------IPTEHESP-NNSVPLALQRAFYQL 258

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + IP+  ++       D      Q D QE   +L+D+L N +K               
Sbjct: 259 QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP------------ 306

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    + EIF G++++ ++C   +Y S    +F  L
Sbjct: 307 -------VEGK------------------LSEIFVGKMKSYIKCVNVDYESARVEDFWDL 341

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N +       +L++    +IE E++ GEN +                        
Sbjct: 342 QLNVKNFK-------NLQESFDNYIEMELMNGENQY------------------------ 370

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746
                 +  D    +                   +K   F   P +L + L RF      
Sbjct: 371 ------AAQDYGLQD------------------AQKGVIFESFPPVLHLQLKRFEYDFNY 406

Query: 747 D---KNNTDIAYPA-----------ILTITLKNKEKCR----FKLYGVVNHFGNLNNGHY 788
           D   K N    +P            +L  +L + +K R    + L+GV+ H G+++ GHY
Sbjct: 407 DQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGDKSRNPYVYNLHGVLVHSGDISTGHY 466

Query: 789 TSLINKEPSHDLNPQRQKWFYFDDETV 815
            +LI  +P  +      +W+ FDDE V
Sbjct: 467 YTLI--KPGVE-----DQWYRFDDERV 486

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 82/382 (21%), Positives = 137/382 (35%), Gaps = 117/382 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           GL+N G TCY+NS+LQ  + T  FR L        +I T  +   SNS  +  ++ +   
Sbjct: 200 GLKNQGATCYLNSLLQSYYFTKYFRKLVY------HIPTDGETP-SNSVPLALQRAFYKL 252

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+   +       D      Q D QE   +L+D+L N++K+              
Sbjct: 253 QRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKAT------------- 299

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                                 E EG   ++EIF G++++ ++C    Y S+   +F  +
Sbjct: 300 ----------------------EVEG--KLNEIFVGKMKSYIKCVNVEYESSRVEDFWDI 335

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++       + L  L      +IE EM+ GEN +   +                    
Sbjct: 336 QLNV-------KGLNGLNQAFENYIEVEMMDGENQYAAQRYGLQD--------------- 373

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                                             +K   F   P +L + L RF      
Sbjct: 374 ---------------------------------AKKGVVFESFPPVLHLQLKRFEYDFNY 400

Query: 744 GLLDKNNTDIAYPAILTIT--------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKE 795
             L K N    +P  + ++            E   + L+GV+ H G+++ GHY ++I  +
Sbjct: 401 DQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMMYNLHGVLVHTGDISTGHYYAMI--K 458

Query: 796 PSHDLNPQRQKWFYFDDETVKQ 817
           P  D      KW+ FDD+ V Q
Sbjct: 459 PGLD-----DKWYRFDDDKVWQ 475

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 90/400 (22%), Positives = 152/400 (38%), Gaps = 115/400 (28%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV-DPHLSNSFHILFRKM 502
            +SGL N+G+TC+++S+LQCL     F    +S  +      +  D   S +   +  ++
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHEL 194

Query: 503 Y--LNGGCAV---------IPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELK 551
           Y  LN   A             ++L TC +          QQD  EF   +++Q+H    
Sbjct: 195 YGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSY- 253

Query: 552 SNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQ 611
                               +D+ NA E  +   +  E     ++H +F+G LE+S+ C 
Sbjct: 254 -------------------VLDLPNAKEVSRANNKQCE----CIVHTVFEGSLESSIVCP 290

Query: 612 RC-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXX 670
            C N + T    F  LSL I +K++       L +C+  F + E L   N ++C +C   
Sbjct: 291 GCQNNSKTTIDPFLDLSLDIKDKKK-------LYECLDSFHKKEQLKDFN-YHCGEC--- 339

Query: 671 XXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLP 730
                               N + + +                        K     KLP
Sbjct: 340 --------------------NSTQDAI------------------------KQLGIHKLP 355

Query: 731 NLLIIHLSRFS--MSGLLDKNNTDIAYPAILTIT--LKNKEKCR-----------FKLYG 775
           ++L++ L RF   ++G   K +  I +P  L +      KEK +           ++L G
Sbjct: 356 SVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIG 415

Query: 776 VVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           +V+H G +N GHY +               +WF F+D  V
Sbjct: 416 IVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMV 447

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/391 (21%), Positives = 146/391 (37%), Gaps = 97/391 (24%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRY--KEYIGTKVDPHLSNSFHILFRK 501
            +SGL N+G+TC+++S+LQCL     F    +S  +  K  +G+  D   S +   + ++
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGSP-DKCFSCALDKIIQE 193

Query: 502 MYLNGGCAVI----------------PVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQ 545
           +Y      V+                  ++L TC +          QQD  EF   +++Q
Sbjct: 194 LY-----GVLNTDQPSPSSSATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQ 248

Query: 546 LHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLE 605
           +H                       + D  NA E  +   +  E     ++H +F+G LE
Sbjct: 249 IHQSY--------------------THDSPNAKEIDRVNNKRCE----CIVHSVFEGSLE 284

Query: 606 NSLECQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
           +S+ C  C   S T    F  LSL I +K++       L +C+  F + E L   N ++C
Sbjct: 285 SSIVCPGCQKNSKTTIDPFMDLSLDIKDKKK-------LYECLDSFHKKEQLKDFN-YHC 336

Query: 665 PKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKST 724
            +C                        R  + L  S                    RK  
Sbjct: 337 GECNSTQDAIKQLGIHRLPSVLVLQLKRFEHLLNGS-------------------NRKLD 377

Query: 725 SFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLN 784
            FI+ P  L  ++  +  +G  +K+  +   P I+           ++L G+V+H G +N
Sbjct: 378 DFIEFPTYL--NMKSYCSTGESEKHTGNGKVPDII-----------YELIGIVSHRGTVN 424

Query: 785 NGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
            GHY +               +WF F+D  V
Sbjct: 425 EGHYIAFCKISGG--------QWFKFNDSVV 447

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 140/371 (37%), Gaps = 92/371 (24%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L         I T+ +   +NS  +  ++ +   
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFRKLVYE------IPTEHESP-NNSVPLALQRAFYQL 258

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + IP+  L+       D      Q D QE   +L+D+L N +K               
Sbjct: 259 QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP------------ 306

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    ++EIF G++++ ++C   +Y S    +F  L
Sbjct: 307 -------VEGK------------------LNEIFVGKMKSYIKCINVDYESARVEDFWDL 341

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N +       +L++    +IE E++ GEN +                        
Sbjct: 342 QLNVKNFK-------NLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGVIFESFPPVL- 393

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746
                  H  L   EY+ N                K     + P    I LS F    +L
Sbjct: 394 -------HLQLKRFEYDFNYDQMV-----------KVNDKYEFPE--TIDLSPFVDKDVL 433

Query: 747 DKNNTDIAYPAILTITLKNKEK--CRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQR 804
            K           T+  +NK+K    + L+GV+ H G+++ GHY +LI  +P  +     
Sbjct: 434 KK-----------TLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLI--KPGVE----- 475

Query: 805 QKWFYFDDETV 815
            +W+ FDDE V
Sbjct: 476 DQWYRFDDERV 486

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 141/387 (36%), Gaps = 124/387 (32%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L         I T+ +   +NS  +  ++ +   
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFRKLVYE------IPTEHESP-NNSVPLALQRAFYQL 258

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + IP+  ++       D      Q D QE   +L+D+L N +K               
Sbjct: 259 QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP------------ 306

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    ++EIF G++++ ++C   +Y S    +F  L
Sbjct: 307 -------VEGK------------------LNEIFVGKMKSYIKCINVDYESARVEDFWDL 341

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N         +L+     +IE E++ GEN +                        
Sbjct: 342 QLNVKN-------FENLQGSFDNYIEMELMNGENQY------------------------ 370

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746
                 +  D    +                   +K   F   P +L + L RF      
Sbjct: 371 ------AAQDYGLQD------------------AQKGVIFESFPPVLHLQLKRFEYDFNY 406

Query: 747 D---KNNTDIAYPA-----------ILTITLKNKEKCR----FKLYGVVNHFGNLNNGHY 788
           D   K N    +P            +L  TL + +K +    + L+GV+ H G+++ GHY
Sbjct: 407 DQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGDKDKNPYIYNLHGVLVHSGDISTGHY 466

Query: 789 TSLINKEPSHDLNPQRQKWFYFDDETV 815
            +LI  +P  +      +W+ FDDE V
Sbjct: 467 YTLI--KPGVE-----DQWYRFDDERV 486

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/380 (21%), Positives = 139/380 (36%), Gaps = 117/380 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  + T  FR L         I T+ + + ++S  +  ++ +   
Sbjct: 204 GFRNQGATCYLNSLLQSYYFTKYFRRLVYQ------IPTEGE-NPNDSVTLALQRAFYQL 256

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  ++       D      Q D QE   +L+D+L   +K               
Sbjct: 257 QVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRMKGT------------- 303

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                               S+E +    I+E+F G++++ + C   +Y S    +F  +
Sbjct: 304 --------------------SVEGK----INELFVGKMKSYIRCINVDYQSVRTEDFWDI 339

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++ N R       DL+     +IE E++ GEN                          
Sbjct: 340 QLNVKNMR-------DLQTSFENYIEVELMDGENQ------------------------- 367

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                       ++   H                +K   F   P +L + L RF      
Sbjct: 368 ------------YAAQGHGLQD-----------AKKGVVFESFPPVLHLQLKRFEYDFNY 404

Query: 744 GLLDKNNTDIAYPAILTITL--------KNKEKCRFKLYGVVNHFGNLNNGHYTSLINKE 795
             L K N    +P  + +          +N     +KL+GV+ H G+++ GHY +LI  +
Sbjct: 405 DQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKIYKLHGVLVHTGDISTGHYYTLI--K 462

Query: 796 PSHDLNPQRQKWFYFDDETV 815
           PS      + +W+ FDD+ V
Sbjct: 463 PS-----TKDEWYRFDDDRV 477

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 92/398 (23%), Positives = 145/398 (36%), Gaps = 119/398 (29%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAF-RNLFLSNRYKEYIGTKVDPHLSNSFHILFRKM 502
            +SGL N+G+TCY++ ++QCL     F ++ F    YKE         LS +   +  ++
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDPVSCLSCALDSVVFEL 194

Query: 503 Y----------LNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKS 552
           Y           NGG  +I +L    C +   +  +   QQD  EF   L++++H+E K 
Sbjct: 195 YGKTQKKAVDDKNGG--LIDIL---NCTWKINEDLVGYSQQDAHEFWQFLMNRIHSEYKL 249

Query: 553 NQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQR 612
           N +         IE   D+  + N                  + H++FQG LE+++EC  
Sbjct: 250 NNNT--------IEVPKDTHQLCNC-----------------IYHKVFQGFLESTIECAN 284

Query: 613 CNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXX 671
           C   S T    +  LSL + +K+        L +C++ F   E L               
Sbjct: 285 CRKESKTTTEAYMDLSLDLKDKKT-------LYECLNSFHMKEEL--------------- 322

Query: 672 XXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPN 731
                                   D TF   N                  K  +  KLP 
Sbjct: 323 -----------------------KDFTFHCSNCGGPQG----------ALKQLTISKLPP 349

Query: 732 LLIIHLSRF--SMSGLLDKNNTDIAYPAIL------------TITLKNKEKCRFKLYGVV 777
           +L++ L RF   ++G   K N  I YP  L            TI   +     ++L GV+
Sbjct: 350 VLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPDDSDIIYELIGVI 409

Query: 778 NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
            H G +N GHY                 +W  F+D  +
Sbjct: 410 CHTGTVNEGHYIC--------SCKLANNQWVKFNDSMI 439

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 84/386 (21%), Positives = 142/386 (36%), Gaps = 123/386 (31%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L         I T+ +   +NS  +  ++ +   
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFRKLVYE------IPTEHESP-NNSVPLALQRAFYQL 258

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + IP+  L+       D      Q D QE   +L+D+L N +K               
Sbjct: 259 QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP------------ 306

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    ++EIF G++++ ++C   +Y S+   +F  L
Sbjct: 307 -------VEGK------------------LNEIFVGRMKSYIKCINVDYESSRVEDFWDL 341

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            +++ N +       +L++    +IE E++ GEN +                        
Sbjct: 342 QMNVKNFK-------NLQESFDNYIEMELMNGENQY------------------------ 370

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746
                 +  D    +                   +K   F   P +L + L RF      
Sbjct: 371 ------AAQDYGLQD------------------AQKGVIFESFPPVLHLQLKRFEYDFNY 406

Query: 747 D---KNNTDIAYPA-----------ILTITLKNKEKCR---FKLYGVVNHFGNLNNGHYT 789
           D   K N    +P            +L  TL + +      + L+GV+ H G+++ GHY 
Sbjct: 407 DQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGDNGNPYIYNLHGVLVHSGDISTGHYY 466

Query: 790 SLINKEPSHDLNPQRQKWFYFDDETV 815
           +LI  +P  +      +W+ FDDE V
Sbjct: 467 TLI--KPGVE-----DQWYRFDDERV 485

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 94/398 (23%), Positives = 151/398 (37%), Gaps = 119/398 (29%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPH--LSNSFHILFRK 501
            + GL NLG+TC+++S+LQ L     F N  +S  + +    + DP   +S +   +  +
Sbjct: 135 GLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSHSKKCPIQ-DPKSCISCALEKMVCE 193

Query: 502 MYLNGGCAVIPV---------LFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKS 552
            Y +   +   V         + L  C++   +      QQD  EF   LL+QLH++ + 
Sbjct: 194 FYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGYSQQDAHEFWQFLLNQLHHDFQV 253

Query: 553 NQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQR 612
              + V+   D I  D  +                       + H  FQG L++S+ C  
Sbjct: 254 CSGKGVN---DAISDDLCT----------------------CIAHSTFQGLLKSSIVCPD 288

Query: 613 C-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXX 671
           C N + T    F  LSL I +K        +L +C+  F + E L   N ++CP C    
Sbjct: 289 CQNDSKTTIDPFMDLSLDIKDKS-------NLYNCLDSFHKKERLHDFN-YHCPNC---- 336

Query: 672 XXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPN 731
                              N S + +                        K  S  KLP+
Sbjct: 337 -------------------NTSQDAI------------------------KRLSIYKLPS 353

Query: 732 LLIIHLSRFS--MSGLLDKNNTDIAYPAILTITLKNKEKCR------------FKLYGVV 777
           +L++ L RF   ++G   K N  I YP  L +    ++ C             ++L GVV
Sbjct: 354 VLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNM----RDYCSSGDSDVDVPDLIYELIGVV 409

Query: 778 NHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
            H G +N GHY +              ++WF F+D  V
Sbjct: 410 AHKGTVNEGHYVATT--------KVAGRQWFKFNDSMV 439

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 112/324 (34%), Gaps = 102/324 (31%)

Query: 531 VQQDTQEFLILLL----DQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAE 586
           + QD  EFL  LL    D L+N  KS +D                               
Sbjct: 493 MHQDAHEFLNFLLNELSDYLNNGAKSGKDD------------------------------ 522

Query: 587 SLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDC 646
             E   L+ I +IFQG L N ++C  C+  ++    F    + +P+         D++  
Sbjct: 523 --EEHSLNFIKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDSE-----TDIQAL 575

Query: 647 ISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNX 706
           +  F + EML+G N + C  C                                       
Sbjct: 576 LQNFDQREMLSGPNKFYCNVCCGLQE---------------------------------- 601

Query: 707 XXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI-- 761
                          +S    +LP+ L +HL RF  S   + N      + YP  L +  
Sbjct: 602 -------------AERSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCS 648

Query: 762 TLKNKEKCRFKLYGVVNHFGN-LNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFN 820
           T  N    +++L G+V H G    +GHY SL   +           W  FDDETV+    
Sbjct: 649 TYSNSVCKKYELSGIVVHMGGGPQHGHYVSLCKND--------NFGWLLFDDETVESVSE 700

Query: 821 YFDLDKNVNRISSSDVYVLFYEKI 844
              LD   +  + +  YVLFY ++
Sbjct: 701 KTVLDFVGDSSTLTTAYVLFYREL 724

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           G  N GNTCY NS+LQCL+  T FR
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFR 156

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 139/372 (37%), Gaps = 111/372 (29%)

Query: 483 IGTKVDPHLSNSFHILFRKMYLNGG--CAVIPVLFLKTCNFLRPD--LRIPDVQQDTQEF 538
           +     P+L N+   +F  +  N      V P LF+KT   L+ +  L    +QQD  EF
Sbjct: 407 VAVTAKPNLYNTLKEIFECITENENYTGVVSPTLFVKT---LKKENVLFNTQMQQDAHEF 463

Query: 539 LILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHE 598
           L  LL+ L                               N+Y       L++ G + I  
Sbjct: 464 LNFLLNDL-------------------------------NDY-------LQSRGQTYILN 485

Query: 599 IFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTG 658
            FQG + N ++C  C+  +++   F    + +     K+     +++ +  + + E+L G
Sbjct: 486 QFQGTVTNQIKCLTCDTITSSSEPFLDFPIEVEADEEKY-----IQNVMEHYQQRELLRG 540

Query: 659 ENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXL 718
            N + C +C                             L  +E                L
Sbjct: 541 SNKFYCNECC---------------------------GLQEAE---------------RL 558

Query: 719 VTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNT---DIAYPAIL--TITLKNKEKCRFKL 773
           V  KS     LP  L +HL RF  S   + N      I YP IL  + T  +     ++L
Sbjct: 559 VGLKS-----LPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRL 613

Query: 774 YGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRIS 832
            GVV H GN  ++GHY SL + E           W  FDDETV+     + LD   +  S
Sbjct: 614 QGVVVHMGNGPHHGHYVSLCHTE--------LFGWLLFDDETVESVDESYVLDFVGSHES 665

Query: 833 SSDVYVLFYEKI 844
            +  YVLFY +I
Sbjct: 666 PTTAYVLFYSEI 677

 Score = 38.5 bits (88), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 429 GLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFR 471
           GLP    S+ ++      G  N GNTCY NS+LQCL+    FR
Sbjct: 150 GLPFGDGSNKVF------GYENFGNTCYCNSVLQCLYHLPEFR 186

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 86/400 (21%), Positives = 145/400 (36%), Gaps = 129/400 (32%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           GL+N G TCY+NS+LQ  + T  FR L         I T+ +   +NS  +  ++ +   
Sbjct: 191 GLKNQGATCYLNSLLQSYYFTKYFRKLVYQ------IPTEGETP-ANSVSLALQRAFFQL 243

Query: 507 GCAVIPVLFLKTCNFLRP---DLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPD 563
             +  P   L TC   R    D      Q D QE   +L+D+L N++K            
Sbjct: 244 QRSSEP---LDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGT---------- 290

Query: 564 LIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNF 623
                                    E EG   ++ +F G++++ ++C   +Y S+   +F
Sbjct: 291 -------------------------EVEG--KLNGLFVGKMKSYIKCVNVDYESSRVEDF 323

Query: 624 CTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXX 683
             + L++       + L  L+     +IE EM+ GEN                       
Sbjct: 324 WDIQLNV-------KGLKGLQQSFENYIEVEMMDGENQ---------------------- 354

Query: 684 XXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS 743
                          ++   H                +K   F   P +L + L RF   
Sbjct: 355 ---------------YAAQGHGLQD-----------AKKGVLFESFPPVLHLQLKRFEYD 388

Query: 744 ---GLLDKNNTDIAYPAILTIT--------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLI 792
                L K N    +P  + ++          +    ++ L+GV+ H G+++ GHY ++I
Sbjct: 389 FNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAKYNLHGVLVHTGDISTGHYYAMI 448

Query: 793 NKEPSHDLNPQRQKWFYFDDETV-----KQQFNY-FDLDK 826
             +P  +       W+ FDD+ V     KQ F   F  DK
Sbjct: 449 --KPGLE-----DAWYRFDDDKVWRVTKKQVFEQNFGFDK 481

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 82/390 (21%), Positives = 145/390 (37%), Gaps = 122/390 (31%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L       +   ++ +P   +S  +  ++ +   
Sbjct: 204 GFRNQGATCYLNSLLQSYFFTKYFRRLVY-----QIPTSQENP--KDSVVLALQRAFYQL 256

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  ++       D      Q D QE   +L+D+L   +K               
Sbjct: 257 QVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGT------------- 303

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                               ++EN+    ++EIF G++++ ++C   +Y S    +F  +
Sbjct: 304 --------------------TVENK----LNEIFVGKMKSFIKCINVDYESARTEDFWDI 339

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            +++ N       L  L+D    +IE E++ GEN +                        
Sbjct: 340 QMNVKN-------LKGLKDSFENYIEVELMDGENQY------------------------ 368

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                 +  D    +                   +K   F   P +L + L RF      
Sbjct: 369 ------AAQDYGLQD------------------AKKGVVFESFPAVLHLQLKRFEYDFNY 404

Query: 744 GLLDKNNTDIAYPAILTIT-------LKNKEKCR-FKLYGVVNHFGNLNNGHYTSLINKE 795
             L K N    +P  + ++       L+     R + L+GV+ H G+++ GHY +LI  +
Sbjct: 405 DQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRWYGLHGVLVHTGDISTGHYYALI--K 462

Query: 796 PSHDLNPQRQKWFYFDDETV-----KQQFN 820
           P  +      +W+ FDDE V     KQ F+
Sbjct: 463 PGLE-----DQWYRFDDERVWKVSKKQAFD 487

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 155/400 (38%), Gaps = 115/400 (28%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV-DPHLSNSFHILFRKM 502
            +SGL N+G+TC+++S+LQCL     F    +S  +      +  D   S +   +  ++
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIKHSMSQSHFNKCKVRSPDNCFSCALDKIVHEL 194

Query: 503 YLNGGCAVIP-----------VLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELK 551
           Y        P            ++L TC +          QQD  EF   +++Q+H    
Sbjct: 195 YGVLNTDQPPSSSSATNRQAGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIH---- 250

Query: 552 SNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQ 611
             Q+ ++S  P   E D +++   +                  ++H +F+G LE+S+ C 
Sbjct: 251 --QNYVLSL-PSTKESDKENIKHCDC-----------------IVHTVFEGSLESSIVCP 290

Query: 612 RC-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXX 670
            C N + T    F  LSL I +K++       L +C+  F + E+L   N ++C +C   
Sbjct: 291 SCQNNSKTTIDPFMDLSLDIKDKKK-------LYECLDSFHKKELLKDFN-YHCGEC--- 339

Query: 671 XXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLP 730
                               N + + +                        K     KLP
Sbjct: 340 --------------------NSTQDAI------------------------KQLGIHKLP 355

Query: 731 NLLIIHLSRFS--MSGLLDKNNTDIAYPAILTI----TLKNKEK---------CRFKLYG 775
           ++L++ L RF   ++G   K +  I +P  L +    +++  EK           ++L G
Sbjct: 356 SVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNKKVPDIIYELIG 415

Query: 776 VVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           +V+H G +N GHY +               +WF F+D  V
Sbjct: 416 IVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMV 447

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 96/402 (23%), Positives = 148/402 (36%), Gaps = 135/402 (33%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMY 503
            ++GL N+G+TC+++S++Q    T       L +   +   T  D  L NS   +     
Sbjct: 134 GLAGLVNMGSTCFMSSIIQ----TLIHNPYILKHSMDQLHSTTCD--LQNSSSCM----- 182

Query: 504 LNGGCAVIPVLF--------------------LKTCNFLRPDLRIPDVQQDTQEFLILLL 543
               CAV  ++                     L +C++ +        QQD  EF   LL
Sbjct: 183 ---SCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQDAHEFWQFLL 239

Query: 544 DQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQ 603
           +QLHN                     D +   N          SL+N+   + H  FQG 
Sbjct: 240 NQLHN---------------------DHLRATNQKA-------SLKNDCNCISHRSFQGF 271

Query: 604 LENSLECQRC-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAW 662
           L++S+ C  C N   T       LSL I NK         L +C+  F + E LT  N +
Sbjct: 272 LKSSIVCPECQNDRKTTIDLMMDLSLDIKNKST-------LHECLDNFHKKEQLTDFN-Y 323

Query: 663 NCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRK 722
           +C KC                       N   N +                        +
Sbjct: 324 HCEKC-----------------------NTKQNAI------------------------R 336

Query: 723 STSFIKLPNLLIIHLSRF--SMSGLLDKNNTDIAYPAILTIT-------LKNKEKCRFKL 773
             +  KLP +L++ L RF  S++G   K N  I +P  L ++       +       ++L
Sbjct: 337 QLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIVYEL 396

Query: 774 YGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
            G+++H G++N GHYTS I K P         +WF F+D  V
Sbjct: 397 IGLISHQGSVNQGHYTS-ICKIPG-------GQWFKFNDSMV 430

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 101/264 (38%), Gaps = 81/264 (30%)

Query: 595 LIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENE 654
            I+E FQG L N ++C  C+  ++    F    L  P + ++ ++  D+   +  + + E
Sbjct: 542 FINESFQGILTNRIKCLSCDNVTSRDEPF----LDFPIEVQEHKEFTDISTILKSYHQKE 597

Query: 655 MLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXX 714
           ML G N + C +C                              T  E             
Sbjct: 598 MLGGHNKFYCSQC-----------------------------CTLQE------------- 615

Query: 715 XXXLVTRKSTSFIKLPNLLIIHLSRFSMS-------GLLDKNNTDIAYPAILTITLKNKE 767
                 +++    KLPN L +HL RF  S        L +K    I YP  L ++     
Sbjct: 616 -----AQRTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNK----IVYPLELNVSSSFTS 666

Query: 768 KC--RFKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETV----KQQFN 820
               ++KL G+V H G+    GHY ++   +        +  W  FDDET     +++  
Sbjct: 667 SISKKYKLQGIVVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETASWINEEEVL 718

Query: 821 YFDLDKNVNRISSSDVYVLFYEKI 844
            F  D+     S +  YVLFYE++
Sbjct: 719 SFIGDEK----SQNTAYVLFYEEV 738

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFR 471
           I G  N GNTCY NS+LQCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 88/218 (40%), Gaps = 51/218 (23%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G +N G TCY+NS+LQ  F T  FR L       +    K  P+  NS  +  ++ +   
Sbjct: 207 GFKNQGATCYLNSLLQSYFFTKYFRKLVY-----QIPTDKESPN--NSVPLALQRAFFQL 259

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  L+       D      Q D QE   +L+D+L N++K               
Sbjct: 260 QKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGT------------- 306

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                 DV+                    ++E+F G++ + ++C   +Y S+   +F  +
Sbjct: 307 ------DVDGK------------------LNEVFVGKMRSYIKCVNVDYESSRVEDFWDI 342

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
            L++ N R        L++    +IE EM+ GEN +  
Sbjct: 343 QLNVKNLR-------GLQESFKNYIEVEMMDGENQYAA 373

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 18/107 (16%)

Query: 720 TRKSTSFIKLPNLLIIHLSRFSMS---GLLDKNNTDIAYPAIL--------TITLKNKEK 768
            +K   F   P +L + L RF        L K N    +P  +         I+  N + 
Sbjct: 381 AKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADS 440

Query: 769 CRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
             + L+GV+ H G+++ GHY ++I  +PS +      +W+ FDD+ V
Sbjct: 441 YIYDLHGVLVHTGDISTGHYYTMI--KPSIE-----DQWYRFDDDKV 480

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 88/218 (40%), Gaps = 51/218 (23%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L        Y     +   +NS  +  ++ +   
Sbjct: 204 GFRNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTENESPNNSVPLALQRSFYQL 256

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  L+       D      Q D QE   +L+D+L N +K               
Sbjct: 257 QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGT------------- 303

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                               S+E     +++EIF G++++ ++C   +Y S+   +F  L
Sbjct: 304 --------------------SVE----GMLNEIFVGKMKSYIKCIDVDYESSRVEDFWDL 339

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
            L++ N +        L++    +IE E+L GEN +  
Sbjct: 340 QLNVKNMK-------GLKESFDNYIEIELLNGENQYQA 370

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 17/106 (16%)

Query: 720 TRKSTSFIKLPNLLIIHLSRFSMSGLLD---KNNTDIAYPAILTIT--LKNKEK-----C 769
             K   F   P +L + L RF      D   K N    +P  + ++  L++ +K     C
Sbjct: 378 AEKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNC 437

Query: 770 RFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
            + L+GV+ H G+++ GHY +LI  +P  +      +W+ FDDE V
Sbjct: 438 VYNLHGVLVHAGDISTGHYYTLI--KPGLE-----DQWYRFDDERV 476

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 89/218 (40%), Gaps = 51/218 (23%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G +N G TCY+NS+LQ  F T  FR L         I T+ D   +NS  +  ++ +   
Sbjct: 194 GFKNQGATCYLNSLLQSYFFTKYFRRLVYQ------IPTENDSP-NNSVPLALQRAFYQL 246

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+  L+       D      Q D QE   +L+D+L N++K               
Sbjct: 247 QVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKMKGTP------------ 294

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE+                   ++EIF G++++ ++C   +Y S+    F  L
Sbjct: 295 -------VEDK------------------LNEIFVGRMKSYIKCINVDYESSRVEEFWDL 329

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
            +++ N       L DL+     +IE E++ GEN +  
Sbjct: 330 QMNVKN-------LKDLKSSFENYIEIELMNGENQYAA 360

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 46/77 (59%), Gaps = 9/77 (11%)

Query: 769 CRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ--QFNYFDLDK 826
           C +KL+GV+ H G+++ GHY ++I  +PS +      +W+ FDDE V +  +   FD + 
Sbjct: 429 CIYKLHGVLVHAGDISTGHYYAMI--KPSTE-----DQWYRFDDEKVWKVTKTQVFDENF 481

Query: 827 NVNRISSSDVYVLFYEK 843
            ++RI   +V ++  E+
Sbjct: 482 GLDRIPDDEVRLMSREQ 498

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
           YER151C
          Length = 917

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 68/151 (45%), Gaps = 33/151 (21%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSM----------------SGLLDKNNTDIAYPAILTI 761
           V  K  +FI KLP +L+I L RF+                 SG ++K    I Y   LTI
Sbjct: 772 VEAKKQTFIDKLPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTI 831

Query: 762 --------TLKNKEKCRFKLYGVVNHFGN-LNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
                   +L++     +KL GV+ H G+  + GHYT+ +        + Q  KW+  DD
Sbjct: 832 PIESVSSTSLRDDANREYKLTGVIYHHGSSPDGGHYTADV-------FHQQTNKWYRIDD 884

Query: 813 ETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
             + +  N   LD + N + +   Y+L YEK
Sbjct: 885 VNISELKNDHVLDADDNDMGTRTAYILIYEK 915

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 532 QQDTQEFLILLLDQLHNELKSNQDRLV 558
           Q+D +EFL  LLDQLH EL S+ D L 
Sbjct: 592 QEDAEEFLTHLLDQLHEELVSSIDCLT 618

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 93/399 (23%), Positives = 150/399 (37%), Gaps = 118/399 (29%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRY---------KEYIGTKVDPHLSNS 494
            +SGL N+G+TCY++ ++QCL     F    L+  +            I   +D  +++ 
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFKICKTHDPTTCISCALDSIVTDF 194

Query: 495 FHIL-----FRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNE 549
           + I       +K   +G      ++ L TC++          QQD  EF   LL++LH+E
Sbjct: 195 YGISDLDDDVKKTNNDG------LIDLLTCSWKINQNLAGYSQQDAHEFWQFLLNRLHSE 248

Query: 550 LKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
            KSN               TD+  ++  N         L N    + H++FQG L++S+ 
Sbjct: 249 YKSNIGP------------TDTAPLKEGN-------HELCN---CIYHKVFQGFLKSSIV 286

Query: 610 CQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCX 668
           C  CN  + T    F  LSL I  K         L +C++ F + E L  +  ++C  C 
Sbjct: 287 CPECNSDAKTTIEPFMDLSLDIKGKNT-------LYECLNSFHKKEQLH-DFDYHCKNC- 337

Query: 669 XXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIK 728
                                 N S +                          K  +  K
Sbjct: 338 ----------------------NTSQD------------------------PTKQLAVAK 351

Query: 729 LPNLLIIHLSRFS--MSGLLDKNNTDIAYPAILTIT----------LKNKEKCRFKLYGV 776
           L  +L+    RF   +SG   K N  I +P  L +             +K    ++L G+
Sbjct: 352 LSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDLIYELIGI 411

Query: 777 VNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           + H G +N GHYT++          P+ Q W  F+D  V
Sbjct: 412 ICHTGTVNEGHYTAICKI-------PEGQ-WIKFNDSMV 442

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 88/411 (21%), Positives = 151/411 (36%), Gaps = 103/411 (25%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHL-SNSFHILFRKM 502
            ++GL N+G+TCY++S++QC+         F+  ++      K+  +  S +   +    
Sbjct: 135 GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMASNCTSCAISSIIADF 194

Query: 503 YLNG-----------GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELK 551
           Y N                   + L TC++   +      QQD  E+   +L+ +H + K
Sbjct: 195 YGNSVQNDYKSKKNNNNKHEGFINLLTCSWKVNENLAGYSQQDAHEYWQFILNHIHQDYK 254

Query: 552 SNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQ 611
           S+    +  H D                      + L N    ++H  FQG L++S+ C 
Sbjct: 255 SS----MHSHSD----------------------DKLCN---CVVHSSFQGSLKSSIVCP 285

Query: 612 RCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXX 670
            CN  S T +  F  LSL I +K         L +C+  F + E L   + + C KC   
Sbjct: 286 ECNNDSKTTFDPFIDLSLGIKDKHT-------LTECLDNFHKKEQLHDYDFF-CKKCQAQ 337

Query: 671 XXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLP 730
                                R  + ++                    V +K   +I+ P
Sbjct: 338 QNPIKQFTINKLPPVLVLQLKRFEHLMSG-------------------VNQKLNDYIEFP 378

Query: 731 NLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTS 790
            +L        M   L  N      P+IL           ++L G+++H G++N GHY +
Sbjct: 379 KIL-------DMKPYLKDNQNPDEDPSIL-----------YELIGIISHTGSVNEGHYVA 420

Query: 791 LINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
               E          +WF F+D  V +      L+K+V +      Y+LFY
Sbjct: 421 FCKIE--------NGEWFKFNDSMVTKI-----LEKDVLK---EQAYLLFY 455

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 87/219 (39%), Gaps = 51/219 (23%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G RN G TCY+NS+LQ  F T  FR L        Y     +   ++S  +  ++ +   
Sbjct: 210 GFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIPTDEEKPNDSVPLALQRAFYQL 262

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             + +P+  L+       D      Q D QE   +L+D+L   +K  +            
Sbjct: 263 QVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKGTK------------ 310

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                  VE                    + E+F G++++ ++C+  +Y S+    F  +
Sbjct: 311 -------VEGK------------------LSELFVGKMKSYIKCKNVDYESSRVEEFWDI 345

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCP 665
            L++       + L +L+     +IE E++ GEN +  P
Sbjct: 346 QLNV-------KDLKNLQQSFENYIEVELMDGENQYAAP 377

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 58/124 (46%), Gaps = 26/124 (20%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLD---KNNTDIAYPAILTIT-------LKNKEKCR- 770
           K   F   P +L + L RF      D   K N    +P  + ++       LKN+ +   
Sbjct: 386 KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 771 --FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV-----KQQFNY-F 822
             +KL+GV+ H G+++ GHY ++I      DL  Q   W+ FDDE V     KQ F+  F
Sbjct: 446 HIYKLHGVLVHTGDISTGHYYTMIKP----DLGDQ---WYRFDDERVWKVDRKQVFDENF 498

Query: 823 DLDK 826
            LDK
Sbjct: 499 GLDK 502

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 69/159 (43%), Gaps = 26/159 (16%)

Query: 425 YTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLF--LSNRYKEY 482
           Y KY + ++P++ N    +   G+ N GN C+++S+LQ L     F ++   +S R    
Sbjct: 312 YIKYTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAK 371

Query: 483 IGTKVDPHLSNSFHILFR----------------KMYLNGGCAVIPVL-FLKTCNFLRPD 525
           IG+ V P L     +  R                K+       + P    +K  +F +  
Sbjct: 372 IGSSVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTL 431

Query: 526 LRIPDV-------QQDTQEFLILLLDQLHNELKSNQDRL 557
            ++P         Q+D +EFL  LLDQLH E  ++ D L
Sbjct: 432 SKLPKFRDLRWGHQEDAEEFLTHLLDQLHEEFITSIDAL 470

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 64/153 (41%), Gaps = 34/153 (22%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSM---------------SGLLDKNNTDIAYPAILTIT 762
           V  K  +FI KLP +L+I L RFS                SG ++K    I Y   LTI 
Sbjct: 627 VEAKKQTFIDKLPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIP 686

Query: 763 LK----------NKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFD 811
            +          +    ++KL GVV H G + + GHYT+ +  +       +  KWF  D
Sbjct: 687 KETISSVHSNFYDDAGTKYKLVGVVYHHGVSPSGGHYTADVYHQ-------EMDKWFRID 739

Query: 812 DETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
           D  + +      L    +   S   Y+L Y+KI
Sbjct: 740 DVNIAELNKEEVLKGGEDGFDSRTAYILMYQKI 772

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 110/264 (41%), Gaps = 82/264 (31%)

Query: 595 LIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENE 654
            +  +FQG + NS++C  C+  +++   F  L  +IP    +    V+++D +S F + E
Sbjct: 508 FVQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIPVNEDE---EVNIQDMLSNFNQRE 562

Query: 655 MLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXX 714
           ML G N + C  C                           N L  +E             
Sbjct: 563 MLNGANKFYCDSC---------------------------NGLQEAE------------- 582

Query: 715 XXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTITLKNKE- 767
                  ++    +LP +L +HL RF  S   +K+ ++I       YP  L +  K+   
Sbjct: 583 -------RTVGLKQLPKILSLHLKRFKYS---EKHQSNIKLFNKIYYPLKLKVCTKSDTI 632

Query: 768 KCR-FKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ-----QFN 820
            C+ ++L G+V H G    +GHY ++      HD+      W  +DDETV+       F 
Sbjct: 633 VCKNYELNGIVIHMGGGPQHGHYVAICK----HDMF----GWLLYDDETVESIDEETVFK 684

Query: 821 YFDLDKNVNRISSSDVYVLFYEKI 844
           +   +K++     +  YVLF++++
Sbjct: 685 FVGDEKDM-----TTAYVLFFKEV 703

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 421 IVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +VTR +++ LP    S+ ++      GL N GNTCY NS+LQCLF  +  R   L
Sbjct: 115 LVTRESEH-LPCGDGSTKVF------GLENFGNTCYCNSVLQCLFNLSELRTNIL 162

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 80/385 (20%), Positives = 136/385 (35%), Gaps = 127/385 (32%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYK-----EYIGTKVDPHLSNSFHILFRK 501
           G +N G TCY+NS+LQ  F T  FR +     YK     E     V   L  SF++L + 
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV----YKIPSDNESPNDSVSLALQRSFYLLEKS 258

Query: 502 MYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEH 561
                     P+  L+       D      Q D QE   +L+D+L   +K          
Sbjct: 259 KE--------PLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGT-------- 302

Query: 562 PDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYS 621
                                      E EG   ++++F G++++ + C   +Y S    
Sbjct: 303 ---------------------------EVEG--TLNDLFVGKMKSYIRCVNVDYESFRVE 333

Query: 622 NFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXX 681
           +F  + L++ N       L D+++    ++E EM+ GEN +                   
Sbjct: 334 DFWDIQLNVKN-------LKDVKESFENYVEVEMMDGENQY------------------- 367

Query: 682 XXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFS 741
                      +  D    +                   +K   F   P +L + L RF 
Sbjct: 368 -----------AAQDYGLQD------------------AKKGVVFESFPPVLHLQLKRFE 398

Query: 742 MS---GLLDKNNTDIAYPAILTIT------LKNK--EKCRFKLYGVVNHFGNLNNGHYTS 790
                  L K N    +P  + ++      +K+     C + L+ V+ H G+++ GHY +
Sbjct: 399 YDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCIYNLHCVLVHSGDISAGHYYA 458

Query: 791 LINKEPSHDLNPQRQKWFYFDDETV 815
           +I    +        +WF FDD+ V
Sbjct: 459 MIKPNVT-------DQWFRFDDDKV 476

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/378 (19%), Positives = 134/378 (35%), Gaps = 116/378 (30%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G +N G TCY+NS+LQ    T  FR L        Y     D + +NS  +  ++ +   
Sbjct: 198 GFKNQGATCYLNSLLQSYHFTKLFRKLV-------YQIPTEDENPTNSVALALQRAFYLL 250

Query: 507 GCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIE 566
             +  P+   +       D      Q D QE   +L+D+L + +K               
Sbjct: 251 QTSKEPLDTTELTKSFGWDTGDAFTQHDVQELNRILMDRLEHRMKGT------------- 297

Query: 567 YDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTL 626
                               S+E +    I+E+F G++++ ++C   +Y S+   +F  +
Sbjct: 298 --------------------SVEGK----INELFVGKMKSCIKCINVDYESSRVEDFWDI 333

Query: 627 SLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXX 686
            L++       + + +L++    +IE E++ GEN                          
Sbjct: 334 QLNV-------KDMKNLQESFEQYIEVELMNGENQ------------------------- 361

Query: 687 XXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMS--- 743
                       ++  +H             L   +   F   P +L + L RF      
Sbjct: 362 ------------YAAQDHG------------LQDAQKVVFESFPPVLHLQLKRFEYDFNY 397

Query: 744 GLLDKNNTDIAYPAILTIT------LKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPS 797
             L K N    +P  + ++              + L+GV+ H G+++ GHY ++I  +  
Sbjct: 398 DQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGVLVHSGDISTGHYYAMIQPDA- 456

Query: 798 HDLNPQRQKWFYFDDETV 815
                    W+ FDD+ V
Sbjct: 457 ------HGSWYRFDDDRV 468

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 86/393 (21%), Positives = 140/393 (35%), Gaps = 118/393 (30%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATT-AFRNLFLSNRYKEYIGTKVDPHLSNS-FHILFRK 501
            + GL N+G+TC+++S++Q L       +     N Y     ++ D   S+S F     +
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHY-----SRCDIQDSSSCFSCALDQ 188

Query: 502 MYLNGGCAVIPVLF---------LKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKS 552
           + +N         F         L  C++          QQD  EFL   L+QLH     
Sbjct: 189 IVMNFYGPTSDATFTSQQRGFVDLLLCSWKTNKNLAGYSQQDAHEFLQFFLNQLH----- 243

Query: 553 NQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQR 612
                     D +     ++  EN N                ++H  FQG L +S+ C  
Sbjct: 244 ---------ADHVRVAQTNVKAENCN---------------CILHTAFQGSLRSSILCTD 279

Query: 613 C-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXX 671
           C + ++  +     LSL I NK         L +C+  F + E LT              
Sbjct: 280 CQDGSNITFDPMMDLSLDIKNKS-------TLVECLQSFHKGERLT-------------- 318

Query: 672 XXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPN 731
                                        ++NH+                K  +  KLP 
Sbjct: 319 -----------------------------DFNHHCSSCGSVQNPI-----KQMTIAKLPP 344

Query: 732 LLIIHLSRFS--MSGLLDKNNTDIAYPAILTIT-------LKNKEKCRFKLYGVVNHFGN 782
           +L++ L RF   M+G   K N +I YPA L +         ++     ++L  V++  G+
Sbjct: 345 VLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVYELVAVISQEGS 404

Query: 783 LNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           +N GHYT +  K P         +WF F+D  +
Sbjct: 405 VNQGHYTCMC-KVPG-------GQWFRFNDTMI 429

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 59/126 (46%), Gaps = 20/126 (15%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTITLK-NKEKC-RFKLYGVVNH 779
           +LP+ L +HL RF  S   +K N +I       YP  L +    N E C +++L G+V H
Sbjct: 554 QLPDTLTLHLKRFKYS---EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVH 610

Query: 780 FGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYV 838
            G    +GHY SL           Q+  W  FDDETV+       L+      + +  YV
Sbjct: 611 MGGGPQHGHYVSLCKH--------QKFGWLLFDDETVEAVKEETVLEFTGESANMATAYV 662

Query: 839 LFYEKI 844
           LFY+ +
Sbjct: 663 LFYKAV 668

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G  N GNTCY NS+LQCL+  +  R   L
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENIL 169

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 10/94 (10%)

Query: 579 EYKKWFAESLENEGL-----SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNK 633
           E +K     ++N G      + I+++F+G L N ++C  C+  ++    F    + +   
Sbjct: 452 ENQKKATSKIKNNGFLNTSTNFINDLFKGTLTNQIKCLTCDNVTSRDEPFLDFPIEV--- 508

Query: 634 RRKFRKLVDLEDCISLFIENEMLTGENAWNCPKC 667
             K  +  D++  +  + + EML G N + C +C
Sbjct: 509 --KGEEETDIQAILKSYHQREMLNGSNKFYCDEC 540

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 94/231 (40%), Gaps = 46/231 (19%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKE---------YIGTKVDPHLSNSFHI 497
           GL NLG+TC+++S+LQ L   T  +  FL++ +            I   +D  +S  +  
Sbjct: 138 GLLNLGSTCFMSSILQSLIHNTYIQYWFLNSGHARRCALRDPSSCISCALDRIISECYGS 197

Query: 498 LFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRL 557
           L  +    G       L L TC++          QQD  EFL  LL+QLH + K  ++R 
Sbjct: 198 LSERNDHAG------FLSLLTCSWKINQNFAGYSQQDAHEFLQFLLNQLHCDYK--RERQ 249

Query: 558 VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTS 617
           V E                     K    S       ++H  FQG L +S+ C  C   S
Sbjct: 250 VDE--------------------DKEVRSSSSQLCHCIVHSSFQGTLRSSIVCPECQDDS 289

Query: 618 -TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKC 667
            T    F  LSL I  +R        L DC+  F   E L  +  ++CP+C
Sbjct: 290 KTMLDPFLDLSLDIKGQR-------TLYDCLDSFHRREQLH-DFDYHCPRC 332

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 19/103 (18%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCR---------FK 772
           K  +  +L   L++ L RF    L    N  +  P    + L     C          ++
Sbjct: 340 KQLTIERLAPTLVLQLKRFEH--LTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYR 397

Query: 773 LYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           L GVV+H G +N GHYT+++       LN    +WF F+D  +
Sbjct: 398 LSGVVSHSGTVNEGHYTAVLQ------LNS--GEWFKFNDSMI 432

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 102/294 (34%), Gaps = 101/294 (34%)

Query: 532 QQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENE 591
           QQD  EF    L+QLH                      D + V      K         E
Sbjct: 228 QQDAHEFWQFFLNQLH---------------------ADHVRVTGKKSSK-------PEE 259

Query: 592 GLSLIHEIFQGQLENSLECQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              + H  FQG L +S+ C  C+  S   +     LSL I NK +       L DC+  F
Sbjct: 260 CNCISHSAFQGSLRSSILCTDCHDGSNITFDPMMDLSLEIKNKNK-------LVDCLKSF 312

Query: 651 IENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXX 710
            E E                                           T +++NH      
Sbjct: 313 HEGE-------------------------------------------TLTDFNHRCPNCG 329

Query: 711 XXXXXXXLVTRKSTSFIKLPNLLIIHLSRFS--MSGLLDKNNTDIAYPAILTIT-LKNKE 767
                      K  +  KLP +L++ L RF   M+G   K N  IAYP  L +    ++ 
Sbjct: 330 SVQNPI-----KQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQS 384

Query: 768 KCR------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           + R      ++L  V++H G++N GHYTS+  K P         +WF F+D  +
Sbjct: 385 ESRPVPDMMYELVAVISHEGSVNQGHYTSMC-KIPG-------GQWFRFNDSMI 430

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 92/415 (22%), Positives = 156/415 (37%), Gaps = 143/415 (34%)

Query: 444 SISGLRNLGNTCYINSMLQCL-----FATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHIL 498
            +SGL N+G+TC+++S+LQCL     F   + R +  SN+ K       D   S +   +
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMRQIH-SNKCKV---RSPDKCFSCALDKI 190

Query: 499 FRKMY--LN--------------GGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILL 542
             ++Y  LN              GG      + L TC +          QQD  EF   L
Sbjct: 191 VHELYGVLNTDQPSSSSSATNRQGG-----FIHLLTCAWKINQSLAGYSQQDAHEFWQFL 245

Query: 543 LDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQG 602
           ++++H      Q  ++S          +  +V+ AN  +             ++H +F+G
Sbjct: 246 INEIH------QSYVLSL--------PNPKEVDRANNKR----------CDCIVHTVFEG 281

Query: 603 QLENSLECQRC-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENA 661
            LE+S+ C  C N + T    F  LSL I +K++       L +C+  F + E+L   N 
Sbjct: 282 SLESSIVCPGCQNNSKTTIDPFMDLSLDIKDKQK-------LYECLDSFHKKELLKDFN- 333

Query: 662 WNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTR 721
           ++C +C                       N + + +                        
Sbjct: 334 YHCGEC-----------------------NSTQDAI------------------------ 346

Query: 722 KSTSFIKLPNLLIIHLSRFS--MSGLLDKNNTDIAYPAILTITLKNKEKCR--------- 770
           K     +LP++L++ L RF   ++G   K +  I +P  L +    K  C          
Sbjct: 347 KQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNM----KSYCSTAESESENH 402

Query: 771 ----------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
                     ++L G+V+H G +N GHY +               +WF F+D  V
Sbjct: 403 IGNGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMV 449

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 49/112 (43%), Gaps = 16/112 (14%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPH------LSNSFHILFR 500
           GL+NLGNTCY+N+ LQCLF     R + L+ +    +    + H      L N F  L +
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIVLELRNCFDSLDK 169

Query: 501 KMYLNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLLDQL 546
           K +     AV+P++ L       P     D       QQD +E    L   L
Sbjct: 170 KKF----QAVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELFTQLFHSL 217

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 59/126 (46%), Gaps = 20/126 (15%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTITLK-NKEKC-RFKLYGVVNH 779
           +LP+ L +HL RF  S   +K N +I       YP  L +    N E C +++L G+V H
Sbjct: 557 QLPDTLALHLKRFKYS---EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVH 613

Query: 780 FGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYV 838
            G    +GHY SL   E        +  W  FDDETV+       L+      + +  YV
Sbjct: 614 MGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYV 665

Query: 839 LFYEKI 844
           LFY+ +
Sbjct: 666 LFYKAM 671

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 56/137 (40%), Gaps = 24/137 (17%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLEN 590
           + QD  EF   LL++L                + IE +  +M +EN N           N
Sbjct: 431 MHQDAHEFFNFLLNELS---------------EYIERENQNM-LENGNSVN---GSGGLN 471

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
           +  + I+ +FQG L N ++C  C+  ++    F    + +           D++  +  +
Sbjct: 472 KNANFINNLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEVQGDEE-----TDIQAILKSY 526

Query: 651 IENEMLTGENAWNCPKC 667
            + EML G N + C +C
Sbjct: 527 HQREMLNGSNKFYCDEC 543

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           G  N GNTCY NS+LQCL+  ++ R
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLR 166

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 66/154 (42%), Gaps = 34/154 (22%)

Query: 719  VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAY---------------------- 755
            V  K  +FI KLP +L+I L RFS    + K+N    Y                      
Sbjct: 934  VEAKKQTFIDKLPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHELLV 993

Query: 756  --PAILTITLKNKEKCR-FKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFD 811
               ++ +  LKN E  R +KL  VV H G+  + GHYT+ I        N   +KWF  D
Sbjct: 994  PVESVSSAILKNNESSRKYKLRAVVYHHGSSPDGGHYTADI-------YNKDLKKWFMID 1046

Query: 812  DETVKQQFNYFDLDKNVNRISSSDVYVLFYEKII 845
            D  + +  +   ++   N + +   Y+L YEK I
Sbjct: 1047 DVNITELEDADVVNGGDNGLDTRTAYILMYEKEI 1080

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNT------DIAYPAILTITLK-NKEKC-RFKLYGVVNH 779
           +LP+ L +HL RF  S   +K N       DI YP  L +    N E C +++L G+V H
Sbjct: 556 QLPDTLALHLKRFKYS---EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVH 612

Query: 780 FGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYV 838
            G    +GHY SL      H++      W  FDDETV+       L+      + +  YV
Sbjct: 613 MGGGPQHGHYVSLC----KHEI----FGWLLFDDETVEAVKEEAVLEFTGESPNMATAYV 664

Query: 839 LFYE 842
           LFY+
Sbjct: 665 LFYK 668

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           G  N GNTCY NS+LQCL+  ++ R
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVR 166

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 590 NEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISL 649
           N+  + I  +FQG L N ++C  C+  ++    F    + +           D++  +  
Sbjct: 470 NKTTNFISNLFQGTLTNQIKCLTCDNVTSRDEPFLDFPIEVQGDEE-----TDIQAILKS 524

Query: 650 FIENEMLTGENAWNCPKC 667
           + + EML G N + C KC
Sbjct: 525 YHQREMLNGPNKFYCDKC 542

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 50/115 (43%), Gaps = 13/115 (11%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVD---PHLSNSFHILFRKMY 503
           G+ NLGNTCY+N+ LQ LF     R   L    K  I   VD     L     + F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 504 LNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLLDQLHNELKS 552
              G  + P+L L+    + P     D       QQD +E    L  QL + LK+
Sbjct: 163 DRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEE----LFTQLFHTLKT 213

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 8/48 (16%)

Query: 769 CRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           C + L GV+ H G N  +GHY + I  +         +KW+ FDD+ V
Sbjct: 413 CIYDLIGVITHQGANSESGHYQAFIRDDAD-------EKWYRFDDDKV 453

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 55/127 (43%), Gaps = 21/127 (16%)

Query: 435 HSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT--------K 486
           H    + Q+ I GL N+GNTCY+NS LQ L+     R++ L  +YKE            K
Sbjct: 99  HQRQKFNQMPI-GLLNMGNTCYMNSTLQALYRVDGLRDMVL--KYKEQANVQPGDELHYK 155

Query: 487 VDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLI 540
           +   L   F  L +K Y     +V+PV+FL       P     D       QQD +E   
Sbjct: 156 LISELKRCFENLQKKSYE----SVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFT 211

Query: 541 LLLDQLH 547
            L   L+
Sbjct: 212 QLFSSLN 218

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 108/295 (36%), Gaps = 103/295 (34%)

Query: 532 QQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENE 591
           QQD  E+   LL+QLHN      D +VS +         S D  N       FAE  +  
Sbjct: 239 QQDAHEYWQFLLNQLHN------DYMVSHNK--------SPDETN-------FAELCD-- 275

Query: 592 GLSLIHEIFQGQLENSLECQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              + H  FQG L++S+ C  C   S T    F  LSL I +K        +L +C+  F
Sbjct: 276 --CIAHSTFQGSLKSSIVCPECKMDSKTTKDPFMDLSLDIKDKS-------NLYECLDSF 326

Query: 651 IENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXX 710
            + E L   N ++C +C                       N + N +             
Sbjct: 327 HKMEQLHDFN-YHCDRC-----------------------NTTQNAI------------- 349

Query: 711 XXXXXXXLVTRKSTSFIKLPNLLIIHLSRFS--MSGLLDKNNTDIAYPAILTITLKNKEK 768
                      K     KLP +L++ L RF   ++G   K N  + +P  L +    +  
Sbjct: 350 -----------KRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNM----RNY 394

Query: 769 CR--------FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           C         F+L G++ H G +N GHY +       H        WF F+D  V
Sbjct: 395 CDGDDVPDIIFELIGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMV 441

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/389 (22%), Positives = 145/389 (37%), Gaps = 108/389 (27%)

Query: 444 SISGLRNLGNTCYINSMLQCLFATT-AFRNLFLSNRYKEY--------IGTKVDPHLSNS 494
            + G  N+G+TC+++S+LQ L       +N    + Y           I   +D  ++ S
Sbjct: 119 GLHGFVNMGSTCFMSSILQVLIHNPFIVQNSMSQSHYSSCKIRNPNNCISCALDEIIAES 178

Query: 495 FHILFRKMYLNGGCAVIPV-------LFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547
           +    +  Y NG     P+       + +  C++   D      QQD  EFL  +L++LH
Sbjct: 179 YGNFVK--YNNGK----PINQYHDGFISMLNCSWKINDNFAGYSQQDAHEFLQFILNRLH 232

Query: 548 NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607
            + K     L S + +    +TDS                       LIH IFQG+L++S
Sbjct: 233 RDYK-----LTSTYTN----NTDSCSC--------------------LIHSIFQGKLKSS 263

Query: 608 LECQRCNYTSTNYSN-FCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPK 666
           + C  C+  S   ++ +  LSL I +K   ++       C+  F + E L   N ++CP 
Sbjct: 264 IVCPECHDNSKTVTDPYIDLSLDIKDKATLYQ-------CLDSFHKKETLHDYN-YHCPN 315

Query: 667 CXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSF 726
           C                        R      F   N+                 K  +F
Sbjct: 316 CDTMQDPIKQLTIDKLPPVLVLQLKR------FEHLNNGQNV-------------KLNAF 356

Query: 727 IKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNG 786
           I+ P  L  ++ ++  +   ++NN+ I Y                +L GV++H G +N G
Sbjct: 357 IEFPTYL--NMKKYCHT---EENNSSIIY----------------ELNGVISHIGTVNEG 395

Query: 787 HYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           HY +         L      WF F+D  V
Sbjct: 396 HYIAT--------LKLDSNNWFKFNDSMV 416

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 98/261 (37%), Gaps = 70/261 (26%)

Query: 595 LIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENE 654
            I+++FQG   + + C  C+  +++   F    + + + +       D+++ +  F + E
Sbjct: 464 FINDLFQGTQTSKVRCLTCDSVTSHDERFLDFPIELEDSKDA---ATDIQEQLREFCQTE 520

Query: 655 MLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXX 714
           +L G N + C +C                                               
Sbjct: 521 LLHGANKFYCNECCGLQE------------------------------------------ 538

Query: 715 XXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTD------IAYPAILTITLKNKEK 768
                 ++     KLP +L +HL RF  S   +  NT+      I YP  L +  K    
Sbjct: 539 -----AQRVVGLKKLPRILALHLKRFKYS---EAQNTNIKLFNKITYPLFLEVASKFDPS 590

Query: 769 C--RFKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLD 825
              +++L GVV H G    +GHY S+   +           W +FDDETV+       L+
Sbjct: 591 VSKKYELTGVVLHMGGGPQHGHYVSVCKTD--------NFGWLFFDDETVETLDEPQVLN 642

Query: 826 KNVNRISSSDVYVLFYEKIIE 846
              +  +S+  YVLFY++  E
Sbjct: 643 FTGDTTTSTTAYVLFYKETDE 663

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 6/47 (12%)

Query: 429 GLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G+P    S+ ++      G  N GNTCY NS+LQCLF  T FRN  L
Sbjct: 103 GMPFGDGSNKIF------GYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 20/128 (15%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTI--TLKNKEKCRFKLYGVVNH 779
           +LP+ L +HL RF  S   ++ NT+I       YP  L +  T  +    +++L GVV H
Sbjct: 540 QLPHTLALHLKRFKYS---EEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIH 596

Query: 780 FGN-LNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYV 838
            G    +GHY SL   +        +  W  FDDETV+       L+   +  + +  YV
Sbjct: 597 MGGSPQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSNQATAYV 648

Query: 839 LFYEKIIE 846
           LFY+++ E
Sbjct: 649 LFYKELDE 656

 Score = 38.5 bits (88), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           G  N GNTCY NS+LQCL+  T  R
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELR 162

 Score = 38.1 bits (87), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 598 EIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLT 657
           ++FQG L N ++C  C+  ++    F    + +     K  + +D++D +  +   EML 
Sbjct: 462 DLFQGVLTNRIKCLTCDNITSRDEPFLDFPIGV-----KGDENIDIQDVLRCYHTREMLN 516

Query: 658 GENAWNCPKC 667
           G N + C +C
Sbjct: 517 GSNKFYCSQC 526

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 65/152 (42%), Gaps = 33/152 (21%)

Query: 719  VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPA-------------------I 758
            V  K  +FI KLP +L+IHL RFS     DK+N+   Y A                   I
Sbjct: 875  VEAKKQTFIDKLPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVI 934

Query: 759  LTITLKNK-----EKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
               T+ N      E   ++L GVV H G + + GHYT+ I        + +  KW+  DD
Sbjct: 935  PAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTADI-------YHKEVDKWYRIDD 987

Query: 813  ETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
             TV +      L    N   S   Y+L Y+K+
Sbjct: 988  VTVTELEKDDVLKGGENSTDSRTAYILMYQKL 1019

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 20/126 (15%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTITLK-NKEKC-RFKLYGVVNH 779
           +LP+ L +HL RF  S   +K N +I       YP  L +    N + C +++L G+V H
Sbjct: 554 QLPDTLTLHLKRFKYS---EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVH 610

Query: 780 FGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYV 838
            G    +GHY SL   E        +  W  FDDETV+       L+      + +  YV
Sbjct: 611 MGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYV 662

Query: 839 LFYEKI 844
           LFY+ +
Sbjct: 663 LFYKAM 668

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G  N GNTCY NS+LQCL+  ++ R   L
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENIL 169

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/137 (19%), Positives = 57/137 (41%), Gaps = 26/137 (18%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLEN 590
           + QD  EF   LL++L   ++    ++ +      + ++DS   ++ N            
Sbjct: 430 MHQDAHEFFNFLLNELSEYIERENKKIAAS-----DINSDSEPSKSKN------------ 472

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
                I ++FQG L N ++C  C+  ++    F    + +           D+++ +  +
Sbjct: 473 ----FISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEVQGDEE-----TDIQEILKSY 523

Query: 651 IENEMLTGENAWNCPKC 667
            + EML G N + C +C
Sbjct: 524 HQREMLNGSNKFYCDEC 540

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 46/111 (41%), Gaps = 9/111 (8%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVD---PHLSNSFHILFRKMY 503
           G+ N+GNTCY+N+ LQ L+     R   L+   K+     +D     L       FRK+ 
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRKLR 120

Query: 504 LNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLLDQLHN 548
              G A+ P+L L+    + P     D       QQD +E    L   +  
Sbjct: 121 DKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQT 171

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 14/123 (11%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI--TLKNKEKCRFKLYGVVNHFGN 782
           +LP++L +HL RF  S + + N      + YP  L +  T  +  +  ++L GVV H G+
Sbjct: 644 QLPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGS 703

Query: 783 L-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
              +GHY SL   +        +  W  FDDETV+       L+   +  + +  YVLFY
Sbjct: 704 SPQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLFY 755

Query: 842 EKI 844
           ++I
Sbjct: 756 KEI 758

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           G  N GNTCY NS+LQCL+    FR
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFR 197

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 64/178 (35%), Gaps = 48/178 (26%)

Query: 491 LSNSFHILFRKMYLNGGCAVIP-VLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNE 549
           L + F  +    YL G  A    V  LK  N L   +    +QQD+ EFL  LL++L + 
Sbjct: 500 LKDIFESITENRYLTGIVAPTEFVKILKKENVLFNSM----MQQDSHEFLNFLLNELRDY 555

Query: 550 LKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
           L S  +  ++                                       +FQG L N ++
Sbjct: 556 LPSTTNNFITN--------------------------------------LFQGILTNQIK 577

Query: 610 CQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKC 667
           C  C+  ++    F    + + +         ++E  +  +   EML G N + C +C
Sbjct: 578 CLTCDNITSRDEPFLDFPIGVKDDEE-----TNIETLLRNYHTREMLNGSNKFYCNQC 630

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
           YER151C (REAL)
          Length = 909

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 67/156 (42%), Gaps = 37/156 (23%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPA-------------------- 757
           V  K  +FI KLP +L+I L RFS    ++K+N    Y A                    
Sbjct: 760 VEAKKQTFIDKLPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELII 819

Query: 758 ----ILTITLKNK----EKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWF 808
               + +ITLKN     +  R+KL GV+ H G + + GHYT+ +        + +  KW+
Sbjct: 820 PEESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADV-------YHKEHNKWY 872

Query: 809 YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
             DD  + +  +   L        S   Y+L Y+K+
Sbjct: 873 RIDDVNITELEDDDVLKGGEEASDSRTAYILMYQKV 908

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 509 AVIPVLFLKTCNFLRP--DLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLV 558
           AV P  F KT + +    DL+    Q+D +EFL  LLDQLH EL S  D L 
Sbjct: 556 AVKPDEFYKTLSTIPKFKDLQWGH-QEDAEEFLTHLLDQLHEELISAIDGLT 606

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 87/226 (38%), Gaps = 67/226 (29%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYK-----EYIGTKVDPHLSNSFHILFRK 501
           GL+N G TCY+NS+LQ  F T  FR +     YK     E     V   L  SF++L + 
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV----YKIPSENESPNDSVLLALQRSFYLLQKS 258

Query: 502 MYLNGGCAVIPVLFLKTCNFLRP---DLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLV 558
                         L T    R    D      Q D QE   +L+D+L   +K  +    
Sbjct: 259 NET-----------LDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKGTE---- 303

Query: 559 SEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTST 618
                          VE A                  ++E+F G++++ + C   +Y S+
Sbjct: 304 ---------------VEGA------------------LNELFVGKMKSYIRCINVDYESS 330

Query: 619 NYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
              +F  + L++ N       L  +++    ++E E++ GEN +  
Sbjct: 331 RVEDFWDIQLNVKN-------LKGVQESFDNYVEVEIMDGENQYAA 369

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 18/107 (16%)

Query: 720 TRKSTSFIKLPNLLIIHLSRFSMS---GLLDKNNTDIAYPAILTIT--------LKNKEK 768
            +K   F   P++L + L RF        L K N    +P  + ++         KN   
Sbjct: 377 AKKGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGP 436

Query: 769 CRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           C + L+GV+ H G ++ GHY ++I      D+  Q   WF FDD+ V
Sbjct: 437 CVYNLHGVLVHSGEISVGHYYAMIKP----DVGDQ---WFRFDDDKV 476

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 136/367 (37%), Gaps = 107/367 (29%)

Query: 491 LSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRI-PDVQQDTQEFLILLLDQLHNE 549
           L + F  +     L G   V P+ F++T    R +L     + QD  EFL  LL++L   
Sbjct: 413 LKDIFECITENHSLTG--VVSPISFVET--LKRENLLFNTTMHQDAHEFLNFLLNELS-- 466

Query: 550 LKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLE 609
                        + I+ D DS+  + A +Y  +            I+ +FQG L   ++
Sbjct: 467 -------------EYIQKDIDSIQ-DPAKKYDNF------------INGLFQGTLTYRIK 500

Query: 610 CQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXX 669
           C  C+  ++    F    + + +         D++  +  + + EML+G N + C +C  
Sbjct: 501 CLTCDNVTSRDEPFLDFPIEVQDDEE-----TDIQALLRSYQQREMLSGSNKFYCDECCG 555

Query: 670 XXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKL 729
                                                               +     +L
Sbjct: 556 LQE-----------------------------------------------AERKVGLKQL 568

Query: 730 PNLLIIHLSRFSMSGLLDKNNTDIA------YPAIL--TITLKNKEKCRFKLYGVVNHFG 781
           P+ L +HL RF  S   ++ N +I       YP  L    +  +    +++L G+V H G
Sbjct: 569 PHTLALHLKRFKYS---EEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMG 625

Query: 782 NL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNV-NRISSSDVYVL 839
               +GHY SL   +           W  FDDETV +  +   + K + +R S +  YVL
Sbjct: 626 GGPQHGHYVSLCKND--------NFGWLLFDDETV-EAVHESTVSKFIGDRDSLTTAYVL 676

Query: 840 FYEKIIE 846
           FY++I +
Sbjct: 677 FYKEIAQ 683

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G  N GNTCY NS+LQCL+  T FR L L
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 33/152 (21%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSM----------------SGLLDKNNTDIAYPAILTI 761
           V  K  +FI KLP +L+I L RFS                 SG ++K    I+Y   L I
Sbjct: 670 VEAKKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEI 729

Query: 762 --------TLKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
                    L+N     ++L GV+ H G + + GHYT+ +        + Q + W+  DD
Sbjct: 730 PDETLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTADV-------FHKQTKTWYRIDD 782

Query: 813 ETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
             + +  +   L    + + S   Y+L Y+ +
Sbjct: 783 VNITKLEDDDVLKGGEDNMDSRTAYILMYQNV 814

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 52/141 (36%), Gaps = 30/141 (21%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLF--LSNRYKEYIGTKVDPHLSNSFHILFRKM-- 502
           G+ N  N C+++S+LQ L     F ++   +S R            L ++   +++K   
Sbjct: 375 GIINNANICFMSSVLQVLLYCAPFVDILNVVSTRNMNAKSGSSSAKLLDACLTIYKKFDK 434

Query: 503 -------------YLNGGCAVIPVLFLKTCNFLRPD------LRIPDV-------QQDTQ 536
                           G     P  +      + PD        IP         Q+D +
Sbjct: 435 ANYEKEKEKESEKEKPGSKKSSPPAYASITEAVNPDEFYRSLSTIPKFKDLRWGHQEDAE 494

Query: 537 EFLILLLDQLHNELKSNQDRL 557
           EFL  LLDQLH EL S  D L
Sbjct: 495 EFLTHLLDQLHEELISAIDSL 515

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP--HLSNSFHILFRKMY- 503
           G +N+GNTCY+NS LQ LF     +++ L+ + +   G  + P   L +   I  +K + 
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTE---GNNISPEDELHHKIVIELKKCFE 166

Query: 504 -LNGG--CAVIPVLFLKTCNFLRPDLRIPDV------QQDTQEFLILLLDQL 546
            L+G    AV+PV+ L       P     D       QQD +E    L   L
Sbjct: 167 TLDGKKFKAVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTL 218

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 115/320 (35%), Gaps = 89/320 (27%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLEN 590
           +QQD  EFL  LL+               +  + IE  T S+++           E++  
Sbjct: 434 MQQDAHEFLNFLLN---------------DSSEYIECHTSSVNI--------VPQENMNG 470

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              + I ++F+G L N ++C  C+  ++    F    + +           D++  +  +
Sbjct: 471 TSDNFITDLFKGTLTNRIKCLTCDNITSRDEPFLDFPIEVQGDDE-----TDIQKILKSY 525

Query: 651 IENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXX 710
            + EML G N + C KC                             L  +E         
Sbjct: 526 HQREMLNGVNKFYCNKCY---------------------------GLQEAE--------- 549

Query: 711 XXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI--TLKN 765
                  +V  K   +I     L +HL RF  S   + N      I YP  L +  T   
Sbjct: 550 ------RIVGLKQVPYI-----LSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDT 598

Query: 766 KEKCRFKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDL 824
               R++L GVV H G+   +GHY  +   E        +  W  +DDETV+       L
Sbjct: 599 SVSKRYELSGVVIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVL 650

Query: 825 DKNVNRISSSDVYVLFYEKI 844
               +    +  YVLFY++I
Sbjct: 651 KFTGHSGDQTTAYVLFYKEI 670

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 15/73 (20%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR--------NLFLSNRYKE--YIGTKVDPHLSNSFH 496
           G  N GNTCY NS+LQCL+    FR         + +SNR ++    G+KV    + SF 
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERIPVSNRIRKSNLTGSKVRVFTNESFE 196

Query: 497 ILFRKMYLNGGCA 509
           +       NGG +
Sbjct: 197 V-----STNGGSS 204

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 18/114 (15%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL--------SNRYKEYIGTKVDPHLSNSFHIL 498
           GL+N+GNTCY+N+ LQ LF     ++L L        ++   + I  K+   L  +F  L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 499 FRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLLDQL 546
            ++ +     +V+P++ L T     P     D       QQD +E    L   L
Sbjct: 170 KKRSF----KSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTL 219

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 115/317 (36%), Gaps = 94/317 (29%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLEN 590
           + QD  EFL  L++ L + L+    RL  + P+                           
Sbjct: 429 MHQDAHEFLNFLMNALSDSLQLQLQRLPDKSPE--------------------------- 461

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              + IH +FQG + NS++C  C+  ++N   F   ++ +          ++++D +  F
Sbjct: 462 ---NFIHTLFQGTMNNSIKCLTCDNITSNEEPFFDFAIPVSEDEE-----LNVQDILRDF 513

Query: 651 IENEMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXX 710
            + EML G N + C  C                        R      +SE         
Sbjct: 514 HQREMLNGANKFYCDSCNGLQEAERTVGIKELPELLPLHLKR----FKYSE--------- 560

Query: 711 XXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLK-NKEKC 769
                      K  S IKL N  +IH                  YP  L +    +   C
Sbjct: 561 -----------KHQSNIKLFN--VIH------------------YPLNLRVCSTFDHAVC 589

Query: 770 R-FKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ--QFNYFDLD 825
           + ++L G+V H G    +GHY ++      H+L      W  +DDETV+   +       
Sbjct: 590 KDYELNGIVIHMGGGPQHGHYVAIC----KHELF----GWLLYDDETVESVGEDAVLRFI 641

Query: 826 KNVNRISSSDVYVLFYE 842
            +VN ++++  YVLFY+
Sbjct: 642 GDVNDMTTA--YVLFYK 656

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           GL N GNTCY NS+LQCL+     R
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELR 124

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 56/129 (43%), Gaps = 24/129 (18%)

Query: 728 KLPNLLIIHLSRFSMS-------GLLDKNNTDIAYPAILTI--TLKNKEKCRFKLYGVVN 778
           +LP  L +HL RF  S        L +K    I YP  LT+  T  +K   R++L   V 
Sbjct: 511 RLPKTLSLHLKRFKYSEDKMANIKLFNK----IDYPTFLTVSSTFDSKLSKRYELASAVI 566

Query: 779 HFGNLNN-GHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVY 837
           H G+    GHY SL   E           W  FDDETV+       L  +    +S   Y
Sbjct: 567 HLGDGPQYGHYISLCKTETF--------GWLLFDDETVEAVDEQTVL--SFTGENSDTAY 616

Query: 838 VLFYEKIIE 846
           VLFY ++ E
Sbjct: 617 VLFYNEVSE 625

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 20/32 (62%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           I G  N GNTCY NS+LQC F  + FR   LS
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 595 LIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENE 654
            + +IFQG L N + C  C+  ++    F   ++ +     K  + ++++  +  F + E
Sbjct: 430 FVQDIFQGSLTNQIRCYTCDSITSTEEPFLDFAIEV-----KEDENLNIQRHLESFHQRE 484

Query: 655 MLTGENAWNCPKC 667
           +L G + + C +C
Sbjct: 485 LLNGSDKFYCDRC 497

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 81/229 (35%), Gaps = 72/229 (31%)

Query: 596 IHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEM 655
           I+++FQG ++ +  C  C+  ++    F   ++ + N         ++++ +  + + EM
Sbjct: 439 INDLFQGVIKYTTRCLTCDNITSREELFLDFAIEVSNNEE-----TNIQEILGDYSQREM 493

Query: 656 LTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXX 715
           L G N + C  C                                                
Sbjct: 494 LNGSNKFFCDCCSGLQE------------------------------------------- 510

Query: 716 XXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTITLKNKEKC 769
                 +     KLP  LI+HL RF  S   ++ N++I       YP +L ++  +    
Sbjct: 511 ----AERIVGLKKLPETLILHLKRFKYS---EEQNSNIKLFNKINYPLVLQVSSTSNSDI 563

Query: 770 --RFKLYGVVNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
              + L G+V H G    +GHY S+   E        +  W  FDDE V
Sbjct: 564 SKSYDLTGIVLHLGGGPQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRN 472
           G  N GNTCY NS+LQCL+     R+
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRD 138

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
           UBP3Ubiquitin-specific protease involved in transport
           and osmotic response; interacts with Bre5p to
           co-regulate anterograde and retrograde transport between
           the ER and Golgi; involved in transcription elongation
           in response to osmostress through phosphorylation at
           Ser695 by Hog1p; inhibitor of gene silencing; cleaves
           ubiquitin fusions but not polyubiquitin; also has mRNA
           binding activity
          Length = 912

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 65/155 (41%), Gaps = 37/155 (23%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPA-------------------- 757
           V  K  +FI KLP +L+I   RFS    ++K+N    Y A                    
Sbjct: 763 VEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELII 822

Query: 758 ----ILTITLKNK----EKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWF 808
               + +ITLKN     +  R+KL GV+ H G + + GHYT+ +        + +  KW+
Sbjct: 823 PEESMSSITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTADV-------YHSEHNKWY 875

Query: 809 YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
             DD  + +  +   L        S   Y+L Y+K
Sbjct: 876 RIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 910

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 509 AVIPVLFLKTCNFLRP--DLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLV 558
           AV P  F KT + +    DL+    Q+D +EFL  LLDQLH EL S  D L 
Sbjct: 559 AVKPDEFYKTLSTIPKFKDLQWGH-QEDAEEFLTHLLDQLHEELISAIDGLT 609

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 90/253 (35%), Gaps = 39/253 (15%)

Query: 576 NANEYKKWFAESLENE---------------GLSLIHEIFQGQLENSLECQRCNYTS-TN 619
           +A+E+ +   E+LE E               GL++     +G L ++L C RC  +S  N
Sbjct: 214 DAHEFTQLLLETLEKEHTELSLMLKGDKRLEGLAVPAFPIRGSLADNLVCLRCGGSSKVN 273

Query: 620 YSNFCTLSLSIPNKRRK-FRKL--------VDLEDCISLFIENEMLTGENAWNCPKCXXX 670
              F   +L +PN      R +        +D   C+S  I   + T +N          
Sbjct: 274 VHQFSMHTLPVPNATSADLRDMLFDNQTETIDDYTCVSCQIRAILATEKNRGR-QGVDST 332

Query: 671 XXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLP 730
                                  H     S YN +                K T  +  P
Sbjct: 333 ELAIIEELARLAPSISINEDMPPHLAAYVSAYNKDHCITAALKSTIV----KRTVSVDSP 388

Query: 731 NLLIIHLSRFSMSGL-LDKNNTDIAYPAILTI--TLKNKEKC------RFKLYGVVNHFG 781
            +LI+HLSR   +G+   KN  ++ +P  L I   L    KC      R+KL  ++ H G
Sbjct: 389 RVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVRAVRYKLCAMIKHIG 448

Query: 782 NLNNGHYTSLINK 794
             + GHY    +K
Sbjct: 449 THSQGHYACFRHK 461

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 46/113 (40%), Gaps = 25/113 (22%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPH----------LSNSFH 496
           GL+N+GNTCY+N+ LQ LF   + R+L L+     Y   K  P           +   F 
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILN-----YDPAKASPQDEMHHKIVLEMKRCFE 162

Query: 497 ILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDV------QQDTQEFLILLL 543
            L  K Y     +V+P++ L       P     D       QQD +E    L 
Sbjct: 163 NLENKSY----KSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLF 211

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 84/208 (40%), Gaps = 53/208 (25%)

Query: 439 LYVQLSISGLRNLGNTCYINSMLQCLFATTAFRN-LF--LSNRYKEYIGTKVDPH-LSNS 494
           ++  L   GL N G TCY N+ +Q +    A ++ LF  L  +YK      +DP+ +S +
Sbjct: 435 VFANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYKN-----IDPNSVSYT 489

Query: 495 FHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDV--------QQDTQEFLILLLDQL 546
                R+M+L+       V+     N L    R+ D+        Q+D+ E+ + L+ +L
Sbjct: 490 LAETTRRMWLSNKKGNKKVIAYYNPNELIE--RLDDINWSMNPYNQEDSHEYFMSLMSKL 547

Query: 547 HNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLEN 606
                                       EN+    +   ES+       I++IF G LE 
Sbjct: 548 Q---------------------------ENSVPIGRNMTESI-------IYDIFGGLLEQ 573

Query: 607 SLECQRCNYTSTNYSNFCTLSLSIPNKR 634
           ++ C+ C   S     F  LSL +  KR
Sbjct: 574 TVTCKSCGGVSKTEQEFYDLSLDLNGKR 601

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 95/243 (39%), Gaps = 63/243 (25%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPH---LSNSFHILFRKMY 503
           GL N+G+TC+++S+LQ L       N  +S  +  ++   +      +S +   +  + Y
Sbjct: 139 GLVNMGSTCFMSSILQALIHNPYIVNYSMSQTH--FVNCSIKNSSLCMSCALDAMIIEFY 196

Query: 504 LNGGCAVIPV------------------LFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQ 545
             G   + P+                  + L TC+    +      QQD  EFL   L+Q
Sbjct: 197 --GQSKLQPISSSSSSSSSSSSSSPSAFISLLTCSLKINENFAGYSQQDAHEFLQYFLNQ 254

Query: 546 LHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLE 605
           LH +                 Y  DS   E             EN    + H IFQG+L+
Sbjct: 255 LHQD-----------------YKRDSSHNEQ------------ENNCPCVAHSIFQGELK 285

Query: 606 NSLECQRC-NYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNC 664
           +S+ C  C N + T    F  LSL I +K        DL  C+  F + E L   N ++C
Sbjct: 286 SSIVCPECQNDSKTIIDPFMDLSLDIKDK-------TDLYQCLDSFHKKEKLHDFN-YHC 337

Query: 665 PKC 667
            +C
Sbjct: 338 SRC 340

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 26/109 (23%)

Query: 728 KLPNLLIIHLSRFS--MSGLLDKNNTDIAYPAILTI-------TLKNKEKCRFKLYGVVN 778
           KLP +L++ L RF   ++G   K N  + YP  L +       T +      ++L G+++
Sbjct: 354 KLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIYELTGILS 413

Query: 779 HFGNLNNGHYTSLINKEPSHDLNPQRQKWFYF---------DDETVKQQ 818
           H G++N GHY  ++       +N  R  WF F         +DE +KQQ
Sbjct: 414 HIGSINEGHYVVVLK------INDGR--WFKFNDSMISVIKEDEALKQQ 454

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
           YER151C
          Length = 795

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 72/179 (40%), Gaps = 34/179 (18%)

Query: 692 RSHNDL--TFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKN 749
           RS NDL   F +++              +  +K T   KLP +L+I L RF      DK+
Sbjct: 623 RSVNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQLKRFQFINNTDKD 682

Query: 750 NTDIAYPA---------------------ILTITLKNK---EKCRFKLYGVVNHFG-NLN 784
           N+ I Y A                     I +I+  N    E  ++ L GV+ H G + +
Sbjct: 683 NSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNALRDEDRQYSLSGVIYHHGLSSD 742

Query: 785 NGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
            GHYT+ +        + +  KW+  DD  + +      L    + + S   Y+L Y+K
Sbjct: 743 GGHYTADV-------YHKETDKWYRIDDINITEVQKDSVLKGGEDGVDSRTAYILMYQK 794

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 78/398 (19%), Positives = 145/398 (36%), Gaps = 119/398 (29%)

Query: 442 QLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRK 501
           QL   GL N G TCY N+ +Q +    + ++        ++  T     ++       ++
Sbjct: 358 QLKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQSVTQVLAETSKR 417

Query: 502 MYL---NGGCAVIP---VLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQD 555
           M+    N    + P   +  L   N +  + +    Q+D+ E+ + L+ +L       Q+
Sbjct: 418 MWSPEPNKNTYINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLMSRL-------QE 466

Query: 556 RLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNY 615
             V     L E                           S+I++IF G L   + C+ C  
Sbjct: 467 DSVPRGHKLTE---------------------------SIIYDIFGGLLHQKVTCKSCGG 499

Query: 616 TSTNYSNFCTLSLSIPNKRRKFRKLVD-----------LEDCISLFIENEMLT--GENAW 662
            S     F  LSL +  K++    + +           +E  IS F   E++    ++ +
Sbjct: 500 VSKTEQPFYDLSLHLKGKKKSDETVPENQEDVPQRRYSIEKSISDFFNPELIKVDKKDGY 559

Query: 663 NCPKCXXXXXXXXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRK 722
            C KC                       +++ N +                        K
Sbjct: 560 VCEKC-----------------------HKTTNAI------------------------K 572

Query: 723 STSFIKLPNLLIIHLSRFSMSGL-LDKNNTDIAYPAILTIT--LKNKEK---CRFKLYGV 776
             S ++ P  L+IHL +F  +G    K    ++YP  L ++   ++++K    +++L  V
Sbjct: 573 RNSILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDMSEYCEDQQKTLPVKYQLISV 632

Query: 777 VNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813
           V H G +L++GHY +   K+P          W  +DDE
Sbjct: 633 VVHEGRSLSSGHYIAHC-KQPD-------GSWATYDDE 662

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 83/210 (39%), Gaps = 60/210 (28%)

Query: 440 YVQLSISGLRNLGNTCYINSMLQCLFATTAFR---NLFLSNRYKEYIGTKVDPHLSNSFH 496
           Y +L   GL N G TCY N+ +Q L    A +   N  L+ +Y   I +    H+     
Sbjct: 379 YSKLKPKGLLNHGVTCYTNAAVQALLHIPAMQHYLNDILAGKYSSTISSNSVSHV---LA 435

Query: 497 ILFRKMYLNGGCAVIPVLFLKTCN-FLRPD---LRIPDV--------QQDTQEFLILLLD 544
              R+M+ N G         K+ N ++ P     R+ D+        Q+D+ E+ + ++ 
Sbjct: 436 ETSRRMWHNDG--------KKSGNSYINPKKLIARLDDINCMMSEWQQEDSHEYFMSIMS 487

Query: 545 QLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQL 604
           +L       Q+  V +   + E                           S+I++IF G L
Sbjct: 488 RL-------QEDSVPKGHKMTE---------------------------SIIYDIFGGSL 513

Query: 605 ENSLECQRCNYTSTNYSNFCTLSLSIPNKR 634
           + ++ C+ C   ST    F  LSL +  K+
Sbjct: 514 KQTVTCKSCGEVSTTEQPFYDLSLHLKGKK 543

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 6/109 (5%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP--HLSNSFHILFRKMYL 504
           GL N+GN+CY+NS+LQCLF    +         +E+    V P  +L      L+R M L
Sbjct: 321 GLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNNLRCQLIKLYRAMKL 380

Query: 505 NGGC---AVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
                   + P  F K C     +      QQD  EFL  ++D L  +L
Sbjct: 381 EPELYPQGIKPQSF-KKCFSAGHEEFASQRQQDAMEFLTYMIDNLDKKL 428

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 63/130 (48%), Gaps = 30/130 (23%)

Query: 729 LPNLLIIHLSRFSMSGLLDKNNTD------IAYPAILTI--TLKNKEKCRFKLYGVVNHF 780
           LP +L +HL RF  S   ++NN +      I YP+ L +  T       +++L G++ H 
Sbjct: 549 LPKILSLHLKRFKYS---EENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHL 605

Query: 781 G-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNR-ISSSD--- 835
           G    +GHY ++   E        +  W  +DDETV+       L+K+V R +  S+   
Sbjct: 606 GAGPQHGHYVAMCKTE--------KFGWLLYDDETVEAV-----LEKDVLRHVGDSNDLA 652

Query: 836 -VYVLFYEKI 844
             Y+LFY+ I
Sbjct: 653 TAYILFYKTI 662

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 596 IHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEM 655
           I  IFQG L N + C  C+  ++    F  L + +     K R   D++  +S + + EM
Sbjct: 468 IKNIFQGTLTNKIRCLTCDNVTSRDEPFLDLPIEV-----KSRNETDIKKALSNYHQREM 522

Query: 656 LTGENAWNCPKC 667
           L G N + C  C
Sbjct: 523 LNGSNKFYCDGC 534

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR-NLFL 475
           G  N GNTCY NS+LQCL+  +  R NL L
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLIL 157

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 22/113 (19%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPH----------LSNSFH 496
           G +N+GNTCY+N+ LQ LF     R L L+   K +  T ++P           L + F 
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAF--TNLNPQDEMHHKLILELKHCFE 166

Query: 497 ILFRKMYLNGGCAVIPVLFLKTCNFLRPDL--RIPDV----QQDTQEFLILLL 543
            L +K Y     +V+P++ +     + P    R P      QQD +E    L 
Sbjct: 167 SLKQKNY----QSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELFTQLF 215

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
           similar to uniprot|Q01477 Saccharomyces cerevisiae
           YER151C UBP3 Ubiquitin-specific protease that interacts
           with Bre5p to co-regulate anterograde and retrograde
           transport between endoplasmic reticulum and Golgi
           compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 64/152 (42%), Gaps = 33/152 (21%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPA-------------------- 757
           V  K  +FI +LP +L+I L RF      DK+N+ + Y A                    
Sbjct: 682 VEAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELII 741

Query: 758 -ILTITLKNK---EKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
            I +I+  N    E  R+ L GV+ H G + + GHYT+ +        + +  KW+  DD
Sbjct: 742 PIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTADV-------YHRESDKWYRIDD 794

Query: 813 ETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
            ++ +      L        S   Y+L Y+KI
Sbjct: 795 VSIIELEKEDVLKGGEESGDSRTAYILMYQKI 826

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 61/151 (40%), Gaps = 33/151 (21%)

Query: 720 TRKSTSFIKLPNLLIIHLSRFSM---------------SGLLDKNNTDIAYPAILTI--- 761
            +K T   KLP + +I L RFS                SG ++K    I + + LTI   
Sbjct: 301 AQKQTFIDKLPEVFLIQLKRFSFINNTDKSKVVNYNAYSGRVEKIRKKIRFGSELTIPSS 360

Query: 762 -------TLKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813
                      +    +KL GVV H G + + GHYT  + +E        ++KWF  DD 
Sbjct: 361 AISSVHANFYKESGSTYKLIGVVYHHGVSSSGGHYTCDVYQEA-------QKKWFRIDDI 413

Query: 814 TVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
            V++      L        S   Y+L Y+K+
Sbjct: 414 NVQEIEMEEVLQPGEEGSDSRTAYILIYQKL 444

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 56/140 (40%), Gaps = 36/140 (25%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILF------- 499
           G+ N GN C+++S+LQ L     F +L         I  K    + N+  +L        
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLM------NLISIKTSAKMGNTGFLLLDACLELY 63

Query: 500 -----------RKMYLNGGC---------AVIPVLFLKTCNFLRP--DLRIPDVQQDTQE 537
                      +   +N G          A+ P  F KT + L    DLR    Q+D +E
Sbjct: 64  RKFDKVTFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRWGH-QEDAEE 122

Query: 538 FLILLLDQLHNELKSNQDRL 557
           FL  LLDQLH E   + D L
Sbjct: 123 FLTHLLDQLHEEFVQSIDSL 142

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 47/108 (43%), Gaps = 7/108 (6%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRY-KEYIGTKVDPHLSNSFHILFRKMYLN 505
           GL+NLGNTCY+NS LQ L+     R+  L+ +  +E    +    L +     F+++   
Sbjct: 61  GLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHHQLVSELRRCFQQLKDK 120

Query: 506 GGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLLDQLH 547
              +V P+L L       P     D       QQD +E    + + L 
Sbjct: 121 PQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQIFNSLR 168

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 58/137 (42%), Gaps = 33/137 (24%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLEN 590
           + QD  EFL  LL++L + LK +           +E DTD +      E K  F      
Sbjct: 399 MHQDAHEFLNYLLNELSDTLKRD-----------MELDTDKL------ESKPTF------ 435

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
                I ++F+G L NS +C  C+  +     F    + I          + ++D ++ +
Sbjct: 436 -----IEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIEIQEDEE-----IKIQDILNNY 485

Query: 651 IENEMLTGENAWNCPKC 667
              E+LTG N + C KC
Sbjct: 486 KHRELLTGANKFYCDKC 502

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 19/29 (65%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G  N GNTCY NS+LQCL+  T FR   L
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 57/130 (43%), Gaps = 28/130 (21%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTD------IAYPAILTITLKNKEKCR--FKLYGVVNH 779
           +LP  L IHL RF  S   D++ T+      I YP  L ++    E     ++L G+V H
Sbjct: 526 ELPKTLAIHLKRFKYS---DEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVH 582

Query: 780 FG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV----KQQFNYFDLDKNVNRISSS 834
            G    +GHY S+               W  FDDETV    +     F  D N    S+ 
Sbjct: 583 IGIGPQHGHYISVCKT--------SDYGWLLFDDETVECISEDTVLSFVGDSN----SAG 630

Query: 835 DVYVLFYEKI 844
             YVLFY++I
Sbjct: 631 TAYVLFYKEI 640

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 62/139 (44%), Gaps = 32/139 (23%)

Query: 530 DVQQDTQEFLILLLDQLHNEL-KSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESL 588
           D+ QD  EFL  LL+ + + L K+N ++    +PD         +  + NE         
Sbjct: 405 DMHQDAHEFLNFLLNDVSDYLDKANTEK----NPD---------NTRSGNE--------- 442

Query: 589 ENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCIS 648
                + +++IF+G + N + C  C+  ++ Y +F    + +        + +D++  + 
Sbjct: 443 ----TNFVNDIFKGTITNQIRCLTCDTVTSRYESFLDFPIEVIGD-----ETIDIQKMMI 493

Query: 649 LFIENEMLTGENAWNCPKC 667
            + + EML G N + C  C
Sbjct: 494 SYHQKEMLQGSNKFYCGTC 512

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           GL N GNTCY NS+LQCL+    FR   L 
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILG 161

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
           YER151C (REAL)
          Length = 905

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 63/155 (40%), Gaps = 37/155 (23%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPA-------------------- 757
           V  K  +FI KLP +L+I   RFS    +DK+N    Y A                    
Sbjct: 756 VEAKKQTFIDKLPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKKIKYGHELII 815

Query: 758 ----ILTITLKNKEKC----RFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWF 808
               + +ITLKN         +KL GV+ H G + + GHYT+ +        + +  KW+
Sbjct: 816 PEESMSSITLKNHATGIADRNYKLTGVIYHHGISSDGGHYTADV-------YHSEHNKWY 868

Query: 809 YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
             DD  + +  +   L        S   Y+L Y+K
Sbjct: 869 RIDDVNIIELEDDDVLKGGEEASDSRTAYILMYQK 903

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 21/120 (17%)

Query: 440 YVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFL----------SNRYKEYIGTKVDP 489
           + QL + G +N+GNTCY+N+ LQ L+     R++ L          S    E I  ++  
Sbjct: 104 FAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVI 162

Query: 490 HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDV------QQDTQEFLILLL 543
            +   F  L  K +     +V+P++ L T     P     D       QQD +E    L 
Sbjct: 163 EMKRCFENLQNKSFK----SVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQLF 218

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 25/118 (21%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK-----VDP---------HLS 492
           GL NLGN+CY+NS+LQC      F N  + N   E +GT+     V P          L+
Sbjct: 327 GLINLGNSCYLNSILQC------FYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLT 380

Query: 493 NSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNEL 550
           N+  I    +Y NG   + P  F K       +    + QQD  EFL  ++D L N++
Sbjct: 381 NAMKI-ESDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKI 433

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 53/128 (41%), Gaps = 18/128 (14%)

Query: 432 HLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS-NRYKEYIGTKVDPH 490
            L  SS+L +     G +N+GNTCY+NS LQ L+     R L LS N  +    +  D  
Sbjct: 99  QLQRSSDLPI-----GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADST 153

Query: 491 LSNSFHIL------FRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDV------QQDTQEF 538
           + +   I+      F+ +      +V+P++ L       P     D       QQD +E 
Sbjct: 154 VESHKKIVLELQRCFQNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEEL 213

Query: 539 LILLLDQL 546
              L   L
Sbjct: 214 FTQLFHSL 221

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI 497
           +G+ N+GNTCY+NS+LQ  F+    R   L   Y++ +    D HLSNS HI
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTVENFND-HLSNSGHI 784

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 99/226 (43%), Gaps = 50/226 (22%)

Query: 447 GLRNLGNTCYINSMLQCLFA--TTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYL 504
           GL NLGN+CY+NS+LQ LFA   + + ++ +    K++    V P  SN           
Sbjct: 320 GLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYP--SN----------- 366

Query: 505 NGGCAVIPVLFLKTCNFLR-PDLRIPDVQQDTQEFLILLLDQLHNELKSN--QDRLVSEH 561
           N  C +I +L     N  R P+   P   ++        + Q + E  SN  QD L    
Sbjct: 367 NVKCQLIKLLNAMKINPSRYPEGIKPRSFKNC-------IGQNNKEFTSNKQQDAL---- 415

Query: 562 PDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYS 621
            + + Y  + +D       KK F + L N G     ++ +  +E+ L+C RC +    YS
Sbjct: 416 -EFLSYFVNELD-------KKLFKKELTNPG-----DLMRCYMEDRLQCLRCKHVK--YS 460

Query: 622 NFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKC 667
                S+ +P K     +  D+ + +  F + E++     +NCP C
Sbjct: 461 YQANESIQLPLKDNNEPQ--DIRERLDAFFKGEVI----EFNCPHC 500

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT--KVDPHLSNSFHI 497
           +G+ N+GNTCY+NS+LQ  F+    R   L     EY  T    + HLSNS H+
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL-----EYQKTLDNFNDHLSNSGHV 784

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 33/65 (50%), Gaps = 12/65 (18%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           G  N GNTCY NS+LQCL+  + FR   L  RY E +     P +S       RK  LNG
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVL--RYPERV-----PVVSR-----IRKSDLNG 174

Query: 507 GCAVI 511
             A I
Sbjct: 175 SKARI 179

 Score = 38.5 bits (88), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 14/122 (11%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI--TLKNKEKCRFKLYGVVNHFGN 782
           +LP +L +HL RF  S     N      I YP  L +  T  +    +++L GVV H G+
Sbjct: 545 QLPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGS 604

Query: 783 L-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
              +GHY  +   E        +  W  +DDETV+       L    +    +  YVLFY
Sbjct: 605 GPQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLKFTGHPGDQTTAYVLFY 656

Query: 842 EK 843
           ++
Sbjct: 657 KE 658

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 54/143 (37%), Gaps = 40/143 (27%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSM------DVENANEYKKWF 584
           +QQD  EFL  LL+                  + IE     M      D+ NAN+     
Sbjct: 423 MQQDAHEFLNFLLNDF---------------SEYIERRNSGMQFGPKKDIVNAND----- 462

Query: 585 AESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLE 644
                    + I ++F+G L N ++C  C+  ++    F    + +           D++
Sbjct: 463 ---------NFIADLFKGTLTNRIKCLTCDNITSRDEPFLDFPIEVQGDDE-----TDIQ 508

Query: 645 DCISLFIENEMLTGENAWNCPKC 667
             +  + + EML G N + C KC
Sbjct: 509 KILRSYHQREMLNGVNKFYCNKC 531

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/258 (20%), Positives = 104/258 (40%), Gaps = 48/258 (18%)

Query: 423 TRYTKYGLPHL----PHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNR 478
           TR   +G P L    P+SSN +   S   +    +T    +  +   +    R   L+  
Sbjct: 286 TRRISHGSPPLGSTPPYSSNSFTPSSPPNISPTSSTRPEETSSEERKSAALIRGPVLNVD 345

Query: 479 YK--EYIGTKVDPHLSNSFHILFRKM----YLNGGCAVIPVLFLKTC---NFLRPDLRIP 529
           +   +++     P L  +   L+  +    YL G   V P+ F++T    N L   +   
Sbjct: 346 HSLIDFLPAGEKPGLYTALKDLYESITENKYLTG--VVSPIQFVETLKKENVLFSTM--- 400

Query: 530 DVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE 589
            + QD  EFL  LL+++ + L ++ +++              +DV+N  +          
Sbjct: 401 -MHQDAHEFLNFLLNEVSDYLGAHSEQIAQ-----------GLDVKNPGD---------- 438

Query: 590 NEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISL 649
              ++ ++ +FQG L N  +C  C+ T+     F   ++ +           D++  ++ 
Sbjct: 439 ---INFVNRLFQGTLTNRTKCLTCDNTTYRNEPFLDFAIEVQQDSE-----TDIQTTLAD 490

Query: 650 FIENEMLTGENAWNCPKC 667
           F + E+L G N + C  C
Sbjct: 491 FHQKELLNGANKFYCDVC 508

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI 497
           +G+ N+GNTCY+NS+LQ  F+    R+  L+  Y++ +    D HLSNS H+
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLNNFND-HLSNSEHV 784

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI 497
           +G+ N+GNTCY+NS+LQ  F+    R   L   Y++ +    D HLSNS H+
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFND-HLSNSGHV 783

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 79/207 (38%), Gaps = 48/207 (23%)

Query: 440 YVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILF 499
           +  L   GL N G TCY N+ +Q +    A ++        +Y  T     +S +     
Sbjct: 338 FTNLKPRGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLLGKYDSTISKNSVSYTLAETS 397

Query: 500 RKMYL---NGGCAVIPVLFLKTCNFLRPDLRIPDV--------QQDTQEFLILLLDQLHN 548
           +KM+L          P  ++   + +    R+ D+        Q+D+ E+ + L+ +L  
Sbjct: 398 KKMWLPLSKNYKKNSPASYINPKHLIS---RLDDINCMMSEWQQEDSHEYFMSLMSRL-- 452

Query: 549 ELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSL 608
                Q+  V +   LIE                           S+I++IF G L+  +
Sbjct: 453 -----QEDSVPKGHKLIE---------------------------SIIYDIFGGLLKQIV 480

Query: 609 ECQRCNYTSTNYSNFCTLSLSIPNKRR 635
            C+ C  TS     F  LSL +  KRR
Sbjct: 481 TCKSCGSTSKTEQPFYDLSLHLKGKRR 507

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
           YER151C (REAL)
          Length = 910

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 62/155 (40%), Gaps = 37/155 (23%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPA-------------------- 757
           V  K  +FI KLP +L+I   RFS    ++K+N    Y A                    
Sbjct: 761 VEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELII 820

Query: 758 ----ILTITLKNKEKCR----FKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWF 808
               + +ITLKN         +KL GV+ H G   + GHYT+ +        + +  KW+
Sbjct: 821 PEESMSSITLKNHTSGADDRIYKLTGVIYHHGVGSDGGHYTADV-------YHSEHNKWY 873

Query: 809 YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
             DD  + +  +   L        S   Y+L Y+K
Sbjct: 874 RIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 908

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 63/151 (41%), Gaps = 32/151 (21%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKC-------- 769
           V  K  +FI +LP +L++ L RFS     DK+N  + Y +I     K ++K         
Sbjct: 711 VEAKKQTFIDRLPQVLLVQLKRFSFVNNEDKDNNMMNYNSINGRIEKIRKKISYGHELVI 770

Query: 770 ---------------RFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813
                          +++L GV+ H G + + GHYT+ +        N    KW+  DD 
Sbjct: 771 PEESLSPHSWSQTNRKYQLTGVIYHHGLSSDGGHYTADV-------FNKTADKWYRIDDI 823

Query: 814 TVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
            + +      L    +   +   Y+L Y+K+
Sbjct: 824 NITELKKDDVLKGGEDGTDTRTAYILMYQKL 854

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 35/152 (23%)

Query: 720 TRKSTSFIKLPNLLIIHLSRF---------------SMSGLLDKNNTDIAYPAILTI--- 761
            +K T   KLP  L+I   RF               S +G ++K    + Y   LTI   
Sbjct: 628 AKKHTCIDKLPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHELTIPKE 687

Query: 762 --------TLKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDD 812
                   T  ++E  ++ L GV+ H G + + GHYT  +  +   DL+    KW+  DD
Sbjct: 688 SISPNLVSTSNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDK---DLD----KWYRIDD 740

Query: 813 ETVKQQFNYFDLDKNVNRISSS-DVYVLFYEK 843
             V +  N  D+ ++ +  S S   Y+L YEK
Sbjct: 741 VNVDEIKNKEDILRSGDSASDSRTAYILLYEK 772

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
           Anc_8.202 YER151C
          Length = 829

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 64/152 (42%), Gaps = 37/152 (24%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSM----------------SGLLDKNNTDIAYPAILTI 761
           V  K  +FI KLP +L+I L RFS                 +G ++K    I Y   L I
Sbjct: 687 VEAKKQTFIDKLPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELII 746

Query: 762 ---------TLKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFD 811
                    T+ N+E   + L GV+ H G + + GHYT+ +       L+ + +KW+  D
Sbjct: 747 PSESVSSNATMSNRE---YSLTGVIYHHGLSPDGGHYTADV-------LHSESKKWYRID 796

Query: 812 DETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
           D  + +      L        S   Y+L Y+K
Sbjct: 797 DVNINELEEDDVLKGGEEDNDSRTAYILMYQK 828

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 80/187 (42%), Gaps = 30/187 (16%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLNG 506
           GL NLGN+CY+NS+LQCLF     +   L    +++    + P  +N+F     K  LN 
Sbjct: 324 GLINLGNSCYLNSVLQCLF-NGGVKGWSLKGLGQDFPQDVLYP--TNNFKCQLIK--LNN 378

Query: 507 GCAVIPVLF--------LKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLV 558
              V P  +         K C     +      QQD+ EFL  L+D L  ++  N     
Sbjct: 379 AMKVEPQNYPEGIRPKSFKKCVGQSHEEFSSGRQQDSMEFLGYLVDVLDKKIFKNG---- 434

Query: 559 SEHPDLIEYDT-DSMDVENAN--EYKKWFAESLE------NEGLSLIHEI---FQGQLEN 606
           S   DL+++   D +   N    +Y    AESL+      N+   L+H I   F G+ E 
Sbjct: 435 SNPNDLMKFTMEDRLQCTNCGKVKYSSEAAESLQLPMPENNDPQDLVHIIAQYFNGE-EV 493

Query: 607 SLECQRC 613
              C  C
Sbjct: 494 EFTCPHC 500

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 24/42 (57%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK 486
           I G  N GNTCY NS+LQCLF    FR   L +  KE I  +
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFRIDILKHPRKESIDGR 162

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 600 FQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGE 659
           FQG L N ++C  C+  ++N   F    + + N        ++++D ++ + + E+L G 
Sbjct: 426 FQGTLTNQIKCLTCDTLTSNNEPFLDFPIEVKNDDED----LNIQDILNKYHQREILNGT 481

Query: 660 NAWNCPKC 667
           N + C +C
Sbjct: 482 NKFYCNQC 489

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLS-NRYKEYIGTKV-DPHLSNSFHILFRKMYL 504
           G +N+GNTCY+N+ LQ L+     R++ L+ N  +E   + V D        I  ++ + 
Sbjct: 110 GFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQIIIEMKRCFE 169

Query: 505 N----GGCAVIPVLFLKTCNFLRPDLRIPDV------QQDTQEFLILLL 543
           N       +V+P++ L T     P     D       QQD +E    L 
Sbjct: 170 NLQNKSFKSVLPIVLLNTLRKCYPQFAERDAQGGFYKQQDAEELFTQLF 218

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 8/64 (12%)

Query: 416 HRPKRIVTRYTKYGL--PHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNL 473
           HR   ++  + ++G   P +  S     +L  +G+ N+GNTCY+NS+LQ  F+ T FR  
Sbjct: 731 HRASALLRHFYEFGKVNPKMIDS-----ELWPTGINNIGNTCYLNSLLQYYFSITLFRE- 784

Query: 474 FLSN 477
           F+ N
Sbjct: 785 FIEN 788

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 48/122 (39%), Gaps = 12/122 (9%)

Query: 432 HLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS-NRYKEYIGTKVDPH 490
            + H S L V     GL+NLGNTCY+NS LQ L+     R   L+    KE    +    
Sbjct: 97  QMQHLSQLPV-----GLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKENRSGEQHIQ 151

Query: 491 LSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLLD 544
           L       F+++      +  P+L L T     P     D       QQD +E    +  
Sbjct: 152 LVAELKRCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESGFYKQQDAEELFTQIFH 211

Query: 545 QL 546
            L
Sbjct: 212 SL 213

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           GL+N+GNTCY+N+ LQ L+  T  R   L
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAIL 133

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 83/230 (36%), Gaps = 61/230 (26%)

Query: 447 GLRNLGNTCYINSMLQCLF--ATTAFRNLFLSNRYK---EYIGTKVDPHLSNSFHILFRK 501
           GL NLGN+CY+NS LQCLF      +    L N       Y    +   L+     L  +
Sbjct: 332 GLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEE 391

Query: 502 --MYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVS 559
             +Y  G   + P  F K       +      QQD  EF    +D+L  +L  N D    
Sbjct: 392 PTIYKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDELDKKLFKNSDY--- 444

Query: 560 EHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYT--S 617
                           N N+  K+                    +E+ L+CQ C+    S
Sbjct: 445 ----------------NPNDLMKFM-------------------MEDRLQCQECHGVKYS 469

Query: 618 TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKC 667
           T  SN   L L   N  +      DLE+ I+ +   E++     + CP C
Sbjct: 470 TETSNVIQLPLQESNDAQ------DLEERINAYFSGEVI----EFKCPNC 509

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 45/109 (41%), Gaps = 12/109 (11%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHIL------FR 500
           G +N+GNTCY+N+ LQ L+     R++ L+    E + +           I+      F 
Sbjct: 110 GFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKRCFE 169

Query: 501 KMYLNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLL 543
            ++     +V+P++ L T     P     D       QQD +E    L 
Sbjct: 170 NLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELFTQLF 218

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 62/153 (40%), Gaps = 34/153 (22%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSM---------------SGLLDKNNTDIAYPAILTI- 761
           V  K  +FI KLP + +I L RFS                SG ++K    I Y   L I 
Sbjct: 636 VEAKKQTFIDKLPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAIP 695

Query: 762 ---------TLKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFD 811
                    +   +    +KL GVV H G + + GHYT  + +E    LN    KW+  D
Sbjct: 696 DATISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQE---TLN----KWYRID 748

Query: 812 DETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844
           D  V++      L        S   Y+L Y+K+
Sbjct: 749 DTNVQEIEKDEVLKGGEEGNDSRTAYILIYQKL 781

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 40/168 (23%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHIL-------F 499
           G+ N GN C+++S+LQ L     F NL         I  K    + ++  +L       +
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLM------NLISVKTSAKMGSTGFLLLDACLELY 401

Query: 500 RKMYLNG-------------------GCAVIPVLFLKTCNFLRP--DLRIPDVQQDTQEF 538
           RK                          A+ P  F KT + L    DLR    Q+D +EF
Sbjct: 402 RKFDKQAFEREKASRSSSGVNISSALADAIKPDDFYKTLSKLPKFKDLRWGH-QEDAEEF 460

Query: 539 LILLLDQLHNELKSNQDRLV-SEHPDLI----EYDTDSMDVENANEYK 581
           L  LLDQLH E  ++ D L  SE   LI    + DT ++ + N  +YK
Sbjct: 461 LTHLLDQLHEEFVNSIDSLSDSEVISLINSINDEDTKTVFIRNLAKYK 508

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 10/77 (12%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLL-DKNNTDIAYPAILTI---------TLKNKEKCRF 771
           K    ++LP++LI+HLSR + +G+   +N  ++ +   +T+         T+    + ++
Sbjct: 332 KKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVKY 391

Query: 772 KLYGVVNHFGNLNNGHY 788
            L  VV H G+ ++GHY
Sbjct: 392 NLKSVVKHTGSHSSGHY 408

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 89/404 (22%), Positives = 150/404 (37%), Gaps = 107/404 (26%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP--HLSNSFHILFRKMYL 504
           GL N+G+TC+++S+LQ L       N  +   +     +K +P    S +  ++  + Y 
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQSK-NPLSCTSCALDLIITEFYA 196

Query: 505 --NGGCAVIPVLFLKTCNFLRPDLRIPD-----VQQDTQEFLILLLDQLHNELKSNQDRL 557
             + G       F+   N L   L++ +      QQD  EFL  +L+Q+HN+ K N    
Sbjct: 197 TESKGNNSSHTGFISLLNSL---LQVNENFAGYSQQDAHEFLQFILNQIHNDYKLNSMED 253

Query: 558 VSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLS---LIHEIFQGQLENSLECQRCN 614
           V+   +       ++     +         +    +S   L H  FQG L++S+ C +CN
Sbjct: 254 VNS-GNTTAIAMKTLPGTQNSNNNNNNTNHIHGNDVSCKCLSHSNFQGSLKSSILCPQCN 312

Query: 615 YTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXX 673
             S T    F  LSL + +K        +L  C+  F + E L   N ++C +C      
Sbjct: 313 NDSKTTIDPFMDLSLDVKDKS-------NLYQCLDSFHKLEKLHDFN-FHCSEC------ 358

Query: 674 XXXXXXXXXXXXXXXXXNRSHNDLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLL 733
                            N + + +                        K  +  KL  LL
Sbjct: 359 -----------------NSTQDPI------------------------KQLTLNKLSPLL 377

Query: 734 IIHLSRFS--MSGLLDKNNTDIAYPAILTITLKNKEKCR--------------------F 771
           +  L RF   ++G   K N  I YP  L +    K  C+                    +
Sbjct: 378 VFQLKRFEHLLNGTTVKINDFIEYPLYLNM----KTYCQSSNNDTEEEESNSENVPDMIY 433

Query: 772 KLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETV 815
           +L  +++H G +N GHY  ++             +WF F+D  V
Sbjct: 434 ELTSIISHKGTVNEGHYIVVVKVNDG--------QWFKFNDSMV 469

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           GL N+GNTCY+NS+LQ  FA    RN   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 6/51 (11%)

Query: 421 IVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFR 471
           +++ +T   LP+   S+ ++      G  N GNTCY NS+LQCL+  T FR
Sbjct: 127 VLSTHTTDLLPYGDGSNKVF------GYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 79/194 (40%), Gaps = 47/194 (24%)

Query: 481 EYIGTKVDPHLSNSFHILFRKM----YLNGGCAVIPVLF---LKTCNFLRPDLRIPDVQQ 533
           +Y+ + + P+L  S   +F  +    +L G   V P  F   LK  N L   +    + Q
Sbjct: 390 DYLPSSIKPNLYTSLRDIFESITENRFLIG--VVSPTSFVEILKRENVLFSTM----MHQ 443

Query: 534 DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593
           D  EFL  LL++L + L+    R +S+         DS+   N N               
Sbjct: 444 DAHEFLNFLLNELSDSLQ----RQISD---------DSIITPNDN--------------- 475

Query: 594 SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIEN 653
             I  +F+G + N  +C  C+  ++    F    + +           D+++ +S F + 
Sbjct: 476 -FIDRLFKGTMTNQTKCLTCDNITSRDEPFLDFPIEVNGNCE-----TDIQEMLSDFHQK 529

Query: 654 EMLTGENAWNCPKC 667
           EML G N + C KC
Sbjct: 530 EMLNGSNKFYCDKC 543

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 18/125 (14%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI--TLKNKEKCRFKLYG-VVNHFG 781
           +LP++L +HL RF  S   + N      I YP  L +  T  +    R++L G VV+  G
Sbjct: 557 QLPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMGG 616

Query: 782 NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQ--QFNYFDLDKNVNRISSSDVYVL 839
             ++GHY SL   E        +  W  FDDETV+   + +      +++ ++++  YVL
Sbjct: 617 GPHHGHYVSLCKNE--------KFGWLLFDDETVESVDESSVMKFCGDLHDLTTA--YVL 666

Query: 840 FYEKI 844
           FY++I
Sbjct: 667 FYKEI 671

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 14/122 (11%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI--TLKNKEKCRFKLYGVVNHFGN 782
           +LP++L +HL RF  S     N      I YP  L +  T       +++L GVV H G+
Sbjct: 553 QLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGS 612

Query: 783 L-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
              +GHY  +   E        +  W  +DDETV+       L    +    +  YVLFY
Sbjct: 613 GPQHGHYVCICRNE--------KFGWLLYDDETVESIKEETVLQFTGHPGDQTTAYVLFY 664

Query: 842 EK 843
           ++
Sbjct: 665 KE 666

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGT 485
           G  N GNTCY NS+LQCL+    FR   L  RY E +  
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVL--RYPERVAA 171

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 55/137 (40%), Gaps = 29/137 (21%)

Query: 531 VQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLEN 590
           +QQD  EFL  LL+                  D  EY      ++  N   ++  +  +N
Sbjct: 432 MQQDAHEFLNFLLN------------------DFSEY------IQRNNPRMRFGPQKTDN 467

Query: 591 EGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              + I ++F+G L N ++C  C+  ++    F    + +           D++  +  +
Sbjct: 468 SNDNFITDLFKGTLTNRIKCLTCDNITSRDEPFLDFPIEVQGDEE-----TDIQKMLKSY 522

Query: 651 IENEMLTGENAWNCPKC 667
            + EML G N + C KC
Sbjct: 523 HQREMLNGVNKFYCNKC 539

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKM-- 502
           ++GL N GNTC++NS+LQ L ++    + FL +  +E    K + + S +F  L  K+  
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAH-FLDDIIEESEPNKNELNFSVAFKTLLDKLNA 123

Query: 503 -YLNGGCAVIPVLFLKTC-NFLRPDLRIPDVQQDTQEFLILLLDQLHNELK 551
            Y        P   LKT  +    ++ +   Q+D QEF   ++ QL  +LK
Sbjct: 124 KYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLK 174

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (44%), Gaps = 45/163 (27%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGL-LDKNNTDI-------AYPAILTITLKNK--EKCRF 771
           K   F+  P++ +IHLSR + +G+   +N   +       A+  +   T  N+  ++ R+
Sbjct: 327 KQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKRVRY 386

Query: 772 KLYGVVNHFGNLNNGHY----------------------TSLINKEPS-HDLNPQRQK-- 806
           +L  +V H G+  +GHY                      T++  K+P+  D N +R K  
Sbjct: 387 RLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRRMKST 446

Query: 807 ----WFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKII 845
               ++   D  VK++     +   VN   S  VY+LFYE+I+
Sbjct: 447 TIYPFWLISDTNVKEK----RISDIVNEQKS--VYMLFYERIL 483

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNR 478
           +GL N+GNTCY+NS+LQ  F+ ++ R   L  R
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 14/122 (11%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNN---TDIAYPAILTI--TLKNKEKCRFKLYGVVNHFGN 782
           +LP +L +HL RF  S     N      I YP  L +  T       +++L GVV H G+
Sbjct: 551 QLPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGS 610

Query: 783 L-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841
              +GHY  +   E        +  W  +DDETV+       L    +    +  YVLFY
Sbjct: 611 GPQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLQFTGHPGDQTTAYVLFY 662

Query: 842 EK 843
           ++
Sbjct: 663 KE 664

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFR 471
           G  N GNTCY NS+LQCL+    FR
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFR 159

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G +N+GNTCY+N+ LQ L+ T   R + L
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMIL 140

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 106/282 (37%), Gaps = 45/282 (15%)

Query: 539 LILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHE 598
           ++L L QL ++ KS   +   +  + I     S    +A+E+ +   E L  E L+L H 
Sbjct: 126 MLLELQQLRSDPKSVSSKRFIQQLETIFGGKISRQQNDAHEFTQLILERLNEENLTLDHA 185

Query: 599 ----IFQGQLENSLECQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIEN 653
                F+G + N L C +C  TS  N   F    L++P +       V L D ++     
Sbjct: 186 DLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQGS-----VKLSDLVN---GE 237

Query: 654 EMLTGENAWNCPKCXXXXXXXXXXXXXXXXXXXXXXXN------------------RSHN 695
           +M T EN ++C  C                       N                    H 
Sbjct: 238 QMETIEN-YSCMYCKTVAMLTNEREEKSNVSRTDAELNILKFLKGKLSTLLINEELPEHI 296

Query: 696 DLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLPNLLIIHLSRFSMSGL-LDKNNTDIA 754
               + YN              ++ RKST F + P + +IHLSR   +G+   +N   + 
Sbjct: 297 THYINSYNKGYCNTSEIKS---VIVRKST-FAEFPEIFLIHLSRSVFNGMNYSRNPCQVE 352

Query: 755 YPAILTI---TLKNK-----EKCRFKLYGVVNHFGNLNNGHY 788
           +   + +    LK+      E  ++KL  +V H G+   GHY
Sbjct: 353 FEEEILLPRQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHY 394

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGL-LDKNNTDIAYPAILTI--TLKNKEKC------RFK 772
           K T  +  P LLIIHLSR   +G+   +N+ ++A+   L +   +  K KC      +++
Sbjct: 445 KKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVNNVKYR 504

Query: 773 LYGVVNHFGNLNNGHY 788
           L   V H G  + GHY
Sbjct: 505 LRATVRHQGTHSAGHY 520

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 440 YVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           + QL + G +N+GNTCY+N+ LQ L+     R + L
Sbjct: 104 FAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMIL 138

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472
           +GL N+GNTCY+NS+LQ  FA +  R+
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +G+ N+GNTCY+NS+LQ  F+    RN  L
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLRNYVL 742

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472
           +GL N+GNTCY+NS+LQ  F  +  RN
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 30/131 (22%)

Query: 728 KLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTIT--LKNKEKCRFKLYGVVNH 779
           +LP  L++HL RF      ++ N +I       YP  L I+    +    +++L  +V H
Sbjct: 539 ELPKHLVVHLKRFKY---CEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVH 595

Query: 780 FGNLNN-GHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRI-----SS 833
            G     GHY +L  K  S+        W  +DDETV+        D+ V+RI      S
Sbjct: 596 IGESPQLGHYVTLC-KHKSYG-------WLIYDDETVQAVS-----DELVSRILNNEQRS 642

Query: 834 SDVYVLFYEKI 844
           +  Y+LFYE++
Sbjct: 643 ATAYLLFYEEV 653

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 437 SNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           SN  V   + G +N G TCY NS+LQ LF   +FR+  + 
Sbjct: 97  SNYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 7/58 (12%)

Query: 416 HRPKRIVTRYTKYGL--PHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFR 471
           +R   ++  Y +YG+  P    S +  V     GL N+GNTCY+NS+LQ  FA +  R
Sbjct: 735 NRNSLLLNNYIEYGIVNPKFLPSKSWPV-----GLNNIGNTCYLNSLLQYYFAISPLR 787

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           GLRN+GNTCY N+ LQ L+     R   L+
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +GL N+GNTCY+NS+LQ  F+    R+  L
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 66/157 (42%), Gaps = 38/157 (24%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGL-LDKNNTDIAYPAILTITLKN-----KEKCRFKLYG 775
           + T+    P++L +HLSR   +G    +N   + YP  L +  ++      E+  ++L  
Sbjct: 320 RRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERITYRLRS 379

Query: 776 VVNHFGNLNNGHYTS---------------LINKEPSHDLNPQR-----------QKW-F 808
           ++ H G   +GHY                  +N+ P+    P             ++W +
Sbjct: 380 MIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPY 439

Query: 809 YFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKII 845
           +F  + V ++ N   + +      S  VY+LFYE+++
Sbjct: 440 WFISDAVVRESNAGKMLRE-----SKYVYMLFYERVL 471

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 84/208 (40%), Gaps = 43/208 (20%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL--SNRYKEY------------IGTK--VDP 489
           +G+ N+GNTCY+NS+LQ  F+ +  R   L  S  Y+++            IG +   D 
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811

Query: 490 HLSNSFHILFR-------KMYLNGGCAVIPVLFLKTCNFLRPDLRIP------DVQQDTQ 536
            +  S   +++        +Y N  C V P   L    F   ++ +       D ++D  
Sbjct: 812 EVERSIQFIYQLRDLFYAMIYTNKRC-VTPRRELAYLAFAPSNVEVEFENGVTDAKEDVS 870

Query: 537 EF-------LILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE 589
            +        ++ + +   +L   +    S   D+   D D +    A +      ES E
Sbjct: 871 HYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTE 930

Query: 590 NEGLSL-----IHEIFQGQLENSLECQR 612
           N G+ +     + +I   QLEN+LE  R
Sbjct: 931 N-GIDILPSTKVAKISSDQLENALEMGR 957

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 38.5 bits (88), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G +N+GNTCY+N+ LQ L+     R++ L
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMIL 138

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +GL N+GNTCY+NS+LQ  F+ +  R+  L
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVL 730

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           G  N GNTCY NS+LQCL+  T  R   L
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (43%), Gaps = 26/128 (20%)

Query: 728  KLPNLLIIHLSRFSMSGLLDKNNTDIA------YPAILTITLK-----NKEKCRFKLYGV 776
            +LP  L +HL RF  S   ++ N +I       YP  L ++       NK   R++L G+
Sbjct: 958  QLPKTLSLHLKRFKYS---EEQNCNIKLFNKVNYPLYLDVSSSFNPNINK---RYELNGI 1011

Query: 777  VNHFGNL-NNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSD 835
            V H G    +GHY ++   +        +  W   DDETV+       L    +    + 
Sbjct: 1012 VVHMGGGPQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGDSKDLTT 1063

Query: 836  VYVLFYEK 843
             YVLFY++
Sbjct: 1064 AYVLFYKE 1071

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 81/188 (43%), Gaps = 28/188 (14%)

Query: 491 LSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPD--LRIPDVQQDTQEFLILLLDQLHN 548
           L + F  +    YL G   V PV F++    L+ D  L    + QD  EFL  LL++L +
Sbjct: 774 LKDIFECITENHYLTG--IVSPVEFVE---ILKRDNILFNSRMHQDAHEFLNFLLNELSD 828

Query: 549 EL-----KSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL----SLIHEI 599
            +     + N  + ++ +P+   ++T +    + N+ +       E+  L      I ++
Sbjct: 829 YMIKCINEENLKKTIANNPNTDTHNTLTQSHTSNNQQE-------EDNNLPRMSDFISDL 881

Query: 600 FQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGE 659
           F+G L N   C  C+  ++    F    + +     K     +++  +  + + EML G 
Sbjct: 882 FRGTLINKTRCLTCDNVTSREEPFLDFPIEV-----KDDTETNIQTELKSYHQREMLNGS 936

Query: 660 NAWNCPKC 667
           N + C +C
Sbjct: 937 NKFYCDEC 944

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 38.5 bits (88), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 96/247 (38%), Gaps = 37/247 (14%)

Query: 571 SMDVENANEYKKWFAESLENEGLSLIHEI------FQGQLENSLECQRCN-YTSTNYSNF 623
           S D  +A+E+ +   E+L +E + L   I      F+G   N L C +CN Y+ T +S F
Sbjct: 166 SSDQNDAHEFTQILLETLHSEYIKLQSNIEIGSFPFEGVSSNYLMCLQCNKYSQTIHSPF 225

Query: 624 CTLSLSIPNKRRKFRKLVDLEDCISLFIENEMLTGENAWNCPKCXXXXXXXXXXXXXXXX 683
             L +++P    +  KL DL     L  ++E++ G +   C                   
Sbjct: 226 LMLEVAVPGNYSE--KLTDL----ILHSQDEIIEGYSCLYCKVNMILKNEKYLNQLPEYS 279

Query: 684 XXXXXXXNRSHN-------------DLTFSEYNHNXXXXXXXXXXXXLVTRKSTSFIKLP 730
                  N   N             D++F   +++            ++  K  + IK P
Sbjct: 280 QEEQSILNFLRNQILTLYINDDLPADVSFYVDHYSKNGCVTANFKSNII--KKNAVIKEP 337

Query: 731 NLLIIHLSRFSMSGL-LDKNNTDIAYPAILTI--------TLKNKEKCRFKLYGVVNHFG 781
             LI+HLSR   +G  + ++   + Y   L +          +  E  +++L  VV H G
Sbjct: 338 ASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHTG 397

Query: 782 NLNNGHY 788
           +   GHY
Sbjct: 398 SHVQGHY 404

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
           complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 65/156 (41%), Gaps = 44/156 (28%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRFSM----------------SGLLDKNNTDIAYPAILTI 761
           V  K  +FI KLP +L++ L RFS                 +G ++K    I Y   LTI
Sbjct: 677 VEAKKQTFIDKLPQVLLVQLKRFSFINNTDKDNNMTNYNAYNGRIEKIRKKIKYDHELTI 736

Query: 762 TLK-------NKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813
            L+       + +   ++L GV+ H G + + GHYT+ +        + +  KW+  DD 
Sbjct: 737 PLESLSPASIDTKNRAYELTGVIYHHGLSSDGGHYTADV-------YHKELDKWYRIDD- 788

Query: 814 TVKQQFNYFDLDKNVNRISSSD------VYVLFYEK 843
                 N  +L+K+       D       Y+L Y K
Sbjct: 789 -----VNIIELEKDDVLKGGEDGNDTRTAYILIYRK 819

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 44/111 (39%), Gaps = 18/111 (16%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI--------L 498
           G +N+GNTCY+N+ LQ L+     R+  L+      +    D +  N  HI         
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLNFD----VSINNDKNGENETHIKLVTELKRC 163

Query: 499 FRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPD------VQQDTQEFLILLL 543
           F  +      +V+PV+ L       P     D       QQD +E L  L 
Sbjct: 164 FEGLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELLTQLF 214

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFR 471
           +G+ N+GNTCY+NS+LQ  FA +  R
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLR 747

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
           Ashbya gossypii AGR139C
          Length = 834

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 63/154 (40%), Gaps = 36/154 (23%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRF----------------SMSGLLDKNNTDIAYPAILTI 761
           V  K  +FI +LP +L+I L RF                + +G ++K    I Y   LTI
Sbjct: 687 VEAKKQAFIDRLPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWIKYDHDLTI 746

Query: 762 T-----------LKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWFY 809
                       L +     +KL GVV H G + + GHYT+ +       L+   +KW+ 
Sbjct: 747 PKEALSSINAKFLFSDNDTSYKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYR 799

Query: 810 FDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEK 843
            DD TV +      +        S   Y+L Y++
Sbjct: 800 IDDTTVTEINKEEVVTGGEEGSHSRTAYILIYQR 833

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 67/156 (42%), Gaps = 40/156 (25%)

Query: 719 VTRKSTSFI-KLPNLLIIHLSRF----------------SMSGLLDKNNTDIAYPAILTI 761
           V  K  +F+ +LP +L+I L RF                + +G ++K    I Y   LTI
Sbjct: 643 VEAKKQAFLDRLPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTI 702

Query: 762 T------------LKNKEKCRFKLYGVVNHFG-NLNNGHYTSLINKEPSHDLNPQRQKWF 808
                        L  K+   ++L GVV H G + + GHYT+ +       L+  + KW+
Sbjct: 703 PKEALSSVNAKFYLSGKDTT-YRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWY 754

Query: 809 YFDDETVKQQFNYFDLDKNVNRISSSD-VYVLFYEK 843
             DD  V  +    D+ K  +  S S   Y+L Y++
Sbjct: 755 RIDDNNV-TEIRQEDVFKRGDEASDSKTAYILIYQR 789

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 82/198 (41%), Gaps = 49/198 (24%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRN-LF--LSNRYKEYIGTK-VDPHLSNS---FHILF 499
           GL N G TCY N+ +Q +    A ++ LF  L  +YKE I  K V   L+ +      L 
Sbjct: 407 GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYKETISPKSVSVMLAETSLRMWALQ 466

Query: 500 RKMYLNGGCAVIP---VLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDR 556
            K   N G  + P   +  L+T N +  + +    Q+D+ E+ + L+ +L       +D 
Sbjct: 467 DKKKKNLGY-INPKKLIASLETINCMMSEWQ----QEDSHEYFMSLMSRLQ------EDS 515

Query: 557 LVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENSLECQRCNYT 616
           +   H  + E                           S+I++IF G L+  + C+ C   
Sbjct: 516 VPPGH-KMTE---------------------------SMIYDIFGGLLKQIVTCKSCGGV 547

Query: 617 STNYSNFCTLSLSIPNKR 634
           ST    F  LSL +  K+
Sbjct: 548 STTEQPFYDLSLHLKGKK 565

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +G+ N+GNTCY+NS+LQ  F     R+  L
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFIL 727

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 3/127 (2%)

Query: 445 ISGLRNLGNTCYINSMLQCLFAT---TAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRK 501
           I+GL N GNTC++NS+LQ L ++    AF +  + N  +     K    L     IL +K
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELAAFLDNVIENGSENNGDIKFTETLRELLLILNKK 116

Query: 502 MYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEH 561
            Y          L     N    ++ +   Q+D QEF   +L  L   +K        E 
Sbjct: 117 YYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEKKEER 176

Query: 562 PDLIEYD 568
            ++ E D
Sbjct: 177 NNIKESD 183

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 727 IKLPNLLIIHLSRFSMSGLL-DKNNTDIA---------YPAILTITLKNKEKCRFKLYGV 776
           +KLP +L+IHLSR + +G+   +N  ++          Y +I  + L    +  + L  V
Sbjct: 345 VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 777 VNHFGNLNNGHY 788
           V H G+ + GHY
Sbjct: 405 VKHTGSHSRGHY 416

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLL-DKNNTDIAYPAILTITLK--NKEKC------RFK 772
           K T  +  P +L++HLSR    G+   KN+ ++ +P  L +  +   +++C      R+K
Sbjct: 396 KRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVHCVRYK 455

Query: 773 LYGVVNHFGNLNNGHY 788
           L  ++ H G    GHY
Sbjct: 456 LQAMIKHTGTHFQGHY 471

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 58/132 (43%), Gaps = 24/132 (18%)

Query: 520 NFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDL-----IEYDTDSMDV 574
           N + PDL +PD++    E L +++  L   +K+      S  P L     I     S   
Sbjct: 174 NHVTPDLLLPDLRM--HEALSIMIHNLQQPVKNYTQ--TSLQPLLHTLEQIHNAKISSGQ 229

Query: 575 ENANEYKKWFAESLENEGLSL-------------IHEI-FQGQLENSLECQRCNYTS-TN 619
            +A+E+ +   E+LE E L+L             I E  FQG L  +L C RCN +S  N
Sbjct: 230 NDAHEFSQILFETLEKERLALKTFLEKQQLSDIRIPEFPFQGSLATNLICLRCNNSSKVN 289

Query: 620 YSNFCTLSLSIP 631
              F   SL +P
Sbjct: 290 VHRFTMHSLPVP 301

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 38/137 (27%)

Query: 532 QQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENE 591
           QQD  EF   LL+QLH           S+H    +  +++ + E                
Sbjct: 243 QQDAHEFWQFLLNQLH-----------SDHVRAHKPSSNNSNCE---------------- 275

Query: 592 GLSLIHEIFQGQLENSLECQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              ++H +FQG LE+++ C  C+  S T       LSL I NK         L +C++ F
Sbjct: 276 --CILHLLFQGYLESNIACSECHTNSKTTVDPIMDLSLGIQNKST-------LHECLNSF 326

Query: 651 IENEMLTGENAWNCPKC 667
            + E LT  N + C KC
Sbjct: 327 HKREPLTDFN-YCCKKC 342

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 18/78 (23%)

Query: 728 KLPNLLIIHLSRFS--MSGLLDKNNTDIAYPAILTITLKNKEKCR------------FKL 773
           KLP +L++ L RF   M+G   K N  I++P    + L  K+ C+            +KL
Sbjct: 356 KLPPVLMLQLKRFEHLMNGTSVKINDYISFP----LHLNMKDYCKPVDCLHPVPNMMYKL 411

Query: 774 YGVVNHFGNLNNGHYTSL 791
             +++H G ++ GHYT++
Sbjct: 412 SAIISHHGTVHQGHYTTI 429

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 17/19 (89%)

Query: 447 GLRNLGNTCYINSMLQCLF 465
           GL NLGN+CYINS+LQCL 
Sbjct: 323 GLINLGNSCYINSVLQCLL 341

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHILFRKMYLN 505
           GL N+GNTCY+NS+LQ  F+    R   L+  YK  I        SN   I  R++  N
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILN--YKGSISNYEIDETSNKRRIGGREVSEN 767

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 5/36 (13%)

Query: 430 LPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLF 465
           L HLP S          GL NLGN+CY+NS+LQ LF
Sbjct: 302 LKHLPASKEYGC-----GLNNLGNSCYMNSVLQVLF 332

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +GL N+GNTCY+NS+LQ  F+    R   L
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472
           +GL N+GNTCY+NS+LQ  F  +  R+
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475
           +GL N+GNTCY+NS+LQ  F  +  R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476
           +G+ N+GNTCY+NS+LQ  F  +  R   L+
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 5/36 (13%)

Query: 430 LPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLF 465
           L  LP S  L       G  NLGN+CY+NS+LQCLF
Sbjct: 322 LIQLPPSKELGC-----GFINLGNSCYLNSVLQCLF 352

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472
           +GL N+GNTCY+NS+LQ  F  +  R 
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQ 729

>TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {ON}
           Anc_8.540 YPL072W
          Length = 524

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLD-KNNTDIAYPAILTITLKN--KEKC------RFK 772
           K T   K P  LI+HLSR S +G++  +N+ +IAY + L +  ++     C      ++ 
Sbjct: 349 KKTVITKAPLALILHLSRSSYNGMISVRNSCNIAYDSKLELQSQSITDNICSDIVNNKYS 408

Query: 773 LYGVVNHFGNLNNGHY 788
           L  +V H G    GHY
Sbjct: 409 LQAMVKHTGTHMEGHY 424

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 55/113 (48%), Gaps = 23/113 (20%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK-----VDPHLSNSFHILFRK 501
           GL NLGN+CY+NS+LQ LF      N  + +   E IGT+     V P    S +IL + 
Sbjct: 323 GLINLGNSCYMNSVLQLLF------NAGVPDWSLEQIGTEFPLDVVYP----SNNILCQL 372

Query: 502 MYLNGGCAVIPVLF---LKTCNFLRPDLRIPD-----VQQDTQEFLILLLDQL 546
           + L     + P  +   +K  +F R   +  +      QQD+ EF   L++QL
Sbjct: 373 IKLRNAMKIEPERYPNGIKPTSFKRCIAQAHEEFSSSRQQDSMEFFTFLIEQL 425

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 27/112 (24%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGL-LDKNNTDIAYPAILTI--TLKNKEKC------RFK 772
           K T  ++ P  L++HLSR    G+   +N+  +A+  IL     +    KC       +K
Sbjct: 425 KKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGINPISYK 484

Query: 773 LYGVVNHFGNLNNGHY---------------TSLINKEPSHD---LNPQRQK 806
           L  +V H G+ + GHY                ++IN+ P+ D   + P++ K
Sbjct: 485 LKAIVAHSGSHSQGHYECYRHKPDFVKDTTTKTVINRSPTIDKSLITPEQSK 536

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLD-KNNTDIAYPAILTITLKNK---------EKCRF 771
           K  S I+ P +L+IHLSR   +G++  +N+  + +   ++I  +           E   +
Sbjct: 336 KKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIELVDY 395

Query: 772 KLYGVVNHFGNLNNGHY 788
           +L  ++ H G  N+GHY
Sbjct: 396 QLQSIIKHTGTHNSGHY 412

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 74/205 (36%), Gaps = 48/205 (23%)

Query: 446 SGLRNLGNTCYINSMLQCLFATTAFR---NLFLSNRYKEYIGTKVDPHLSNSFHILFRKM 502
           +GL N    CY NS +Q L + + F    N  +S    E    KV+     +F     K 
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNFTIYLNKVISIFELELKIEKVEKDAKEAFDTYLYK- 124

Query: 503 YLNGGCAVIPVLFLKTCNFLRPDLRIPDV--QQDTQEFLILLLDQLHNELKSNQDRLVSE 560
                  VIPV +   C  L     + D   ++    F+ +L   +H  +   Q      
Sbjct: 125 -------VIPVHY-ALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQ------ 170

Query: 561 HPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEI-------------FQGQLENS 607
                         ++ANE  +   E L+NE  SL   +             F+G+L + 
Sbjct: 171 --------------QDANELTQIVLEVLQNELESLKKYVNRMELSIEVPRFPFEGKLASY 216

Query: 608 LECQRCNYTST-NYSNFCTLSLSIP 631
           L C  C  TS  N S F  L +  P
Sbjct: 217 LSCLNCGQTSIPNISTFNILPIQTP 241

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 26/108 (24%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCR----------- 770
           +  S  KLP +L++ L RF    L++  +  I      ++ L  K+ C+           
Sbjct: 353 RQLSMAKLPPVLMLQLKRFEH--LINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNL 410

Query: 771 -FKLYGVVNHFGNLNNGHYTSL--INKEPSHDLNPQRQKWFYFDDETV 815
            FKL  ++ H G ++ GHYT++  IN +           W  F+D  V
Sbjct: 411 TFKLSAIIPHQGTVDKGHYTTICRINGDV----------WAKFNDSMV 448

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 51/137 (37%), Gaps = 38/137 (27%)

Query: 532 QQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENE 591
           QQD  EF   LL+QLH                     TD + +      K          
Sbjct: 246 QQDAHEFWQFLLNQLH---------------------TDYIRIHGPPSKKSACG------ 278

Query: 592 GLSLIHEIFQGQLENSLECQRCNYTS-TNYSNFCTLSLSIPNKRRKFRKLVDLEDCISLF 650
              ++H +FQG LE+S+ C  C+  + T       LSL I NK         L +C+  F
Sbjct: 279 --CILHMLFQGYLESSIVCSECHGNNKTTVDPIMDLSLGIQNKS-------TLHECLDSF 329

Query: 651 IENEMLTGENAWNCPKC 667
              E LT  N + C  C
Sbjct: 330 HRRESLTDFN-YCCKNC 345

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 19/23 (82%)

Query: 445 ISGLRNLGNTCYINSMLQCLFAT 467
           + GL N GNTC++NS+LQCL ++
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASS 105

>Kpol_1056.45 s1056 complement(114032..115387) [1356 bp, 451 aa]
           {ON} complement(114032..115387) [1356 nt, 452 aa]
          Length = 451

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 12/102 (11%)

Query: 722 KSTSFIKLPNLLIIHLSRF---SMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVN 778
           K    +KLP  LI+H +RF     + + D+N T + +P ++ +     +K +++L   + 
Sbjct: 332 KKYKILKLPRYLILHFNRFDNKEKTPVKDRNQTLVEFPTLMEL-----QKTKYQLIANII 386

Query: 779 HFG----NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVK 816
           H      +++N     L +K  +  LN + ++W+  D   VK
Sbjct: 387 HEPLHELSVDNTSNEDLQSKWKAQLLNEKDEQWYEIDGTEVK 428

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 722 KSTSFIKLPNLLIIHLSRFSMSGL-LDKNNTDIAYPAILTITLKNKE--KC------RFK 772
           K T  +  P++LI+HLSR    G+   KN  ++++   L +  +  E  KC       +K
Sbjct: 440 KKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIRKDSYK 499

Query: 773 LYGVVNHFGNLNNGHY 788
           L  ++ H G+ + GHY
Sbjct: 500 LRSMLRHQGSHSTGHY 515

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 447 GLRNLGNTCYINSMLQCLF 465
           GL NLGN+CY+NS++QCL 
Sbjct: 343 GLINLGNSCYLNSVMQCLL 361

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEY 482
           I+GL N GNTC++NS+LQ L ++    +   +N  K Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTY 137

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEY 482
           I+GL N GNTC++NS+LQ L ++    +   +N  K Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTY 137

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEY 482
           I+GL N GNTC++NS+LQ L ++        +N  K Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTY 137

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 727 IKLPNLLIIHLSRFSMSGLL-DKNNTDIAYPAILTI---------TLKNKEKCRFKLYGV 776
           ++LP++L++HLSR + +G+   +N  ++ +   + +          +    + ++ L  V
Sbjct: 337 VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 777 VNHFGNLNNGHY 788
           V H G+ + GHY
Sbjct: 397 VKHTGSHSRGHY 408

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 89/219 (40%), Gaps = 48/219 (21%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTK-----VDP--HLSNSFHILF 499
           GL NLGN+CY+NS+LQ L       N  + N   +++G++     V P  +L   +  L 
Sbjct: 324 GLINLGNSCYLNSVLQSLL------NGGVPNWSLDFLGSEFPLDVVYPASNLKCQWIKLL 377

Query: 500 RKM------YLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSN 553
             M      Y NG   + P  F K C     +    + QQD  EFL  L D L  +  S+
Sbjct: 378 NAMKCEPEIYPNG---IKPTTF-KKCVGKSHEEFSSNRQQDAMEFLTFLSDLLDRKFFSD 433

Query: 554 QDRLVSEHPDLIEYDT-DSMDVENANEYKKWF--AESL-----ENEG----LSLIHEIFQ 601
                S   DL+ +   D +      + K  +  AE++     EN+     L +I   F+
Sbjct: 434 SSSADSNPNDLVRFMMEDRLQCNKCGKVKYSYEPAEAIQLPLEENDDPQDLLEIIKAYFE 493

Query: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL 640
           GQ     +C  C  T T             NKR  F+ L
Sbjct: 494 GQTI-EFKCANCKETVT------------ANKRPGFKSL 519

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 447 GLRNLGNTCYINSMLQCLF 465
           GL+NLGN+CY+NS+LQ L 
Sbjct: 310 GLQNLGNSCYLNSVLQVLL 328

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEY 482
           I+GL N GNTC++NS+LQ L ++        +N  + Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 447 GLRNLGNTCYINSMLQCLF 465
           GL NLGN+CY+N++LQ LF
Sbjct: 310 GLLNLGNSCYMNAVLQVLF 328

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 447 GLRNLGNTCYINSMLQCLF 465
           GL NLGN+CY+NS++Q LF
Sbjct: 319 GLINLGNSCYLNSVVQVLF 337

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLF 474
           I+GL N GNTC++NS+LQ L ++    +  
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMDFL 156

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 16/78 (20%)

Query: 768 KCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKN 827
           KC + L  +V H+G+ + GHY S    E          +W+   DE+V        +D++
Sbjct: 425 KCVYSLKSIVVHYGSHDYGHYISYRRFE---------DQWWRISDESV------LKVDED 469

Query: 828 VNRISSSDVYVLFYEKII 845
               S+S ++++FYE+ I
Sbjct: 470 -EVFSASGIFIVFYEQDI 486

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 61/144 (42%), Gaps = 18/144 (12%)

Query: 447 GLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYK---EYIGTKVDPHLS----NSFHILF 499
           GL NLGN+CY+NS+LQ L      RN  L        + +  + + H       +   L 
Sbjct: 317 GLLNLGNSCYLNSVLQVLL-NGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375

Query: 500 RKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVS 559
           +  Y  G   + P  F K       +      QQD+ EF   L D+L  E+  N     +
Sbjct: 376 QSRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREIFKN----TT 427

Query: 560 EHP-DLIEYD-TDSMDVENANEYK 581
            +P DL  ++  D +  +N N+ K
Sbjct: 428 TNPNDLFRFNIQDKIKCDNCNKVK 451

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,051,957
Number of extensions: 3984066
Number of successful extensions: 13714
Number of sequences better than 10.0: 279
Number of HSP's gapped: 13483
Number of HSP's successfully gapped: 576
Length of query: 846
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 728
Effective length of database: 39,950,811
Effective search space: 29084190408
Effective search space used: 29084190408
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)