Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D007001.83ON57457427770.0
Suva_5.41.83ON59055520580.0
KNAG0C007901.83ON57957020440.0
NDAI0A006101.83ON56556220420.0
Skud_5.261.83ON59057920170.0
Smik_5.241.83ON59057920150.0
YEL063C (CAN1)1.83ON59052820070.0
NCAS0B085701.83ON53253719080.0
TDEL0C061801.83ON58357318890.0
CAGL0J08184g1.83ON57257518800.0
Kpol_2000.651.83ON59555218820.0
TPHA0B044801.83ON60352018700.0
NDAI0F042001.83ON56657318620.0
SAKL0C02662g1.83ON54853218290.0
SAKL0C02684gsingletonON58855118070.0
SAKL0C02640gsingletonON54855318020.0
NCAS0A006101.84ON60751718060.0
Smik_14.671.83ON57358218010.0
Kwal_33.134011.83ON55956117950.0
YNL270C (ALP1)1.83ON57355017900.0
TBLA0A054501.83ON60656817910.0
KAFR0D039401.83ON59755817900.0
KLTH0F02398g1.83ON55556017860.0
Skud_14.701.83ON57355617840.0
NCAS0A006001.83ON54453917760.0
KLLA0C02343g1.83ON58158317770.0
Kpol_2000.641.84ON61057517800.0
CAGL0J08162g1.84ON59756817720.0
Skud_14.711.84ON61255517720.0
NDAI0F041901.84ON59951717680.0
KNAG0C05920singletonON59955917670.0
YNL268W (LYP1)1.84ON61158517610.0
Suva_14.751.84ON61158217560.0
Smik_14.681.84ON61151417520.0
TPHA0B044701.84ON59957317480.0
ZYRO0F16654g1.83ON58055517430.0
TBLA0A054601.84ON60855017390.0
TDEL0C061701.84ON57354717310.0
Suva_14.731.83ON49748517200.0
KLTH0F02420g1.84ON62154917310.0
Ecym_10881.84ON56756717250.0
KNAG0F004801.84ON59753217190.0
KLLA0C02365g1.84ON57955817150.0
Kwal_33.134111.84ON56053517130.0
SAKL0C02728g1.84ON56254316910.0
Ecym_10871.83ON57057316820.0
AFR667C1.84ON56357616470.0
ZYRO0F16632g1.84ON60752815830.0
AFR668W1.83ON55655015470.0
Kpol_358.3na 1ON5755528721e-109
TPHA0M00130singletonON6115178561e-106
CAGL0A01199gna 1ON6135348431e-104
SAKL0G14916gna 1ON5815568391e-104
KNAG0L02470singletonON6385618371e-103
KLLA0E16281gna 1ON6055588331e-103
Kwal_26.69407.44ON5705768301e-103
SAKL0F09790gsingletonON5585568271e-103
NCAS0D02260na 1ON5975808301e-103
TBLA0A07060na 1ON6255288291e-102
Smik_6.473na 1ON6065078271e-102
AFR156W7.44ON5585568141e-101
Skud_16.12na 1ON6075548171e-101
YPL265W (DIP5)na 1ON6085288141e-100
NDAI0I02660na 1ON5945918111e-100
Suva_16.40na 1ON6065288111e-100
KAFR0B06430singletonON5935538072e-99
KLTH0D01474g7.44ON6245798065e-99
TPHA0H028507.44ON6015668011e-98
TDEL0H040707.44ON5775677982e-98
TDEL0A08030singletonON5145207906e-98
SAKL0D00836gna 2ON6015177942e-97
SAKL0C01232gsingletonON6135627942e-97
ZYRO0D17908gna 1ON5185277854e-97
Kwal_33.15545na 1ON5765437862e-96
KNAG0L02460singletonON5885527811e-95
KNAG0E003907.44ON5995757811e-95
SAKL0B10956g7.44ON5725657791e-95
Ecym_2480na 1ON5865247802e-95
Kwal_33.154075.158ON5875467792e-95
KLTH0E15642g1.244ON5965137793e-95
YOR348C (PUT4)7.44ON6275807813e-95
Suva_8.4027.44ON6835927835e-95
TDEL0C00930singletonON5955067768e-95
Kpol_543.791.244ON6055327751e-94
Kwal_27.126811.244ON5935717723e-94
SAKL0G14014g5.158ON6055347708e-94
NDAI0B052201.244ON6115387709e-94
CAGL0E05632g7.44ON5985687681e-93
KLTH0B01166gna 1ON5775097652e-93
Kpol_367.77.44ON5845977653e-93
TPHA0B010901.244ON6065667663e-93
ZYRO0D03762g1.244ON6005027645e-93
Ecym_60211.244ON6005367645e-93
Ecym_80357.44ON5635607606e-93
TBLA0C01240singletonON6295957641e-92
Smik_15.5327.44ON6316007631e-92
NDAI0E038007.44ON6215957613e-92
KLTH0B02046g5.158ON5895647541e-91
Skud_15.5157.44ON6266007561e-91
SAKL0C01650g1.50ON6135727542e-91
Ecym_47895.158ON5885857513e-91
Kwal_23.4026singletonON5344977448e-91
Suva_2.716singletonON6035647471e-90
KAFR0E018505.158ON5605327432e-90
NDAI0C029505.158ON6095837463e-90
CAGL0B01012g1.50ON6235877456e-90
NDAI0D021605.158ON5875617426e-90
KAFR0A011203.284ON5925757401e-89
KAFR0C004003.284ON5825537391e-89
Kpol_1010.325.158ON5995517392e-89
TBLA0A051801.50ON6765657426e-89
Kwal_33.14276na 2ON5965007357e-89
NCAS0A071105.158ON5925367349e-89
KAFR0C051607.44ON5845837312e-88
CAGL0K05753g1.50ON6605747354e-88
KAFR0D005001.50ON6175317324e-88
Kwal_33.132041.50ON6075897298e-88
Skud_11.2751.244ON6025287289e-88
YBR068C (BAP2)3.284ON6095797281e-87
NCAS0E022607.44ON5935917261e-87
ACL135Wna 1ON5885267261e-87
KLLA0A11770g5.158ON5815887252e-87
YKR039W (GAP1)1.244ON6025617262e-87
Skud_7.5255.158ON6035767244e-87
TBLA0A05190na 3ON6675747284e-87
Suva_2.6881.50ON6615857285e-87
CAGL0B03773g5.158ON6055577236e-87
Skud_4.7841.50ON6635967269e-87
KAFR0D00510na 4ON6175507211e-86
TDEL0E05750singletonON5485287162e-86
AGR319W5.158ON6265637212e-86
KNAG0C02140singletonON5985007183e-86
NDAI0G060301.368ON5995697183e-86
AFR698C1.50ON6095137183e-86
SAKL0D02970g3.284ON6015387174e-86
NCAS0D018705.158ON5955827165e-86
AGR038C3.284ON5805377147e-86
NCAS0B085801.50ON6275127178e-86
SAKL0D02948gna 5ON5945697148e-86
KAFR0D00520na 3ON5985627159e-86
NDAI0A056203.284ON5715607129e-86
NCAS0B079001.244ON6195337169e-86
TPHA0A047005.158ON5695357121e-85
Suva_11.2731.244ON6015617141e-85
CAGL0H08393g3.284ON6125307132e-85
YCL025C (AGP1)1.50ON6335387142e-85
Smik_16.1155.158ON6035567113e-85
SAKL0D04664g1.244ON5935497104e-85
Suva_3.1891.50ON6335847125e-85
KLLA0F23419g7.44ON5735607085e-85
YGR191W (HIP1)5.158ON6035317097e-85
Suva_4.3073.284ON6095347097e-85
Ecym_26623.284ON5895477079e-85
KLLA0A06886gsingletonON5875517079e-85
YDR508C (GNP1)1.50ON6635777121e-84
Smik_4.7901.50ON6635177112e-84
Suva_2.2033.284ON6045357062e-84
Suva_7.4855.158ON6035857053e-84
Smik_3.531.50ON6335377063e-84
KNAG0H011503.284ON6175427045e-84
KLLA0A06930g1.244ON5875507016e-84
KLLA0C01606g1.50ON6205207046e-84
AGR039Cna 5ON5865367016e-84
KNAG0J022003.284ON6075847019e-84
Kwal_8.590na 6ON6295837031e-83
Smik_6.482na 7ON5585606981e-83
TDEL0C065101.50ON6425707031e-83
Ecym_26643.285ON5755356972e-83
TPHA0E036601.50ON6475907022e-83
NDAI0A006401.50ON6414987012e-83
SAKL0F16544gsingletonON5675646928e-83
Skud_3.381.50ON6335856969e-83
NCAS0J00140na 8ON5585396901e-82
NCAS0A106803.284ON5935346922e-82
KLTH0C05170g3.284ON5985216922e-82
AFR230C1.244ON6045126922e-82
AGR040C3.285ON5735696892e-82
Kpol_543.78singletonON6055336913e-82
KAFR0D04120na 3ON6485506934e-82
KNAG0F002701.50ON6345706924e-82
Skud_2.1913.284ON6095386895e-82
Smik_4.2843.284ON6045356852e-81
Kpol_2000.921.50ON6375436863e-81
TDEL0F02830na 9ON5615516804e-81
KAFR0D041401.50ON6375686854e-81
Skud_4.3003.284ON6045356835e-81
KNAG0G009005.158ON6135556835e-81
KLTH0F01584g1.50ON5965806825e-81
Smik_11.3021.244ON5534766786e-81
TBLA0G031203.284ON6735396866e-81
Suva_13.517singletonON5475526786e-81
TPHA0A002405.158ON6035306827e-81
Ecym_2663na 5ON5895326791e-80
YDR046C (BAP3)3.284ON6045356801e-80
CAGL0L03267g1.244ON5975346791e-80
CAGL0M00154gsingletonON5505486761e-80
KLTH0H13398g1.368ON5875456781e-80
Ecym_10561.50ON6065626782e-80
Kwal_23.2817na 10ON5805756762e-80
KLTH0B00154gna 6ON5565166743e-80
YOL020W (TAT2)1.368ON5925516763e-80
Kpol_2002.441.50ON6275696784e-80
NCAS0A004201.50ON6795826814e-80
Kwal_27.105383.284ON6025496764e-80
NDAI0A01340singletonON5545436725e-80
ZYRO0F17446g1.50ON6335556776e-80
TBLA0B077605.158ON6585426761e-79
Smik_2.2013.284ON6095686731e-79
Ecym_27161.368ON5925656721e-79
KLTH0F01606gna 3ON6045786722e-79
Skud_2.1923.285ON6195626723e-79
AEL030W1.368ON5825626693e-79
Suva_15.1481.368ON5925286685e-79
CAGL0D02178g1.368ON5775296675e-79
Skud_15.1381.368ON5925286669e-79
KLLA0A10813g1.368ON5845706659e-79
KLTH0F04048gsingletonON5835516651e-78
SAKL0D02926g3.285ON5835836641e-78
Smik_15.1461.368ON5935606633e-78
NDAI0A074903.284ON5965376633e-78
Kpol_1065.133.284ON5965576608e-78
KLLA0B14685gna 10ON5715636589e-78
Kwal_26.9612singletonON5435516542e-77
SAKL0A09724gna 11ON5515146533e-77
Skud_16.2na 7ON4965066483e-77
NCAS0A089201.368ON5995136564e-77
KLLA0F27093gsingletonON5635006525e-77
Skud_6.2na 8ON5585336516e-77
CAGL0L07546g3.284ON6345856566e-77
Kpol_534.221.368ON5925986521e-76
ZYRO0C18502g7.44ON5755716511e-76
KLTH0D07128gna 11ON5435506472e-76
NCAS0I015303.284ON5955186502e-76
SAKL0C13992gsingletonON5525436472e-76
Kwal_34.16254singletonOFF4814686403e-76
Kwal_YGOB_34.162541.368ON4914686405e-76
TBLA0C012101.368ON6005336451e-75
Smik_2.2023.285ON6175586461e-75
TPHA0M012003.284ON6075596452e-75
ADL272Wna 12ON5645206412e-75
KAFR0F02250singletonON5545396403e-75
KNAG0J022103.285ON5815186362e-74
Suva_4.3083.285ON6185576372e-74
NDAI0F043901.50ON6674996394e-74
ZYRO0G12342g3.284ON6205496355e-74
ZYRO0A00308gsingletonON5645396308e-74
TPHA0A039603.284ON6155526322e-73
ZYRO0G07172gna 9ON5675316264e-73
TBLA0I020103.285ON6285386295e-73
Smik_13.1singletonON5235446216e-73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00700
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...  1074   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   797   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              791   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   791   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   781   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   780   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   777   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            739   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   732   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   728   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   729   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   724   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            721   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   709   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   700   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   698   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              700   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   698   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   696   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   694   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   694   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   694   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   692   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   691   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   688   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   689   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   690   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   687   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   687   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   685   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            685   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   682   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   681   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   679   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   677   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   676   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   674   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   671   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   667   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   671   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   669   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                666   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   665   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   664   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   655   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   652   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   639   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   614   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   600   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   340   e-109
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     334   e-106
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   329   e-104
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   327   e-104
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             327   e-103
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   325   e-103
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   324   e-103
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   323   e-103
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              324   e-103
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   323   e-102
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   323   e-102
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   318   e-101
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   319   e-101
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   318   e-100
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   317   e-100
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   317   e-100
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   315   2e-99
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   315   5e-99
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   313   1e-98
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   311   2e-98
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            308   6e-98
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   310   2e-97
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   310   2e-97
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   306   4e-97
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   307   2e-96
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             305   1e-95
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   305   1e-95
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   304   1e-95
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   305   2e-95
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   304   2e-95
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   304   3e-95
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   305   3e-95
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   306   5e-95
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   303   8e-95
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   303   1e-94
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   301   3e-94
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   301   8e-94
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   301   9e-94
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   300   1e-93
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   299   2e-93
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   299   3e-93
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   299   3e-93
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   298   5e-93
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   298   5e-93
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   297   6e-93
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   298   1e-92
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   298   1e-92
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     297   3e-92
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   295   1e-91
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   295   1e-91
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   295   2e-91
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   293   3e-91
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   291   8e-91
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   292   1e-90
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   290   2e-90
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    291   3e-90
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   291   6e-90
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    290   6e-90
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   289   1e-89
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                289   1e-89
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   289   2e-89
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   290   6e-89
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   287   7e-89
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   287   9e-89
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   286   2e-88
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   287   4e-88
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      286   4e-88
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   285   8e-88
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   285   9e-88
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   285   1e-87
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     284   1e-87
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   284   1e-87
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   283   2e-87
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   284   2e-87
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   283   4e-87
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   285   4e-87
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   285   5e-87
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   283   6e-87
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   284   9e-87
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      282   1e-86
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            280   2e-86
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   282   2e-86
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   281   3e-86
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   281   3e-86
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   281   3e-86
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   280   4e-86
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   280   5e-86
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   279   7e-86
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   280   8e-86
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   279   8e-86
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   280   9e-86
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            278   9e-86
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   280   9e-86
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   278   1e-85
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   279   1e-85
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   279   2e-85
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   279   2e-85
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   278   3e-85
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   278   4e-85
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   278   5e-85
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   277   5e-85
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   277   7e-85
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   277   7e-85
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   276   9e-85
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   276   9e-85
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   278   1e-84
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   278   2e-84
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   276   2e-84
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   276   3e-84
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   276   3e-84
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              275   5e-84
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   274   6e-84
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   275   6e-84
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   274   6e-84
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   274   9e-84
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   275   1e-83
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   273   1e-83
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   275   1e-83
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   273   2e-83
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   275   2e-83
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   274   2e-83
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   271   8e-83
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   272   9e-83
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      270   1e-82
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   271   2e-82
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   271   2e-82
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   271   2e-82
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   270   2e-82
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   270   3e-82
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   271   4e-82
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   271   4e-82
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   270   5e-82
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   268   2e-81
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   268   3e-81
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   266   4e-81
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              268   4e-81
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   267   5e-81
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   267   5e-81
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   267   5e-81
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   265   6e-81
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              268   6e-81
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   265   6e-81
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   267   7e-81
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   266   1e-80
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   266   1e-80
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   266   1e-80
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   265   1e-80
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   265   1e-80
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   265   2e-80
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   265   2e-80
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   264   3e-80
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   265   3e-80
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   265   4e-80
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   266   4e-80
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   265   4e-80
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              263   5e-80
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   265   6e-80
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   265   1e-79
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   263   1e-79
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   263   1e-79
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   263   2e-79
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   263   3e-79
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   262   3e-79
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   261   5e-79
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   261   5e-79
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   261   9e-79
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   260   9e-79
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   260   1e-78
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   260   1e-78
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   259   3e-78
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   259   3e-78
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   258   8e-78
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   258   9e-78
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   256   2e-77
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   256   3e-77
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   254   3e-77
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   257   4e-77
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   255   5e-77
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      255   6e-77
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   257   6e-77
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   255   1e-76
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   255   1e-76
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   253   2e-76
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              254   2e-76
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   253   2e-76
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   251   3e-76
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   251   5e-76
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   253   1e-75
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   253   1e-75
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   253   2e-75
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   251   2e-75
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              251   3e-75
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   249   2e-74
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   249   2e-74
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   250   4e-74
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   249   5e-74
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   247   8e-74
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              248   2e-73
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   245   4e-73
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   246   5e-73
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    243   6e-73
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   244   6e-73
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   245   6e-73
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   244   8e-73
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              246   8e-73
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   244   2e-72
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   243   8e-72
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   241   1e-71
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   241   1e-71
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                240   3e-71
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   240   5e-71
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   240   1e-70
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   239   2e-70
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   238   3e-70
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   239   3e-70
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   236   4e-70
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   238   5e-70
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   237   7e-70
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   237   1e-69
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   238   2e-69
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   235   4e-69
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   238   2e-68
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   233   2e-68
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   233   2e-68
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   232   3e-68
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    231   7e-68
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   231   1e-67
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   236   2e-67
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              230   3e-67
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   229   5e-67
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   233   9e-67
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   226   6e-66
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      226   6e-66
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   224   2e-65
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   230   2e-65
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                224   3e-65
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   224   5e-65
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   228   1e-64
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   222   2e-64
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   226   5e-64
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   221   7e-64
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   220   1e-63
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   219   2e-63
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   216   5e-63
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   219   6e-63
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   218   1e-62
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   222   1e-62
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   217   2e-62
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   217   2e-62
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   217   2e-62
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   217   2e-62
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   216   3e-62
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   220   8e-62
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   215   1e-61
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                214   2e-61
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              215   2e-61
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   214   2e-61
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   214   2e-61
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   214   3e-61
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   212   7e-61
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   213   8e-61
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   212   1e-60
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   212   1e-60
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   211   2e-60
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   211   3e-60
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   216   4e-60
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   210   6e-60
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   210   1e-59
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   214   1e-59
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   209   3e-59
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   212   7e-59
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   211   1e-58
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   211   2e-58
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   211   2e-58
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   206   2e-58
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   205   5e-58
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   209   5e-58
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   203   3e-57
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   207   3e-57
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   202   4e-57
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   205   1e-56
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   197   3e-55
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   198   2e-54
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   194   3e-54
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   196   2e-53
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     178   4e-50
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     177   5e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   171   6e-45
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         137   3e-35
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   123   2e-31
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          99   4e-23
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     100   9e-23
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     99   7e-22
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    83   6e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   1e-16
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          74   1e-14
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      65   8e-12
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    60   2e-09
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              38   0.027
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    39   0.048
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    35   0.42 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    35   0.77 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    34   0.90 
Suva_4.134 Chr4 (247333..251643) [4311 bp, 1436 aa] {ON} YDL112W...    34   1.2  
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              32   1.3  
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    33   2.5  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    32   3.7  
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    32   6.0  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    32   6.6  

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 1074 bits (2777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/574 (95%), Positives = 546/574 (95%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60
           MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA
Sbjct: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           EVKRELKQRH                  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE
Sbjct: 61  EVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120

Query: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
           MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA
Sbjct: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY 240
           AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY
Sbjct: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY 240

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT
Sbjct: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPD 360
           VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKL          PFIIAIENSGTKILPD
Sbjct: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENSGTKILPD 360

Query: 361 IFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVL 420
           IFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVL
Sbjct: 361 IFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVL 420

Query: 421 AYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMP 480
           AYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMP
Sbjct: 421 AYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMP 480

Query: 481 GLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL 540
           GLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL
Sbjct: 481 GLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL 540

Query: 541 EDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           EDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA
Sbjct: 541 EDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/555 (69%), Positives = 450/555 (81%), Gaps = 13/555 (2%)

Query: 27  QDDDMKKI-------NIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXX 79
           +D+  K++       N +   D  S  ED +  + G V +AEVKRELKQRH         
Sbjct: 42  KDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGT 101

Query: 80  XXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFL 139
                    STPL ++GPVG+LI+Y+F+G+L Y+VTQSLGEMATFIPVTSSFTVF+ RFL
Sbjct: 102 IGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFL 161

Query: 140 SPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVK 199
           SP+ GAA GYMYWFSWAVTFALELSVVGQ++ +WT+AVP+AAWISIFWVI+TA+NMFPVK
Sbjct: 162 SPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVK 221

Query: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEIS 259
           +YGE EFWVA++KV+AI+GFLIYC CMVCGAGVTGPVGFRYWRNPG WG G+      IS
Sbjct: 222 YYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGI------IS 275

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
           KNKN  RFLGW +SLINAAFT+QGTELVGITAGEAANPRKTVPRAIKKVVFRIL FYIGS
Sbjct: 276 KNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGS 335

Query: 320 LFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379
           L FIGLLVP++DPKL          PFIIAIENSGTK+LP IFNA+IL TIISA NSNIY
Sbjct: 336 LLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIY 395

Query: 380 VGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNI 439
           VGSR+LF L+K+ LAPK  S+TTK GVP+++V AT++FG LAYMET+ GG  VF WL+NI
Sbjct: 396 VGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNI 455

Query: 440 TAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGF 499
           T +AGF+AWLFI +SHIRFMQ LK+RGISRD+LPFKA LMPGLAYYA F MV+II+ QGF
Sbjct: 456 TGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGF 515

Query: 500 TAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWED 559
           T+FTPTF+  +F AAYISV LF  IW  F+L F+CR++WK+EDVDIDS+RRD+E I+WE+
Sbjct: 516 TSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEE 575

Query: 560 PEPKTFWDKFWNVVA 574
           PEPKT WDKFWNVV 
Sbjct: 576 PEPKTLWDKFWNVVG 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/570 (67%), Positives = 452/570 (79%), Gaps = 10/570 (1%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKR 64
              ++ +   + + V +++++ +     + +I  +    S  + E    +G VHDAEVKR
Sbjct: 20  RKKAEEMRETKLAAVTSYTSLGES----RADIRHRMSFESGEDGESEEQTGYVHDAEVKR 75

Query: 65  ELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATF 124
           ELKQRH                  STPL+ +GPVG+LI+YIF+GTL Y+VTQSLGEMATF
Sbjct: 76  ELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGEMATF 135

Query: 125 IPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWIS 184
           IPVTSSFTVFA RFLSPSIGAA GYMYWFSWAVTFALELSV+GQ++ YWT+AVP+AAWIS
Sbjct: 136 IPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLAAWIS 195

Query: 185 IFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNP 244
           IFWV++TA NMFPVK+YGE+EFW+A +KV+AIVGFL+YCLCMVCGAGVTGPVGFRYWRNP
Sbjct: 196 IFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVGFRYWRNP 255

Query: 245 GPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRA 304
           GPWG G+      ISK+KN  RFLGW +SLIN AFTYQGTELVGI+AGEAANPRK VPRA
Sbjct: 256 GPWGPGI------ISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRA 309

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNA 364
           IKKVVFRIL FYIGSLFFIGLLVP++D  L          PFIIAI+NSGT +LP IFNA
Sbjct: 310 IKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIFNA 369

Query: 365 IILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYME 424
           +I  TI+SAGNSN+YVGSRILF L+K  LAPKILSRTTK GVPW++VL T+V G LAYME
Sbjct: 370 VIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYME 429

Query: 425 TTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAY 484
           T+ GGQ  F+WL+NITA+AGF+ WLFI +SHIRFMQ LK+RGISRDDLPFKA LMPGLAY
Sbjct: 430 TSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAY 489

Query: 485 YAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVD 544
           YA F M +III QGFTAF P F  SDF AAYIS+ LF  IW  FQ+ F+CR+I K+EDVD
Sbjct: 490 YASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVD 549

Query: 545 IDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           ID++RRD+E ++WED EPKT WDKFWN++A
Sbjct: 550 IDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/562 (68%), Positives = 450/562 (80%), Gaps = 9/562 (1%)

Query: 16  KSGVQTFSTMSQDDD--MKKINIIQQTDASSTTE-DEEMLNSGSVHDAEVKRELKQRHXX 72
           K+G    S+   DD    ++ N +    +  T E  EE + +G + +AEVKRELKQRH  
Sbjct: 10  KNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIG 69

Query: 73  XXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFT 132
                           STPL ++GPVG+LIAY+F+GTL Y+VTQSLGEMATFIPVTSSFT
Sbjct: 70  MIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFT 129

Query: 133 VFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTA 192
           VF+ RFLSPS GAA GYMYWFSWA+TFALELSVVGQI+ +WT AVPI AWISIFWV+L A
Sbjct: 130 VFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVA 189

Query: 193 LNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLT 252
           +NMFPV+FYGE EFWVA++KV+AI+GFLIYCLCMVCGAGVTGPVGFRYWRNPGP G G+ 
Sbjct: 190 MNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGI- 248

Query: 253 SNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRI 312
                I+KN N  +FLGW +SLINAAFTYQGTELVGITAGEAANPRK+VPRAIKKVVFRI
Sbjct: 249 -----IAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRI 303

Query: 313 LLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIIS 372
           L FYIGSLFFIGLLVP++DPKL          PFII+I+NSGT ILP IFNA+IL TIIS
Sbjct: 304 LFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIIS 363

Query: 373 AGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTV 432
           A NSN+YVGSRI+F L+K+ LAP+ILSRT K GVPWVSV+ T +FG LAYMET+ GG+  
Sbjct: 364 AANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAA 423

Query: 433 FDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVI 492
           F+WL+NIT +AGF++WLFI ISH+RFMQ L++RGISRDDLPFKA  MPGLAYYA+F M +
Sbjct: 424 FNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTL 483

Query: 493 IIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDV 552
           III QGFT+F P+FD  DF AAYIS  LF  IW  FQLWF+CR IWK+EDVDID++RRD+
Sbjct: 484 IIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDI 543

Query: 553 EKIIWEDPEPKTFWDKFWNVVA 574
           E+++WEDP P TFWDKFWNVVA
Sbjct: 544 EEVVWEDPPPVTFWDKFWNVVA 565

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/579 (66%), Positives = 455/579 (78%), Gaps = 17/579 (2%)

Query: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQ-------TDASSTTEDEEMLNSG 55
           TL    ++    R+ G    S   +D+  K++  ++         D  S  E+ +  + G
Sbjct: 22  TLLHDVEASQTHRRRG----SLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEG 77

Query: 56  SVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVT 115
            V +AEVKRELKQRH                  STPL ++GPVG+LIAY+F+G+L ++VT
Sbjct: 78  EVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVT 137

Query: 116 QSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF 175
           QSLGEMATFIPVTSSFTVF+ RFLSP+ GAA GYMYWFSWA+TFALELSVVGQ++ +WT 
Sbjct: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197

Query: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235
            VP+AAWISIFWV++T +N+FPVK+YGE EFWVA++KV+AI+GFLIYC CMVCGAGVTGP
Sbjct: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257

Query: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           VGFRYWRNPG WG G+      ISKNKN GRFLGW +SLINAAFT+QGTELVGITAGEAA
Sbjct: 258 VGFRYWRNPGAWGPGI------ISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGT 355
           NPRKTVPRAIKKVVFRIL FYIGSL FIGLLVP++DPKL          PFI+AI+NSGT
Sbjct: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGT 371

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
           K+LP IFNA+IL TIISA NSNIYVGSRILF L+K  LAPK LSRT+K GVP+++V ATA
Sbjct: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
           VFG LAYMET+ GG  VF+WL+NIT +AGF+AWLFI ISHIRFMQ LK+RGISRD+LPFK
Sbjct: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491

Query: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCR 535
           A LMPGLAYY+ F M+IIII QGFTAF P F+ S F AAYIS+ LF  +W  F+  F+CR
Sbjct: 492 AKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCR 551

Query: 536 WIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           +IWK+EDVDIDS+RRD+E I+WED EPKTFWDKFWNVVA
Sbjct: 552 FIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/579 (66%), Positives = 450/579 (77%), Gaps = 17/579 (2%)

Query: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEML-------NSG 55
           TL    ++    R+ G    S   +D+  K++  +         ED   +       + G
Sbjct: 22  TLFHDVEASQTHRRRG----SLPLKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRDEDQG 77

Query: 56  SVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVT 115
            V +AEVKRELKQRH                  S PL ++GPVG+LI+Y+F+G+L Y+VT
Sbjct: 78  EVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVT 137

Query: 116 QSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF 175
           QSLGEMATFIPVTSSFTVF+ RFLSP+ GAA GYMYWFSWA+TFALELSVVGQ++++WT 
Sbjct: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTN 197

Query: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235
            VP+AAWISIFWVI+T +N+FPVK+YGE EFWVA++KV+AI+GFLIYC CMVCGAGVTGP
Sbjct: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257

Query: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           VGFRYWRNPG WG G+      ISK+KN GRFLGW +SLINAAFT+QGTELVGITAGEAA
Sbjct: 258 VGFRYWRNPGAWGPGI------ISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGT 355
           NPRKTVPRAIKKVVFRIL FYIGSL FIGLLVP++DPKL          PFIIAIENSGT
Sbjct: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIENSGT 371

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
           K+LP IFNA+IL TIISA NSNIYVGSRILF L+K  LAPK LSRTTK GVP+++V  TA
Sbjct: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITA 431

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
           VFG LAYMET+ GG  VF+WL+NIT +AGF+AWL I ISHIRFMQ LK+RGISRD+LPFK
Sbjct: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFK 491

Query: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCR 535
           A LMPGLAY+A   M+III+ QGFTAF P FD  DF AAYIS+ LF  IW  F++ F+CR
Sbjct: 492 AKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCR 551

Query: 536 WIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           +IWK+EDVDIDS+RRD+E I+WED EPKTFWDKFWNVVA
Sbjct: 552 FIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/528 (71%), Positives = 431/528 (81%), Gaps = 11/528 (2%)

Query: 47  EDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           EDE     G V +AEVKRELKQRH                  STPL ++GPVG+LI+Y+F
Sbjct: 74  EDE-----GEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLF 128

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           +G+L Y+VTQSLGEMATFIPVTSSFTVF+ RFLSP+ GAA GYMYWFSWA+TFALELSVV
Sbjct: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188

Query: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226
           GQ++ +WT+ VP+AAWISIFWVI+T +N+FPVK+YGE EFWVA++KV+AI+GFLIYC CM
Sbjct: 189 GQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 227 VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTEL 286
           VCGAGVTGPVGFRYWRNPG WG G+      ISK+KN GRFLGW +SLINAAFT+QGTEL
Sbjct: 249 VCGAGVTGPVGFRYWRNPGAWGPGI------ISKDKNEGRFLGWVSSLINAAFTFQGTEL 302

Query: 287 VGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPF 346
           VGITAGEAANPRK+VPRAIKKVVFRIL FYIGSL FIGLLVP++DPKL          PF
Sbjct: 303 VGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPF 362

Query: 347 IIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGV 406
           IIAIENSGTK+LP IFNA+IL TIISA NSNIYVGSRILF L+K  LAPK LSRTTK GV
Sbjct: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGV 422

Query: 407 PWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRG 466
           P+++V  TA FG LAYMET+ GG  VF+WL+NIT +AGF+AWLFI ISHIRFMQ LK+RG
Sbjct: 423 PYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482

Query: 467 ISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWG 526
           ISRD+LPFKA LMPGLAYYA   M IIII QGFTAF P F+   F AAYIS+ LF  +W 
Sbjct: 483 ISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWI 542

Query: 527 AFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
            FQ  F+CR+IWK+ DVDIDS+RRD+E I+WED EPKTFWDKFWNVVA
Sbjct: 543 LFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/537 (67%), Positives = 425/537 (79%), Gaps = 9/537 (1%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
              D+    E  E+  S  V    V+RELKQRH                  STPL ++GP
Sbjct: 5   HNQDSKMKEEIREI--SVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGP 62

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAV 157
           VG+LIAY+F+ TL Y+VTQSLGEMATFIPVTSSFTVF+ RF+SP+ GAA GYMYWFSW +
Sbjct: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122

Query: 158 TFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIV 217
           TFALELSVVGQ++ +WTFAVP+AAWISIFWV+LT +NMFPVK+YGE EFWVA VKVVAI+
Sbjct: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182

Query: 218 GFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277
           GFLIYC CMVCGAGVTGPVGFRYWR+PG +G G+      I+K+KN  RFLGW +SLINA
Sbjct: 183 GFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGI------IAKDKNQARFLGWVSSLINA 236

Query: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
           AFT+QGTELVGITAGEAANPRKTVPRAIKKVVFRIL FYI SLFFIGLLVP+DD KL   
Sbjct: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTST 296

Query: 338 XXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKI 397
                  PFIIAIENSGT +LP IFNA+I+ TIISAGNSNIYVGSRI++ L+ + LAP I
Sbjct: 297 DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356

Query: 398 LSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIR 457
           LSRTT+ GVPWV+VL T++FG LAYMET+ GGQ  F+WL+NIT +AGF+ WLFI +SHIR
Sbjct: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416

Query: 458 FMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYIS 517
           FMQ L+ RGISRDDLPFKA  MPGLAYY VF M +III QGFT+F P ++  DF  AYIS
Sbjct: 417 FMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYIS 475

Query: 518 VILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           V +F  IW AFQ WF+CR IW++EDVDID++RR VE+ +W + EP+ FWDKFWNVVA
Sbjct: 476 VFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/573 (62%), Positives = 429/573 (74%), Gaps = 25/573 (4%)

Query: 21  TFSTMSQDDDMK----KINIIQQTDASSTTEDEEML---------------NSGSVHDAE 61
            FS M+ +D        IN  +++  S TT  +E L                 G VH+AE
Sbjct: 17  NFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVDESLPGLSSSDLESSDDFVKEGQVHEAE 76

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           VKR LKQRH                  STPL ++GPVG LIAY+F+ TL Y+V QSLGEM
Sbjct: 77  VKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
           ATFIPVTS+FTVF+SRFLSP+ GAA GYMYWFSWA+TFALELSVVGQI+++WT AVP+AA
Sbjct: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYW 241
           WI+IFWV+LT  N+FPVK+YGE EFW+A +KV+A+VGF+IYCLCMVCGAG+TGPVGFRYW
Sbjct: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFRYW 256

Query: 242 RNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTV 301
           RNPG WG G+      ISK+KN GRFLGW +SLINAAFTYQGTELVGITAGEAANPRK+V
Sbjct: 257 RNPGAWGPGI------ISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310

Query: 302 PRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDI 361
           PRAIKKVVFRIL+FY     FIGLLVP++DPKL          PFIIAIENSGTK+LP I
Sbjct: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
           FNA++L TIISAGNSN+YVGSRI++ LAK  LAP    RT   GVP+ +V  T+ FG LA
Sbjct: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           YME + GG + F+WL+NIT +AGF+ W+ I   HIRFMQ LK+RGISRDDLPFKA  MP 
Sbjct: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490

Query: 482 LAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLE 541
           LAYYA+F MV+II+ QGFTAF PTF   DF AAY+SV LF  IW   Q+WF+CR   +L+
Sbjct: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD 550

Query: 542 DVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           +VDID++RRD+E ++W+D  PKT WDKFWN+VA
Sbjct: 551 EVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/575 (62%), Positives = 436/575 (75%), Gaps = 25/575 (4%)

Query: 14  QRKSGVQTFSTM--SQDDDMKKINI------IQQTDASST------TEDEEMLNSGSVHD 59
           + KS +Q   T+    D D    N        ++T  SST      TE +E+L     HD
Sbjct: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH---HD 65

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
             VKR LKQRH                  +TPL ++GPVG+L+AY+F+GT+ ++VTQSLG
Sbjct: 66  --VKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLG 123

Query: 120 EMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           EMATFIPVTSSF+VFA RFLSP++GAA GYMY+ SW  TFALELSVVGQI+ +WTF VP+
Sbjct: 124 EMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPL 183

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFR 239
           AAWISIFWV+LTA NMFPVKFYGE EFW+A++KV+A++GFLIY LC+VCGAG TGP+GFR
Sbjct: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFR 243

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           YWRNPG  G G+      IS N    RFLGW +SLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 244 YWRNPGAMGPGI------ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 297

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILP 359
            VPRAI+KV+ RILLFYIGSLFFIGL VP++DPKL          PFII I+N+GT++LP
Sbjct: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLP 357

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419
            IFNA+IL TIISAGNSN+YVGSRILFS+AK GLAPK L++TT +GVP++SVLA + FG 
Sbjct: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417

Query: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479
           L+YME + GG   F+WL+NIT +AGF+AWL I  SH+RFMQ LK RGISRDDLP+KA  M
Sbjct: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477

Query: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539
           P LAYYA+F MV+II+ QGFT+F P F   DF AAYISV LF + WG FQ++F+CR IWK
Sbjct: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWK 537

Query: 540 LEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           LEDVDID++RR++E ++WED  PKT WDKFW+ VA
Sbjct: 538 LEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/552 (67%), Positives = 442/552 (80%), Gaps = 6/552 (1%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXX 82
           S++  D   + ++    + + S  EDE  ++ G V DAEVKRELKQRH            
Sbjct: 50  SSIVVDGSSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGT 109

Query: 83  XXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPS 142
                 STPL+++GPVGSLIAY+F+ T+ ++VTQSLGEMATFIPVTSSFTVF+SRF+SPS
Sbjct: 110 GLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPS 169

Query: 143 IGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYG 202
           IGAA GYMYWFSWA+TFALELSVVGQI+ +WT AVP++AWI I+W ILT +NMFPVKFYG
Sbjct: 170 IGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYG 229

Query: 203 EIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNK 262
           E EFWVA++KV+AI+GFLIYCLCMVCGAGVTGPVGFRYWRNPGPWG G+      IS   
Sbjct: 230 EFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGI------ISSQV 283

Query: 263 NTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFF 322
             GRFLGW +SLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKV FRIL+FYI SLFF
Sbjct: 284 AEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFF 343

Query: 323 IGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382
           IGLLVPFDDPKL          PFIIAI+NSGTK+LP IFNA+IL TIISAGNSNIYVGS
Sbjct: 344 IGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGS 403

Query: 383 RILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAI 442
           R++F LAKT LAP+    TTK GVP+++VL T+ FG LA++E + GG   F+WL+NI  +
Sbjct: 404 RVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGV 463

Query: 443 AGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAF 502
           AGF+AWL I I+H+RF+Q L+ RGISRDDLPFKA LMP LAYYA+F M+IIII QGFTAF
Sbjct: 464 AGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAF 523

Query: 503 TPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEP 562
            PTF+ SDF AAYISV LFF +W +FQL+F+C+  W L++VDID++RRD++ IIWED  P
Sbjct: 524 APTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAP 583

Query: 563 KTFWDKFWNVVA 574
           KTFWD+FW+VVA
Sbjct: 584 KTFWDRFWDVVA 595

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/520 (70%), Positives = 425/520 (81%), Gaps = 6/520 (1%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           G V +AEVKR+LKQRH                  +TPL ++GPVG+LIAY+F+ T+ ++V
Sbjct: 90  GVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSV 149

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
           TQSLGEMATFIPVTSSFTVF+SRFLSP+IGAA GYMYWFSWAVTFALELSVVGQI+ +WT
Sbjct: 150 TQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWT 209

Query: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTG 234
            AVP++AWI I+WVILT +N+FPVKFYGE EFWVA++KV+AI+GFLIYCLCMVCGAGVTG
Sbjct: 210 HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTG 269

Query: 235 PVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEA 294
           PVGFRYWRNPGPWG G+      ISK+ N GRFLGW +SLINAAFTYQGTELVGITAGEA
Sbjct: 270 PVGFRYWRNPGPWGPGI------ISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 323

Query: 295 ANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSG 354
           ANPRKTVPRAIKKV FRIL+FYI SLFFIGLLVP+DD KL          PFIIAIENSG
Sbjct: 324 ANPRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSG 383

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
           TKILP IFNA+IL TIISAGNSN+YVGSRILF LAKT LAPK    T++ GVP+ SV  T
Sbjct: 384 TKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFT 443

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           + FG LA++E + GG   F+WL+NI ++AGF+AWL I I+H+RFMQ LK RGISRDDLPF
Sbjct: 444 SSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPF 503

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKC 534
           KA  MP LAYY++F M IIII QGFTAF PTF+ SDF AAYIS+ LFF +W  FQL+F+ 
Sbjct: 504 KARFMPHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRS 563

Query: 535 RWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           + +W +E+VDID++RRDV+ IIWED  PKTFWDKFW+VVA
Sbjct: 564 KLLWTVEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/573 (61%), Positives = 428/573 (74%), Gaps = 16/573 (2%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61
           +TLE  S+ V +  +S ++       +D         + + S   +DE           E
Sbjct: 10  ETLEGKSKIVIKSTES-LEQHDLQGNEDKNTPTTTPSKENVSENEKDEYH---------E 59

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           VKR+L +RH                  + PL  SGPVGSLIAY+F+GT+ Y+VTQSLGEM
Sbjct: 60  VKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
           ATFIPVT+SFT+F+ RFLSP++GAA GYMYWFSWA+TFALELSVVGQI+ +WTFAVP+ A
Sbjct: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPA 179

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYW 241
           WISIFWVILT  N+FPV+ YGEIEFW+A +KV AI+GF+IYC C+VCGAG TGPVGFRYW
Sbjct: 180 WISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYW 239

Query: 242 RNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTV 301
           RNPGPWG G+      IS N    RFLGW +SLINAAFT+QGTELVGITAGEAANPR+TV
Sbjct: 240 RNPGPWGTGI------ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTV 293

Query: 302 PRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDI 361
           P+AI+KVVFRIL+FYI SLFFIGLLVP+DD KL          PFIIAIENSGTKILP I
Sbjct: 294 PKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHI 353

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
           FN +IL+TIISAGNSN+Y+GSR+LF LAK G  PK+ ++TTK GVP  +V+ T++FG LA
Sbjct: 354 FNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALA 413

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           +MET+ GG   F WL+N+  +AGF++WL I  +HIRFMQ L+ RGISR+DLPFKA  MP 
Sbjct: 414 FMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPY 473

Query: 482 LAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLE 541
           LAYYA   M+III FQGFTAF P FDV +FFA+YISV LFF+ WG+FQLWFKCR++WKL 
Sbjct: 474 LAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV 533

Query: 542 DVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           D+DID +RR++E  +W+D  P   W KFW+ VA
Sbjct: 534 DIDIDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/532 (64%), Positives = 414/532 (77%), Gaps = 7/532 (1%)

Query: 44  STTEDEEMLNS-GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLI 102
           S  ED   + S GSV + +VKR LK RH                  STPL ++GPVG+LI
Sbjct: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82

Query: 103 AYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALE 162
           AY+F+GTL Y+VTQSLGEMATFIPVTSSFTVF  RFLSP++G+A GY+YW SWA+TFALE
Sbjct: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142

Query: 163 LSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222
           LSVVGQI+ +WT AVP+ AWI+IFWVILT  N+FPVK+YGE+EFW+A +KV+AIVGF+IY
Sbjct: 143 LSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIY 202

Query: 223 CLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282
              MVCGAG TGPVGFRYWRNPGPWG G+      ISK+ N GRFLGW +SLI+AAFTYQ
Sbjct: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGI------ISKDVNEGRFLGWVSSLISAAFTYQ 256

Query: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX 342
           GTELVGITAGEAANPRKTVPRAI KV FRIL FYI SL FIGLLVPF+DPKL        
Sbjct: 257 GTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYIS 316

Query: 343 XXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTT 402
             PF+IAIENSGTK+LP IFNA+IL TIISAGNSN+YVGSRI +S+A  GLAPK L+ TT
Sbjct: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376

Query: 403 KKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVL 462
           K G+P+ +VL T+V G LAY+E++ G   VF+WL+NITA+AGF+ W+ I ISHIRFMQ L
Sbjct: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436

Query: 463 KFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFF 522
           K +GISRDDLPFKA  MP  AYYA F + +III QGFTAF P F VSDFF AYISV+LFF
Sbjct: 437 KHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFF 496

Query: 523 LIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           + W  FQ+WF+     K ED+D+D++RR+++ ++WE+ +P+  W+KFW  +A
Sbjct: 497 VFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/551 (63%), Positives = 419/551 (76%), Gaps = 6/551 (1%)

Query: 24  TMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXX 83
           T S D+  + ++ +      S     + ++ G+V DAEVKR LK RH             
Sbjct: 44  TKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTG 103

Query: 84  XXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSI 143
                S+PL D+GPVG+LIAY+F+GT+ Y VTQSLGEMATFIPVTSSFTVF  RFLSP+ 
Sbjct: 104 LFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAF 163

Query: 144 GAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGE 203
           G A GY+YWFSW +TFALELSVVGQI+ +WTFAVP+ AWI+IFWVILT  N+FPVK+YGE
Sbjct: 164 GVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGE 223

Query: 204 IEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKN 263
           +EFW+A +KV+AIVGF+IY   MVCGAG TGPVGFRYWRNPGPWG G+      ISK+ N
Sbjct: 224 VEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGI------ISKDVN 277

Query: 264 TGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFI 323
            GRFLGW +SLINAAFTYQGTELVGITAGE+ NPR+TVPRAI KV FRIL FYI SL FI
Sbjct: 278 EGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFI 337

Query: 324 GLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSR 383
           GLLVPF+DPKL          PF+IAIENSGTK+LP IFNA+IL TIISAGNSNIYVGSR
Sbjct: 338 GLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSR 397

Query: 384 ILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIA 443
           +L+ LAK  LAPK+ +R TK GVP++SVL TA FG LAY+  +   Q VFDWL+NITAIA
Sbjct: 398 VLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIA 457

Query: 444 GFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT 503
           GF+AWLFI ++HIRFMQVLK R +SR+DLPFKA  MP  AYY+ F + +III QGFTAF 
Sbjct: 458 GFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFA 517

Query: 504 PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPK 563
           P F+VS+FFAAYISV LF  IW  FQ+ F+ R+I    DVDID++RRD++ I+WE+  PK
Sbjct: 518 PKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPK 577

Query: 564 TFWDKFWNVVA 574
             WDKFW  +A
Sbjct: 578 NAWDKFWAAMA 588

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/553 (61%), Positives = 416/553 (75%), Gaps = 7/553 (1%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNS-GSVHDAEVKRELKQRHXXXXXXXXXXX 81
           S        K+ N  +     S ++D   L S GSV + +VKR LK RH           
Sbjct: 2   SAQQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIG 61

Query: 82  XXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSP 141
                  STPL ++GPVG+LIAY+F+GTL Y V+QSLGEMATFIPVTSSF VF  RFLSP
Sbjct: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSP 121

Query: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFY 201
           ++GAA GYMY+ SW++TFALELSVVGQ++ +WT AVP+ AWI I WV+L + N+ PVKFY
Sbjct: 122 ALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFY 181

Query: 202 GEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKN 261
           GE+EFW+A +KV+AIVGF+IY   MVCGAG TGPVGFRYWRNPGPWG G+      ISK+
Sbjct: 182 GEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGI------ISKD 235

Query: 262 KNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLF 321
            N GRFLGW +SLI+AAFTYQGTELVGITAGEAANPRKTVPRAI KV FRIL FYI SL 
Sbjct: 236 VNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLL 295

Query: 322 FIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVG 381
           FIGLLVPF+DPKL          PF+IAIENSGTK+LP IFNA+IL TIISAGNS++Y+ 
Sbjct: 296 FIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYIS 355

Query: 382 SRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITA 441
           SR+L+S+   GLAPK L+ TTK G+P+ +VL T++ G LAY+E++ G   VFDWL+NITA
Sbjct: 356 SRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITA 415

Query: 442 IAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTA 501
           +AGF+AW+ I ++HIRFMQ LK +GISRDDLPFKA  MP  AYYA F + +III QGFTA
Sbjct: 416 VAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTA 475

Query: 502 FTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPE 561
           F P F+VSDFF AY+SVILFF +W  FQ+WF+     K ED+D+D++RR+++  +WE+ E
Sbjct: 476 FAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDE 535

Query: 562 PKTFWDKFWNVVA 574
           PK  W+KFW+ VA
Sbjct: 536 PKNLWEKFWSAVA 548

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/517 (63%), Positives = 407/517 (78%), Gaps = 6/517 (1%)

Query: 58  HDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117
           HD EVKR LKQRH                  S PL +SGPVGSLIAY+F+G++ Y++TQS
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 118 LGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           LGEMATFIPVTSS TVF+ RFLSP+ G A GYMYWF+WA+T+A+E+SVVGQ+++YWT  V
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVG 237
           P+AAWI+IFWV +T +N FPVK YGEIEFW+A +KV+AI G+L+Y L +VCG    GP+G
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIG 276

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
           FRYWRNPGPWG G+      ISK+KNT RFLGW +SLINAAFTYQGTELVGITAGEAANP
Sbjct: 277 FRYWRNPGPWGAGI------ISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANP 330

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKI 357
           RK+VPRAI KVVFRI LFYI SLFFIGLLVP+DDP+L          PF+I+I+N+GTKI
Sbjct: 331 RKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKI 390

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           LPDIFNAI++IT+ISA NSN+YVGSR+L++LA+TG APK  +  T+ GVP++ VL TA  
Sbjct: 391 LPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAAL 450

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           G+LA++       T F+WL+NI+ +AG  AWLFI ISHIRFMQ LKFRGISRDDLPFKA 
Sbjct: 451 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 510

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537
            MP  AYYA F + +II  QGF AF+P FDV+ FF AYIS+I+  +++   Q++++CR+ 
Sbjct: 511 FMPWAAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFF 570

Query: 538 WKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           WKLED+DID++RR++E++IWED EPKT+WDKFW  VA
Sbjct: 571 WKLEDIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/582 (58%), Positives = 433/582 (74%), Gaps = 23/582 (3%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTE---DEEMLNSGSVHD-- 59
           ES    + +  +  + + ST+ +++      I  + D   T E    +  +N+ S  +  
Sbjct: 3   ESVDMRMSKVSQYEINSISTIKEEEL-----ICARYDGQDTEEAVAGKSSINNDSAKETE 57

Query: 60  ------AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYA 113
                  EVKR+LKQRH                    PL  +GPVG+LI+Y+F+GT+ Y+
Sbjct: 58  TSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYS 117

Query: 114 VTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173
           VTQSLGEMATFIPVTSSF+VFA RFLSP++GA  GYMYW SW  TFALELSV+GQI+ YW
Sbjct: 118 VTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYW 177

Query: 174 TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT 233
           T AVP+ AWI IFW +LT +NMFPVK+YGE EF +A++KV+A++GF+ +  C+VCGAG +
Sbjct: 178 TDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQS 237

Query: 234 G-PVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAG 292
           G P+GFRYWRNPG WG G+      ISKNKN GRFLGW +SLINAAFTYQGTELVGITAG
Sbjct: 238 GGPIGFRYWRNPGAWGPGI------ISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAG 291

Query: 293 EAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIEN 352
           EAANPR+ VPRAIKKVV RIL+FYI SLFFIGLLVP++DPKL          PF+I+IEN
Sbjct: 292 EAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIEN 351

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
           SGTK+LPDIFNA++LITI+SAGNSN+Y+GSR+L+SL+K  LAP+ LS  TK GVP+ +VL
Sbjct: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVL 411

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
           +T+ FG LA++ET+ G   VF+WL+NIT +AGF+AWL I +SHIRFMQ +K RGISRDDL
Sbjct: 412 STSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDL 471

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWF 532
           P++A +MP LAYYA F + +I++ QGFTAF PTF   DF AAYISV LF  IW  FQ+WF
Sbjct: 472 PYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWF 531

Query: 533 KCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           KCR++WKL+DVDIDS+RRD+E+ +W +PE KT W   W++++
Sbjct: 532 KCRFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/561 (60%), Positives = 420/561 (74%), Gaps = 7/561 (1%)

Query: 14  QRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXX 73
           +++   Q   T  +D +M           + +++D ++ +SG   +A V+R+LK RH   
Sbjct: 6   EKEGMSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNA-VQRQLKPRHVSM 64

Query: 74  XXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTV 133
                           +PL ++GPVG+LI+Y+F+G++ Y VTQSLGEMATFIPVTSSFTV
Sbjct: 65  IALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTV 124

Query: 134 FASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTAL 193
           F  RFLS  +GAA GYMY FSW+VT+ALELS+VGQI++YWT AVP AAWI+IFWV +T  
Sbjct: 125 FTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLS 184

Query: 194 NMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTS 253
           N+ PVKFYGE +FW+A +KVVAI+GFL+YCLCMVCGAG TGPVGFRYWRNPGPWGDG+  
Sbjct: 185 NLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGI-- 242

Query: 254 NGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRIL 313
               IS + + GRFLGW +SL+NAAFTYQGTELVGI+AGE+ANPRKTVP+AI KV FRIL
Sbjct: 243 ----ISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRIL 298

Query: 314 LFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISA 373
           LFY+GSLFFIGLLVPF+D KL          PFIIAI+NSGTKILPDIFNA+IL TIISA
Sbjct: 299 LFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISA 358

Query: 374 GNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVF 433
            NSN+YVGSR+L+ LAK  LAP+  +RT + GVP V+VL  A FG L Y+  + G    F
Sbjct: 359 ANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAF 418

Query: 434 DWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVII 493
           DWL+NITAIAGF++WLFI + H+RFMQ LK +GISRDDLPFKA LMP  AYY+ F + +I
Sbjct: 419 DWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLI 478

Query: 494 IIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVE 553
           II QGFT+  PTF+VS+FFAAYISV +F +IW  FQ W++ R I ++E VDIDS+RR+V+
Sbjct: 479 IIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVD 538

Query: 554 KIIWEDPEPKTFWDKFWNVVA 574
              W++ EP T W KFW  +A
Sbjct: 539 AQQWDNTEPTTLWGKFWAAMA 559

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/550 (59%), Positives = 419/550 (76%), Gaps = 9/550 (1%)

Query: 28  DDDMKKINIIQQTDASSTTEDE--EMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXX 85
           D+     N+ +        ED+  +   S      EVKR+LKQRH               
Sbjct: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLI 89

Query: 86  XXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGA 145
                PL  +GPVG+LI+Y+F+GT+ Y+VTQSLGEM TFIPVTSSF+VFA RFLSP++GA
Sbjct: 90  IGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
             GYMYW SW  TFALELSV+G+++ YWT AVP+AAWI IFW +LT++NMFPVK+YGE E
Sbjct: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209

Query: 206 FWVAAVKVVAIVGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGDGLTSNGVEISKNKNT 264
           F +A++KV+A++GF+I+  C+VCGAG + GP+GFRYWRNPG WG G+      IS +KN 
Sbjct: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGI------ISSDKNE 263

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
           GRFLGW +SLINAAFTYQGTELVGITAGEAANPRK +PRAIKKVV RIL+FYI SLFFIG
Sbjct: 264 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIG 323

Query: 325 LLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           LLVP++DPKL          PF+I+IENSGTK+LPDIFNA++LITI+SAGNSN+Y+GSR+
Sbjct: 324 LLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L+SL+K  LAP+ LS  T+ GVP+ SVL+T+VFG LA++E + G    F+WL+NIT +AG
Sbjct: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
           F+AWL I  SHIRFMQ ++ RGISRDDLP+KA +MP LAYYA F + +I++ QGFTAF P
Sbjct: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503

Query: 505 TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKT 564
           TF   DF AAYIS+ LF  IW +FQ+WFKCR +WKL+D+DIDS+RR +E+++W +PE KT
Sbjct: 504 TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKT 563

Query: 565 FWDKFWNVVA 574
            W + W+V++
Sbjct: 564 RWQRVWDVLS 573

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/568 (62%), Positives = 432/568 (76%), Gaps = 14/568 (2%)

Query: 13  RQRKSGVQTFSTMSQDD------DMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKREL 66
           R R S  +     S +D        + +     + ASS+  +E++  +G V +A+VKREL
Sbjct: 47  RHRGSEGEVEYAKSDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKREL 106

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
           K RH                  +TP++++GPVGSLIAYIF+GTL ++VTQSLGEMATFIP
Sbjct: 107 KPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP 166

Query: 127 VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIF 186
           VTSSFTVFASRF+S   GAA GYMYWFSWA+TFALELSVVGQ++++WTF VP+AAWISIF
Sbjct: 167 VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIF 226

Query: 187 WVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGP 246
           WV++  +N FPVK YGE EFWVA++KV+AI+GF+IYCLCMVCGAG+TGPVGFRYWR+PGP
Sbjct: 227 WVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGP 286

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
           WG G+      ISK+KN  RFLGW +SLINAAFTYQGTELVGITAGEAANPRK+VPRAIK
Sbjct: 287 WGPGI------ISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 340

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAII 366
           KV  RILLFYI SLFFIGLLVP++DPKL          PFIIAI+NSGTK+LP IFNA+I
Sbjct: 341 KVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVI 400

Query: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426
           L TIISA NSN+YVGSRIL+ L+   LAPK   + T+ GVP+++VL TA FG LAYMET+
Sbjct: 401 LTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETS 459

Query: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYA 486
            GGQ  F+WL+NIT +AGF+AWL I ISHIRFMQ LK RG+SRDDLP+KA LMPGLAYY 
Sbjct: 460 AGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYG 519

Query: 487 VFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDID 546
            F + +II+ QGFTAF P FD + F  AYIS  LF  I+   Q +F+ R    L+DVDID
Sbjct: 520 AFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDID 579

Query: 547 SNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           ++RRD++ +IWE+  P+TFWDKFW V+A
Sbjct: 580 TDRRDIDTVIWEE-GPQTFWDKFWAVIA 606

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/558 (60%), Positives = 423/558 (75%), Gaps = 9/558 (1%)

Query: 26  SQDDDMKKI----NIIQQTDASSTT----EDEEMLNSGSVHDAEVKRELKQRHXXXXXXX 77
           S+D+ +KK      +   T A S +    E +E        D +VKRELKQRH       
Sbjct: 40  SKDNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALG 99

Query: 78  XXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASR 137
                      +TPL D+GPVG+LIAYIF+G++ Y VTQ+LGEMATFIPVTSS TVF+ R
Sbjct: 100 GTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQR 159

Query: 138 FLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFP 197
           FLSP+ G A GYMYWF+WA+TFA+E+SVVGQ++ YWT AVP+AAWI+IFWV++T +N FP
Sbjct: 160 FLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFP 219

Query: 198 VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV-TGPVGFRYWRNPGPWGDGLTSNGV 256
           VK YGE+EFWVA +KV+AIVG+L+Y L +VCG     GP+GFRYWRNPG WG+GLTS+G 
Sbjct: 220 VKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGE 279

Query: 257 EISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFY 316
            I  +K  GRFLGW  SLINAAFTYQGTELVGITAGEAANPRKTVPRAI KVVFRI+LFY
Sbjct: 280 PIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFY 339

Query: 317 IGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNS 376
           I SLFFIGLLVPF D +L          PF+I+IEN+GTKILPDIFNAI+++T++SA NS
Sbjct: 340 IMSLFFIGLLVPFTDSRLSDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANS 399

Query: 377 NIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWL 436
           N+YVGSR+L+SLA T +APKI +R T++GVP++ V+ T++ G+LA++       T F+WL
Sbjct: 400 NVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWL 459

Query: 437 VNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIF 496
           V+I+ +AG  AWLFI ++H+RFMQVLK RGISRDDLPFKA  MP  +YYA F + +II  
Sbjct: 460 VDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFV 519

Query: 497 QGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKII 556
           QGF AF+P FDV+ FF  YIS+IL  +++   QL+++CR++WKLEDVDIDS+RR++E  I
Sbjct: 520 QGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAI 579

Query: 557 WEDPEPKTFWDKFWNVVA 574
           WED EPKT WDKFW  +A
Sbjct: 580 WEDDEPKTIWDKFWAAIA 597

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/560 (60%), Positives = 421/560 (75%), Gaps = 11/560 (1%)

Query: 19  VQTFSTMSQDDDMKKINIIQQTDASSTT----EDEEMLNSGSVHDAEVKRELKQRHXXXX 74
           +Q+F    Q     +I ++++ ++SS      E +  +++ S  +  ++R LK RH    
Sbjct: 3   MQSFEKQPQLHK-NEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMI 61

Query: 75  XXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVF 134
                         + PL D+GPVGSLI+Y+F+G+L + VTQSLGEMATFIPV SSFTVF
Sbjct: 62  ALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVF 121

Query: 135 ASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALN 194
             RFLSP++GAA GYMY FSW +TFALELS+VG+I+ YWT  VP AAWI IFWV ++  N
Sbjct: 122 TRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSN 181

Query: 195 MFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSN 254
           +  VKFYGE +FW+A +KV+AIVGFLIYCLCMVCGAG TGPVGFRYWRNPGPWGDG+   
Sbjct: 182 LVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPWGDGI--- 238

Query: 255 GVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILL 314
              ISK+K+ GRFLGW +SL+NAAFTYQGTELVG++AGE+ANPRKTVP+AI+KV  RILL
Sbjct: 239 ---ISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILL 295

Query: 315 FYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAG 374
           FY+GSLFFIGLLVPF+DPKL          PFIIAI+NSGT+ LPDIFNA+IL TIISA 
Sbjct: 296 FYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAA 355

Query: 375 NSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFD 434
           NSN+YVGSR+L+ LAK GLAPKI+ R  + GVP++ V   ++FG L Y+  + G    FD
Sbjct: 356 NSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFD 415

Query: 435 WLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIII 494
           WL+NITAIAGF+AWLFI + HIRFMQ LK++GISRDDLPFKA LMP  AYYA F +++II
Sbjct: 416 WLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLII 475

Query: 495 IFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEK 554
           I QGFTAF P F+VS+FFAAY+SV LF  +W  FQ+ FK R I K+EDVDIDS+RR++E 
Sbjct: 476 IIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEA 535

Query: 555 IIWEDPEPKTFWDKFWNVVA 574
            +WED EP   W KFW  +A
Sbjct: 536 EVWEDDEPTNLWGKFWAAMA 555

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/556 (59%), Positives = 421/556 (75%), Gaps = 14/556 (2%)

Query: 27  QDDDMKKINIIQQTDASSTTEDEEMLNSGSV-------HDAEVKRELKQRHXXXXXXXXX 79
           ++ ++      +Q  +++   +  + N G+           EV+R+LK+RH         
Sbjct: 24  KEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGGT 83

Query: 80  XXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFL 139
                      PL  +GPVG+LI+Y+F+GT+ Y+VTQSLGEMATFIPVTSSF+VFA RFL
Sbjct: 84  IGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFL 143

Query: 140 SPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVK 199
           SP++GA  GYMYW SW  TFALELSV+GQI+ YWT AVP+AAWI IFW +LT +NMFPVK
Sbjct: 144 SPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFPVK 203

Query: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV-TGPVGFRYWRNPGPWGDGLTSNGVEI 258
           +YGE EF +A++KV+ ++GF+I+  C+VCGAG   GP+GFRYWRNPG WG G+      I
Sbjct: 204 YYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGI------I 257

Query: 259 SKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIG 318
           S NKN GRFLGW +SLINAAFTYQGTELVGITAGEAANPRK VPRAIKKVV RIL+FYI 
Sbjct: 258 SSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYIL 317

Query: 319 SLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNI 378
           SLFFIGLLVP++DPKL          PF+I+IENSGTK+LPDIFNA++LITI SAGNSN+
Sbjct: 318 SLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNV 377

Query: 379 YVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVN 438
           Y+GSR+L+SL+K  LAPK LS  T+ GVP+++VL T++FG LA++ET+ G    F+WL+N
Sbjct: 378 YIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLN 437

Query: 439 ITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQG 498
           IT +AGF+AWL I  SHIRFMQ +K RGISRDDLP+KA +MP LAYYA F + +I++ QG
Sbjct: 438 ITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQG 497

Query: 499 FTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWE 558
           FTAF PTF   DF AAYISV LF +IW +FQLWFKCR I KL+D+DIDS+RR++E+ +W 
Sbjct: 498 FTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQVWI 557

Query: 559 DPEPKTFWDKFWNVVA 574
           +PE KT W + W++++
Sbjct: 558 EPECKTRWQRVWDILS 573

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/539 (63%), Positives = 418/539 (77%), Gaps = 9/539 (1%)

Query: 39  QTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPV 98
           Q D++ T      L+       +VKRELK+RH                  + PL  +GP+
Sbjct: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPI 71

Query: 99  GSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158
           G+LIAY+F+GT+ ++VTQSLGEM TFIPVT+SFTVFA RFLSP+ GAA GYMYWFSWA+T
Sbjct: 72  GALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131

Query: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218
           FALELSVVGQI+ +WT AVP+AAWISI WV+LT  N+FPV+ YGEIEFW+A+VKV+AI+G
Sbjct: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILG 191

Query: 219 FLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAA 278
           F+IY +C++CGAGVTGPVGFRYW+NPGPWG G+      IS N N  RF GW +SLINAA
Sbjct: 192 FIIYGICIICGAGVTGPVGFRYWKNPGPWGMGI------ISSNVNEARFFGWVSSLINAA 245

Query: 279 FTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX 338
           FT+QGTELVGITAGE   PRKTVP+AIKKVVFRIL+FYIGSL  IGLLVP++DPKL    
Sbjct: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305

Query: 339 XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKIL 398
                 PFII I+N+GTKILP IFNA+ILITIISAGNSN+Y+GSRIL+ LAK   APK  
Sbjct: 306 SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFF 365

Query: 399 SRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRF 458
           + T+K GVP+V+VL T++FG LAYMETT GG   F WL+NI  +AGF+AWL I  SHIRF
Sbjct: 366 TNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRF 425

Query: 459 MQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISV 518
           M+ LK RGISR+DLP+KA LMP LAYYAVF MVIII+ QGFT+F P F V++FFAAYISV
Sbjct: 426 MKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISV 485

Query: 519 ILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWED---PEPKTFWDKFWNVVA 574
            LF + W AFQ+WFKCR +WKL+DVD+D++RRD+E+ +W D    + K +WD+FWN VA
Sbjct: 486 FLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/583 (61%), Positives = 430/583 (73%), Gaps = 20/583 (3%)

Query: 1   MDTLES--SSQSVPRQRKSGVQTFSTMSQDDDMK-----KINIIQQTDASSTTEDEEMLN 53
           ++ LE+  S+ S  +  +SG+   S    DD ++      + +    D SS   D E   
Sbjct: 10  LEELEALHSNLSQSQSARSGMHV-SNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPE--- 65

Query: 54  SGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYA 113
            GS+  AEVKR LK RH                  S PL ++GPVGSLIA++ +GTL Y+
Sbjct: 66  -GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124

Query: 114 VTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173
           VTQSLGEMATFIPVTSSFTVF+ RF+SP++GAA GYMYWFSWA+TFALELS+VGQI+ YW
Sbjct: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184

Query: 174 TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT 233
           T AVP+ AWI+IFWV+L + NMFPVK+YGE EFWVA++KV+AI+GFLIY LCMVCGAG  
Sbjct: 185 TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE 244

Query: 234 GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
           GP+GFRYWR PGPWG+G+      I+KN N  RFLGW +SLI+AAFTYQGTELVGITAGE
Sbjct: 245 GPIGFRYWRKPGPWGNGI------IAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGE 298

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX--XXXXXXPFIIAIE 351
             NPRK VPRAI KV FRIL+FYIGSLFFIGLLVP++DPKL            PF+IAI 
Sbjct: 299 TKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAIL 358

Query: 352 NSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSV 411
           N  T +LP IFNA+IL TIISAGNSN+YVGSRILF L+K  LAPK  S+TTK GVP+++V
Sbjct: 359 NCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAV 418

Query: 412 LATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDD 471
           L TAVFG LAY+  +   Q VFDWL+NITAIAGF  WL I ISHIRFMQ LK RGISRDD
Sbjct: 419 LITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDD 478

Query: 472 LPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLW 531
           LP+KA  MP  AYYA F + +III QGFTAF P F+VSDFFAAYISV LFF++W  FQ  
Sbjct: 479 LPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTI 538

Query: 532 FKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           ++ +    L++VDIDS+RRD++ IIWE+ EPK  W+KFW V A
Sbjct: 539 YRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/575 (58%), Positives = 419/575 (72%), Gaps = 14/575 (2%)

Query: 2   DTLESSSQSVP-RQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEM-LNSGSVHD 59
           ++ + SS   P   RKS +    ++    ++       Q   +S  +DEE         D
Sbjct: 48  NSFKDSSDKPPITLRKSKLSEIGSLHSGSNL------HQHGTTSLHDDEESDTEEAQYQD 101

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
             VKR LKQRH                  +TPL ++GPVGSLIAYIF+G++ Y VTQSLG
Sbjct: 102 TRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLG 161

Query: 120 EMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           EMATFIPVTSS TVF+ RFLSP+ G A GYMYWF+WA+T+A+E+SV+GQ++ YWT AVP+
Sbjct: 162 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPL 221

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFR 239
           AAWI IFWVI+T +N FPVK YGE EFW+A++KV+AI+G+LIY L +VCG    GP+GFR
Sbjct: 222 AAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFR 281

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           YWRNPGPWG G+      IS      RFLGW +SLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 282 YWRNPGPWGPGI------ISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 335

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILP 359
           +VPRAI KVVFRI LFYI SLFFIGLLVPF+D +L          PF+I+I+N+GT+ LP
Sbjct: 336 SVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALP 395

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419
           DIFNA++L+TIISA NSN+YVGSR+L++LA TG APKI S  TK GVP++ V+ TA  G+
Sbjct: 396 DIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGL 455

Query: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479
           LA++       T F+WL+NI+ +AG  AWLFI +SHIRFMQ LK+RGISRDDLPFKA LM
Sbjct: 456 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLM 515

Query: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539
           P  AYYA F + +II  QGF AFTP FDVS FF +YIS+IL  +++   QL+++CR+IWK
Sbjct: 516 PWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWK 575

Query: 540 LEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           +ED+DIDS+RR++E IIWE+ EPK  W+KFW  VA
Sbjct: 576 VEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/568 (57%), Positives = 422/568 (74%), Gaps = 12/568 (2%)

Query: 7   SSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKREL 66
           S+     ++K+G   F     DD +   + + ++    T+ ++E      VHD  VKR L
Sbjct: 42  SATEATHKKKTGSTGF-----DDTISLTHTLSRSRIP-TSMEDEDAEEAEVHDTRVKRAL 95

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
           KQRH                  STPL +SGPVG+LIAYIF+GT+ Y VTQSLGEMATFIP
Sbjct: 96  KQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEMATFIP 155

Query: 127 VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIF 186
           VTSS TVF+ RFLSP+ G A GYMYWF+WA+T+A+E+SV+GQ++ YWTF VP+AAWI IF
Sbjct: 156 VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIF 215

Query: 187 WVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGP 246
           WV++T +N FPVK YGE EFWVA++KV+AIVG+LIY L +VCG    GP+GFRYWRNPG 
Sbjct: 216 WVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRYWRNPGA 275

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
            G G+      IS +    RFLGW +SLINAAFTYQGTELVGITAGEAANPRK+VPRAI 
Sbjct: 276 MGAGI------ISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 329

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAII 366
           KVVFRI+LFYI SLFF+GLLVP++DP+L          PF+I+I+N+GTK+LPDIFNA++
Sbjct: 330 KVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAVV 389

Query: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426
           L+T+ISA NSN+YVGSR+L++LA++G APK  +  T+ GVP++ V+ TA+ G+LA++   
Sbjct: 390 LVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVN 449

Query: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYA 486
               T F+WL+NI+ +AG  AWLFI ++HIRFMQ LKFRGISRDDLPFKA  MP  AYYA
Sbjct: 450 HNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYA 509

Query: 487 VFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDID 546
            F + +II  QGF AF P FDVS+FF AYIS+IL  +++   QL+++CR++WKLED+DID
Sbjct: 510 SFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDIDID 569

Query: 547 SNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           S+RR+++ I+WED EP+  W+KFW  VA
Sbjct: 570 SDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/555 (59%), Positives = 411/555 (74%), Gaps = 14/555 (2%)

Query: 27  QDDDMKKINIIQQTDASSTTEDEEM-------LNSGSVHDAEVKRELKQRHXXXXXXXXX 79
           QDD +  +N+I  +   S     E+              D  VKR LKQRH         
Sbjct: 65  QDDAIASVNLITNSLPRSQIASHEVGDEEEDDEEEAHYEDKHVKRALKQRHIGMIALGGT 124

Query: 80  XXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFL 139
                    STPL  +GPVGSLI+YIF+GT+ Y +TQSLGEMATFIPVTSS TVF+ RFL
Sbjct: 125 IGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGEMATFIPVTSSITVFSKRFL 184

Query: 140 SPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVK 199
           SP+ G A GYMYWF+WA+T+A+E+SV+GQ++ YWT  VP+A WI+IFWV++T +N FPVK
Sbjct: 185 SPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLAVWIAIFWVLITLMNFFPVK 244

Query: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEIS 259
            YGE EFWVA+VKV+AI+G+LIY L +VCG    GP+GFRYWRNPG WG G+      IS
Sbjct: 245 VYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIGFRYWRNPGAWGPGI------IS 298

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
            +KN GRFLGW +SLINAAFTYQGTELVGITAGEAANPRKTVPRAI KVVFRI+LFYI S
Sbjct: 299 SDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMS 358

Query: 320 LFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379
           LFFIGLLVP+++P+L          PF+I+I+N+GT  LPDIFNA++LIT+ISA NSN+Y
Sbjct: 359 LFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVY 418

Query: 380 VGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNI 439
           VGSR+L+SLA+TG APK     TK+GVP++ VL+TA  G+LA++       T F+WL+NI
Sbjct: 419 VGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINI 478

Query: 440 TAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGF 499
           + +AG  AWLFI ++HIRFMQ L+ RGISRDDLPFKA LMP  AYYA F + +II  QGF
Sbjct: 479 STLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGF 538

Query: 500 TAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWED 559
            AF P F VSDFF +YIS+IL  +++   QL++KCR+IWKLED+DID++RR++E IIWED
Sbjct: 539 QAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDIDIDTDRREIEAIIWED 597

Query: 560 PEPKTFWDKFWNVVA 574
            EPK  W+KFW  VA
Sbjct: 598 DEPKNLWEKFWAAVA 612

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/517 (62%), Positives = 405/517 (78%), Gaps = 6/517 (1%)

Query: 58  HDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117
           HD +VKR LKQRH                  +TPL +SGPVGSLIAY+F+G++ Y +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 118 LGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           LGEMATFIPVTSS TVF+ RFLSP+ G A GYMYWF+WA+TFA+E+SVVGQ+++YWT  V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVG 237
           P+AAWI+IFWV++T LN FPVK YGEIEFW+A +KV+AI+G+L+Y L +VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
           FRYWRNPGPWG G+      ISK+ NTGRFLGW +SLINAAFTYQGTELVGITAGEAANP
Sbjct: 269 FRYWRNPGPWGPGI------ISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 322

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKI 357
           RKTVPRAI KVVFRI LFYI SLFFIG+LVP++D +L          PF+I+I+N+GTK+
Sbjct: 323 RKTVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKV 382

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           LPDIFNAI++ITIISA NSN+YVGSR+L++LA +G APK  +  T+ GVP++ V+ T+  
Sbjct: 383 LPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSAL 442

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           G+LA++       T F+WL+NI+ +AG  AWLFI ISHIRFMQ LKFRGISRDDLPFKA 
Sbjct: 443 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 502

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537
           LMP  AYYA F + +II  QGF AF+P +D + FF +YIS+I+  +++   Q++++CR+ 
Sbjct: 503 LMPFGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFF 562

Query: 538 WKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           W++ED+DIDS+RR++E +IWED EPKT WDKFW  VA
Sbjct: 563 WRVEDIDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/559 (59%), Positives = 420/559 (75%), Gaps = 20/559 (3%)

Query: 30  DMKKINIIQQTDASSTTEDEEML--------NSGSVHDAE------VKRELKQRHXXXXX 75
           ++K  N  +    S++    E++        N+G++   E      VKR LK RH     
Sbjct: 47  ELKSTNASEAASQSTSPTGSELIPDCLQSATNTGTLCTEEHVKHRSVKRALKPRHIAMIA 106

Query: 76  XXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFA 135
                        + PL ++GPVG+LIAYIFVGT+ ++VTQSLGEM TFIPVTSSFTVF+
Sbjct: 107 LGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFS 166

Query: 136 SRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNM 195
            RFLSP+ GAA GYMYWFSWA+TFA+ELSV+G+++ +WT AVP+AAWI IFW +LT  NM
Sbjct: 167 HRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNM 226

Query: 196 FPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNG 255
           FPVK+YGEIEFW+A +KV+++VGFLI+CLC+  GAG  GP GFRYWR+PG WG G+    
Sbjct: 227 FPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPFGFRYWRDPGAWGPGI---- 282

Query: 256 VEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLF 315
             I+++++  RFLGW +SLINAAFTYQGTELVGITAGEAANPRK VP+AIKKV+ RIL F
Sbjct: 283 --IAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPKAIKKVILRILFF 340

Query: 316 YIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGN 375
           Y+GSLFFIG+LVPF+DPKL          PFIIAI+NSG  +LP IFN +ILITIISAGN
Sbjct: 341 YVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIFNGVILITIISAGN 400

Query: 376 SNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDW 435
           SN+YVGSRILF LA + LAP+  +RTTK GVP+V+VL T++FG LA++E T  G  VF+W
Sbjct: 401 SNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNW 460

Query: 436 LVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIII 495
           L++I AIAGF+AWL I +SHIRFM+ L++RGISR+ LPFKA  MP LAYYA   +++II+
Sbjct: 461 LLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYATAFIILIIL 520

Query: 496 FQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKI 555
            QGFTAF P F+VSDF A+YIS++LF +IWG FQ   KCR  WK+ED+D+DS+R+D+E I
Sbjct: 521 IQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVEDIDLDSDRKDIEDI 580

Query: 556 IWEDPEPKTFWDKFWNVVA 574
            WED  PKTFW K W  +A
Sbjct: 581 RWEDDSPKTFWTKVWQTLA 599

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/585 (56%), Positives = 424/585 (72%), Gaps = 21/585 (3%)

Query: 1   MDTLESSSQSVP---RQRKSGVQTFSTMSQDDDMKKINIIQQT--------DASSTTEDE 49
           M+ ++ S+++ P    +++   +      Q   +  +N I  +          +   EDE
Sbjct: 37  MEAIDPSNKTTPYSIDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDE 96

Query: 50  EMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGT 109
           E        D  VKR LKQRH                  STPL ++GPVGSLIAYIF+GT
Sbjct: 97  E---EAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGT 153

Query: 110 LTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQI 169
           + Y VTQSLGEMATFIPVTSS TVF+ RFLSP+ G + GYMYWF+WA+T+A+E+SV+GQ+
Sbjct: 154 IVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQV 213

Query: 170 VDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG 229
           ++YWT  VP+AAWI+IFWVI+T +N FPVK YGE EFWVA+VKV+AI+G+LIY L +VCG
Sbjct: 214 IEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCG 273

Query: 230 AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGI 289
               GP+GFRYWRNPG WG G+      IS +K+ GRFLGW +SLINAAFTYQGTELVGI
Sbjct: 274 GSHQGPIGFRYWRNPGAWGPGI------ISSDKSEGRFLGWVSSLINAAFTYQGTELVGI 327

Query: 290 TAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIA 349
           TAGEAANPRKTVPRAI KVVFRI+LFYI SLFFIGLLVP++D +L          PF+I+
Sbjct: 328 TAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVIS 387

Query: 350 IENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWV 409
           I+N+GT  LPDIFNA++LIT++SA NSN+YVGSR+L+SLA+TG APK     T++GVP++
Sbjct: 388 IQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYL 447

Query: 410 SVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISR 469
            V+ TA  G+LA++       T F+WL+NI+ +AG  AWLFI ++HIRFMQ LK RGISR
Sbjct: 448 GVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISR 507

Query: 470 DDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQ 529
           DDLPFKA LMP  AYYA F + +II  QGF AF P F VS+FF +YIS+IL  +++   Q
Sbjct: 508 DDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQ 566

Query: 530 LWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           +++KCR+IWKLED+DIDS+RR++E IIWED EPK  W+KFW  VA
Sbjct: 567 IYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/582 (57%), Positives = 423/582 (72%), Gaps = 15/582 (2%)

Query: 1   MDTLESSSQSVP---RQRKSGVQTFSTMSQDDDMKKINIIQQT-----DASSTTEDEEML 52
           M+ +++S++ V     +++  ++  S +  D  +  IN I  +      AS     ++  
Sbjct: 37  MEVIDTSNKPVAYSIDEKQDNLKKKSGLMLDGTIGDINSITNSLTRSQIASHEQGGDDEE 96

Query: 53  NSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTY 112
                 D  V+R LKQRH                  STPL ++GPVGSLIAYIF+GT+ Y
Sbjct: 97  EEAHYEDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVY 156

Query: 113 AVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDY 172
            VTQSLGEMATFIPVTSS TVF+ RFLSP+ G + GYMYWF+WA+T+A+E+SV+GQ+++Y
Sbjct: 157 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEY 216

Query: 173 WTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV 232
           WT  VP+  WI+IFWV++T +N FPVK YGE EFWVA+VKV+AI+G+LIY L +VCG   
Sbjct: 217 WTTKVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSK 276

Query: 233 TGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAG 292
            GP+GFRYWRNPG WG G+      IS +KN GRFLGW +SLINAAFTYQGTELVGITAG
Sbjct: 277 QGPIGFRYWRNPGAWGPGI------ISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 330

Query: 293 EAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIEN 352
           EAANPRKTVPRAI KVVFRI+LFYI SLFFIGLLVP+ DP+L          PF+I+I+N
Sbjct: 331 EAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQN 390

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
           +GT  LPDIFNAI+LIT+ISA NSN+YVGSR+L+SLA+TG APK     TK+GVP++ VL
Sbjct: 391 AGTYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVL 450

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
           +TA  G+LA++       T F+WL+NI+ +AG  AWLFI +SHIRFMQ L  RGISRDDL
Sbjct: 451 STAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDL 510

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWF 532
           PFKA  MP  AYYA F + +II  QGF +F P F V+DFF +YIS+IL  +++   QL++
Sbjct: 511 PFKAKFMPYGAYYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYY 569

Query: 533 KCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           KCR+IWKLED+DIDS+RR++E IIWED EPK  W+KFW  VA
Sbjct: 570 KCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/514 (63%), Positives = 402/514 (78%), Gaps = 7/514 (1%)

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            VKR LKQRH                  STPL ++GPVGSLIAYIF+GT+ Y +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
           MATFIPVTSS TVF+ RFLSP+ G + GYMYWF+WA+T+A+E+SV+GQ++ YWT  VP+A
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY 240
           AWI+IFWV++T +N FPVK YGE EFWVA+VKV+AIVG+LIY L +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           WRNPG WG G+      ISKNK+ GRFLGW +SLINAAFTYQGTELVGITAGEAANPRKT
Sbjct: 285 WRNPGAWGPGI------ISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPD 360
           VPRAI KVVFRI++FYI SLFFIGLLVP+++P+L          PF+I+I+N+GT  LPD
Sbjct: 339 VPRAINKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPD 398

Query: 361 IFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVL 420
           IFNA++LIT+ISA NSN+YVGSR+L+SLA++G APK     TK+GVP++ VL+TA  G+L
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 421 AYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMP 480
           A++       T F+WL++I+ +AG  AWLFI ++HIRFMQ LK RGISRDDLPFKA LMP
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 481 GLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL 540
             AYYA F + III  QGF AF P F VS+FF +YIS+IL  +++ + QL++KCR+IWKL
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKL 577

Query: 541 EDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           ED+DIDS+RR++E IIWED EPK  W+KFW  VA
Sbjct: 578 EDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/573 (57%), Positives = 419/573 (73%), Gaps = 13/573 (2%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNS---GSVHDAE 61
           +S +   P QRK         S   D    N+    ++S+   D ++ ++   G V D  
Sbjct: 37  DSDTDMEPSQRKKAAMAGKLFS---DQLSYNVSVADNSSAANGDLDLSDTEEAGHVQDTR 93

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           VKR LKQRH                  STPL ++GPVG+LIAYIF+G++ Y +TQSLGEM
Sbjct: 94  VKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEM 153

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
           ATFIPVTSS TVF+ RFLSP+ G   GYMYWF+WA+T+A+E+SVVGQ++ YWT AVP+AA
Sbjct: 154 ATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAVPLAA 213

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYW 241
           WI+IFWV +T LN FPVK YGE+EFWVA++KV+AI+G+LIY L +VCG    GP+GFRYW
Sbjct: 214 WIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQGPIGFRYW 273

Query: 242 RNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTV 301
           RNPGPWG G+      ISK+ N GRFLGW +SLINAAFTYQGTELVGITAGEAANPRK+V
Sbjct: 274 RNPGPWGPGI------ISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 327

Query: 302 PRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDI 361
           PRAI KVVFRI LFYI SLFFIGLLVP++D  L          PF+I+I+N+GT  LPDI
Sbjct: 328 PRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYALPDI 387

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
           FNA++++TIISA NSN+YVGSR+L++LA+TG APK  +  TK GVPW+ V+ TA  G+LA
Sbjct: 388 FNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLA 447

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           ++       T F+WL+NI+ +AG  AW FI +SHIRFMQ LK+RGISRDDLPFKA LMP 
Sbjct: 448 FLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPW 507

Query: 482 LAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLE 541
            AYY+ F + +II  QGF AFTP +D + FF +YIS+IL  +++   QL+++CR++ K+E
Sbjct: 508 GAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVE 566

Query: 542 DVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           D+DID++RR++E IIWED EPK  W+KFW  VA
Sbjct: 567 DIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/555 (58%), Positives = 416/555 (74%), Gaps = 10/555 (1%)

Query: 20  QTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXX 79
           ++ S+  +++D     +  + D   + + E+    G V   EVKR LK RH         
Sbjct: 36  RSISSPPKENDGYGYRVDNEYDVDDSVDGEK----GEVRSTEVKRALKPRHIGMIALGGT 91

Query: 80  XXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFL 139
                    S PL+++GPVG LIAY+F+ T+ ++V QSLGEMAT+IPVTS+F+VF+ RFL
Sbjct: 92  IGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFL 151

Query: 140 SPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVK 199
           SP+ GAA GYMYWFSW++TFALELSV+GQIV YWTF VP+AAWISIFWV++  LN  PVK
Sbjct: 152 SPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVK 211

Query: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEIS 259
           FYGE EFW+A +KVVAIVGF+IYC  MVCGAG TGPVGFRYWR+   +GDG+      IS
Sbjct: 212 FYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVGFRYWRHGYAFGDGI------IS 265

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
           KNKN  RFLGW +SLINAAFTYQGTELVGITAGEAANPRKTVP++IK+ ++RIL+FYI S
Sbjct: 266 KNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFS 325

Query: 320 LFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379
           L F+GLLVPF+D  L          PFI+AI+NSGTK LPDIFNA+IL T+ISA NS++Y
Sbjct: 326 LLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVY 385

Query: 380 VGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNI 439
           VGSR+++S+A+  LAP IL++ +K GVP+ +VL T+  G LAY+ET+  G  VF+WL+NI
Sbjct: 386 VGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNI 445

Query: 440 TAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGF 499
           T +AGF++W  I  SH+RFM+ LK RGISR+DLPFKA+ MP +A Y+ F M +II+ QGF
Sbjct: 446 TGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGF 505

Query: 500 TAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWED 559
           T FTP F  SDF A+YISV LFF+IW  FQ+WF+C  +  + ++DID++RRDV+  +WED
Sbjct: 506 TCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAEVWED 565

Query: 560 PEPKTFWDKFWNVVA 574
             PKT WDKFWN+VA
Sbjct: 566 EPPKTLWDKFWNIVA 580

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/550 (58%), Positives = 410/550 (74%), Gaps = 7/550 (1%)

Query: 26  SQDDDMKKIN-IIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXX 84
           S+ D    +N        +  + DE         D +VKR LK RH              
Sbjct: 65  SKSDIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGL 124

Query: 85  XXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIG 144
               S PL+ SGPVGSLIAYIF+GT+ Y VTQ+LGEMATFIPVTSS TVF+SRFLSP+ G
Sbjct: 125 FIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFG 184

Query: 145 AAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEI 204
            + GY+YWF+WA+T+A+E+SVVGQ++++WT  VP+AAWISIFWV++TALN FPV  YGEI
Sbjct: 185 VSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEI 244

Query: 205 EFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNT 264
           EFWVA+VKV+AIVG+LIY L +VCG    GP+GFRYWR+    G G+      ISK+KN 
Sbjct: 245 EFWVASVKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRHGYAMGGGM------ISKDKNE 298

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
            RFLGW  SLINAAFTYQGTELVGITAGEAANPRK+VPRAI KVVFRI++FYI SLFFIG
Sbjct: 299 ARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIG 358

Query: 325 LLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           LLVP++DPKL          PF+I+IEN+GT+ LP IFNAII+ITIISA NSN+YV SR+
Sbjct: 359 LLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRV 418

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L+SLA +G APKI +R T +GVP++ V+ TA+ G+LA++         F+WL+NI+ +AG
Sbjct: 419 LYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAG 478

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
             AWLFI +SH+RFM+ LK+RGISRDDLPFKA  MP  +YYA F + +II  QGFTAF+P
Sbjct: 479 LCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSP 538

Query: 505 TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKT 564
            FDV+ FF AYIS+IL  +++   QL+++CR+ WK+ED+DID++RR++++I+WED EPKT
Sbjct: 539 KFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKT 598

Query: 565 FWDKFWNVVA 574
            WDKFW  VA
Sbjct: 599 AWDKFWAAVA 608

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/547 (58%), Positives = 421/547 (76%), Gaps = 7/547 (1%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
           D   +++ +   T+     E+E+   +G  HD  VKR LKQRH                 
Sbjct: 34  DPVTQQVTLRTVTNVCDGLEEEDAEEAG-YHDTRVKRALKQRHIGMIALGGTIGTGLFVG 92

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
            +TPL ++GPVGSLIAY+F+G++ Y +TQSLGEMATFIPVTSS TVF+ RFLSP+ G A 
Sbjct: 93  IATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVAN 152

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFW 207
           GYMYWF+WA+T+A+E+SV+GQ++ +WT AVP+AAWI+IFWV ++ LN FPVK YGEIEFW
Sbjct: 153 GYMYWFNWAITYAVEISVIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFW 212

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRF 267
           VA++KV+AIVG+LIY L +VCG    GP+GFRYWRNPGPWG G+      IS +KN GRF
Sbjct: 213 VASIKVIAIVGYLIYALVIVCGGSSQGPIGFRYWRNPGPWGPGI------ISDDKNEGRF 266

Query: 268 LGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLV 327
           LGW +SLINAAFTYQGTELVGITAGEAANPRK+VPRAI KVVFRI++FYI SLFF+G+LV
Sbjct: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLV 326

Query: 328 PFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFS 387
           PF+DP+L          PF+I+I+N+GT++LP IFNA++++TIISA NSN+YVGSR+L++
Sbjct: 327 PFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYA 386

Query: 388 LAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWA 447
           L++TG APK     T+ GVP++ V+AT++ G+LA++       T F+WL+NI+ +AG  A
Sbjct: 387 LSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCA 446

Query: 448 WLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFD 507
           WLFI +SHIRFMQ LKFRGISRDDLPFKA LMP  AYYA F + +II  QGF AF+P FD
Sbjct: 447 WLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFD 506

Query: 508 VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWD 567
           VS FF AYIS+I+  ++    QL+++CR++WKLED+DID++RR++E IIWE+ EP+  W+
Sbjct: 507 VSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWE 566

Query: 568 KFWNVVA 574
           KFW+++A
Sbjct: 567 KFWSIMA 573

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/485 (66%), Positives = 394/485 (81%), Gaps = 7/485 (1%)

Query: 91  PLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYM 150
           PL  +GPVG+LI+YIF+GT+ Y+VTQSLGEMATFIPVTSSF+VFA RFLSP++GA  GYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 151 YWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAA 210
           YW SW  TFALELSV+GQI+ YWT AVP++AWI IFW +LT +NMFPVK+YGE EF +A+
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 211 VKVVAIVGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLG 269
           +KV+A++GF+IY  CMVCGAG   GP+GFRYWRNPG WG G+      IS +KN GRFLG
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGI------ISSDKNEGRFLG 192

Query: 270 WFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPF 329
           W +SLINAAFTYQGTELVGITAGEAANPRK VPRAIKKVV RIL+FYI SLFFIGLLVP+
Sbjct: 193 WVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPY 252

Query: 330 DDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLA 389
           +DPKL          PF+I+IENSGTK+LPDIFNA++LITI+SAGNSN+Y+GSR+L+SL+
Sbjct: 253 NDPKLDSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLS 312

Query: 390 KTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWL 449
           K  LAP+ LS  TK GVP+ +VLAT+VFG LA++ET+ G    F+WL+NIT +AGF+AWL
Sbjct: 313 KNDLAPRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWL 372

Query: 450 FILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVS 509
            I  SHIRFMQ +  RGISR+DLP+KA +MP LAYYA F + +I++ QGFTAF P+F   
Sbjct: 373 LISFSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPV 432

Query: 510 DFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKF 569
           DF AAYISV LF  IW +FQLWFKC  I KL+DVDIDS+RR++E+ +W +P  KT W   
Sbjct: 433 DFVAAYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCV 492

Query: 570 WNVVA 574
           W+V+A
Sbjct: 493 WDVLA 497

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/549 (57%), Positives = 406/549 (73%), Gaps = 6/549 (1%)

Query: 26  SQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXX 85
           +  DD +     Q   ++     +     G + + +VKR LK RH               
Sbjct: 79  AHSDDFEMYVYSQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLF 138

Query: 86  XXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGA 145
              ++PL  SGPVG+LIAYIF+GT+ Y VTQS+GEMATFIPVTSS TVF+SRFLSP+ G 
Sbjct: 139 VGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGV 198

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
           A GYMYWF+WA+TFA+ELSV GQ+++YWT AVP AAWI+IFWV++T  N FPV+FYGE+E
Sbjct: 199 ANGYMYWFNWAITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVE 258

Query: 206 FWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTG 265
           FWVA++KV+AIVG+LIY L +VCG    GP+GFRYWRNPGPWG G+      ISK+K+ G
Sbjct: 259 FWVASIKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRNPGPWGAGI------ISKDKDEG 312

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           RFLGW  SLINA+FTYQGTELVGITAGEAANPR+TVPRAI KV FRIL FYI SLFF+GL
Sbjct: 313 RFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGL 372

Query: 326 LVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRIL 385
           LVP++   L          PF+I+I+N+GT+ LPDIFNA++L+TIISA NSN+YVGSR+L
Sbjct: 373 LVPYNHSSLDKTTTVIASSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVL 432

Query: 386 FSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
           FSLA TG+APK+ S  T +GVP++ V+ T++ G+LA++         F+WL+NI+ +AG 
Sbjct: 433 FSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGL 492

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT 505
            AWLFI ISHIRFMQ LK RGISRDDLPFK+ LMP  AYYA F + +II  QGF AF+P 
Sbjct: 493 CAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPH 552

Query: 506 FDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTF 565
           F V++FF +YIS++L  +++   QL+++CR+  +LED+DIDS+RR+ + +IWED EP T 
Sbjct: 553 FKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTL 612

Query: 566 WDKFWNVVA 574
           W KFW  VA
Sbjct: 613 WGKFWTAVA 621

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/567 (55%), Positives = 414/567 (73%), Gaps = 13/567 (2%)

Query: 9   QSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQ 68
           +++ R+R      +S  ++ ++  +I +   T  S     EE    G  H+ EVKR LK 
Sbjct: 13  ETLTRER------YSKKAKGNNGSEIALESITPDSGDEFPEEHEQEGDYHETEVKRALKA 66

Query: 69  RHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVT 128
           RH                  ++PL  +GPVGSLIAYIF+GT+ Y++TQSLGEMATFIPVT
Sbjct: 67  RHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVT 126

Query: 129 SSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWV 188
           SS TVF+ RFLSP+ G A GYMYWF+WA+TFA+ELSVVGQI++YWT  VP+ AWI+IFW+
Sbjct: 127 SSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWI 186

Query: 189 ILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWG 248
           I+T LN FPV+FYGEIEFW+A+VKV+ IVG+LIY   +VCG    GP+GFR WRNPGPWG
Sbjct: 187 IVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQGPIGFRNWRNPGPWG 246

Query: 249 DGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKV 308
            G+      IS N+   RFLGW +SLI AAFTYQGTELVGITAGE+ NPRKTVP+AI KV
Sbjct: 247 TGV------ISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV 300

Query: 309 VFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIIL 367
            FRIL FYI SLFF+GLLVP++DP++           PF+I+I N+GTKILPDIFNA++L
Sbjct: 301 FFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIFNAVVL 360

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
           +T++SA NSN+Y+GSR+++SLA++G APK      + GVP + V+ TA+ G++A++    
Sbjct: 361 VTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNN 420

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
             +  F+WLVNI+ +AG  AWLFI ++HIRFMQ LK RGISRD LPFKA  MP  AYYA 
Sbjct: 421 NAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAA 480

Query: 488 FCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDS 547
             + +II  QG+TAF+P FDV+ FF AYIS++L  +++   Q+++KCR++WKLED+DID+
Sbjct: 481 SFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDT 540

Query: 548 NRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           NRR+++ I+WED EPK  WDKFW+ +A
Sbjct: 541 NRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/532 (60%), Positives = 406/532 (76%), Gaps = 14/532 (2%)

Query: 39  QTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPV 98
           ++D S   E E       VH+ +VKR LKQRH                  STPL  +GPV
Sbjct: 76  ESDGSDELEAE-------VHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPV 128

Query: 99  GSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158
           GSLIAYIF+GT+ Y VTQSLGEMATFIPVTSS TVF+ RFLSP+ G A GYMYWF+WA+T
Sbjct: 129 GSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 188

Query: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218
           +A+E+SV+GQ++ YWT AVP+AAWI+IFWV++T +N FPVK YGE+EFW+A VKV+AIVG
Sbjct: 189 YAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVG 248

Query: 219 FLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAA 278
           +LIY L +VCG    GP+GFRYWR+PG +G G+      ISKNKNTG+FLGW  SLINAA
Sbjct: 249 YLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGI------ISKNKNTGKFLGWVASLINAA 302

Query: 279 FTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX 338
           FTYQGTELVGITAGEAANPRKTVPRAI KVVFRI+LFYI SLFFIG+L+P++D +L    
Sbjct: 303 FTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQD 362

Query: 339 XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKIL 398
                 PF+I+I+N+ TK+LPDIFNA++++T++SA NSN+YVGSR+L++LA TG APK  
Sbjct: 363 AVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQF 422

Query: 399 SRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRF 458
           S  T+ GVP++ V+ TA  G+LA++       T F+WL+NI+ +AG  AWLFI ++HIRF
Sbjct: 423 SYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRF 482

Query: 459 MQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISV 518
           MQ LKFRGISRDDLPFKA LMP  AYYA F + +II  QG+ AF P +DVS FF +YIS+
Sbjct: 483 MQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISL 541

Query: 519 ILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFW 570
           IL  ++    QL+++ R++ KLED+DID++RR++E I+WED EPKT WDKFW
Sbjct: 542 ILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFW 593

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 420/558 (75%), Gaps = 8/558 (1%)

Query: 17  SGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXX 76
           SG  +  + + +D ++  ++   ++     E EE    G  H+ EVKR LK RH      
Sbjct: 30  SGTLSKRSKAGEDSIELSDVQVSSELYDHAESEE--GEGDFHETEVKRALKPRHVSMIAL 87

Query: 77  XXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFAS 136
                       + PL  SGPVGSLIAYIF+G++ Y VTQSLGEMATFIPVTSS TVF+ 
Sbjct: 88  GGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSK 147

Query: 137 RFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMF 196
           RFLSP+ G A GYMYWF+WA+T+A+ELSV+GQI++YWT AVP+AAWI+IFWV+LTA N F
Sbjct: 148 RFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFF 207

Query: 197 PVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGV 256
           PVK+YGE EF VA++KV+AIVG+L+Y L +VCG    GP+GFRYWRNPGPWG G      
Sbjct: 208 PVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTG------ 261

Query: 257 EISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFY 316
            I+KN N  RFLGW  SL+NA+FTYQGTELVGITAGEA+NPRKTVP+AI KV FRIL+FY
Sbjct: 262 TIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFY 321

Query: 317 IGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNS 376
           IGSLFF+GLLVP++ P+L          PF+I+I+N+GTK+LPDIFNA++L+TI+SAGNS
Sbjct: 322 IGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNS 381

Query: 377 NIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWL 436
           N+YVGSR+L+SLA +G APK  S  TK+GVP++ V+ TA+ G+LA++ T +   T F+WL
Sbjct: 382 NVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWL 441

Query: 437 VNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIF 496
           +NI+ +AG  AW FI ++HIRFMQ LK RGISRD LPFKA LMP  AYYA F + +I+  
Sbjct: 442 INISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFI 501

Query: 497 QGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKII 556
           QGFTAF P FDVS+FF AYIS+IL  +++   QL+++CR++ K+ED+DIDS+RR+++ II
Sbjct: 502 QGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAII 561

Query: 557 WEDPEPKTFWDKFWNVVA 574
           WED EPK  W+KFW  +A
Sbjct: 562 WEDDEPKNLWEKFWVALA 579

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/535 (59%), Positives = 405/535 (75%), Gaps = 10/535 (1%)

Query: 40  TDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVG 99
           +  +S+ ED+E    G + + +VKR LK RH                  ++PL  +GPVG
Sbjct: 36  SGHNSSFEDDE----GDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVG 91

Query: 100 SLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTF 159
           +LIAYIF+G++ Y VTQS+GEMATFIPVTSS TVF++RFLSP+ G A GYMYWF+WA+T+
Sbjct: 92  ALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITY 151

Query: 160 ALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGF 219
           A+E+SV+GQ++ YWT AVP+AAWI IFWV +T  N FPV+FYGE+EFWVA++KV+AIVG+
Sbjct: 152 AVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGY 211

Query: 220 LIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAF 279
           L+Y L +VCG    GP+GFRYWRNPGPWGDG+      IS +K+ GRFLGW  SLINA+F
Sbjct: 212 LLYALIIVCGGSKQGPIGFRYWRNPGPWGDGI------ISGDKDKGRFLGWVASLINASF 265

Query: 280 TYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXX 339
           TYQGTELVGITAGEAANPRKTVP+AI KV FRIL FYI SLFF+GLLVP++ P L     
Sbjct: 266 TYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTS 325

Query: 340 XXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILS 399
                PF+I+I+++GT+ILPDIFNA++L+TIISA NSN+YVGSRILFSLA TG+APK  S
Sbjct: 326 VIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFS 385

Query: 400 RTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFM 459
             T +GVP++ V+ TA+ G+LA++         F+WL+NI+ +AG  AWLFI ISHIRFM
Sbjct: 386 YVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFM 445

Query: 460 QVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVI 519
           Q LK RGISRDDLPFK+ LMP  AYYA F + +II  QGF AF P F V++FF  YIS+I
Sbjct: 446 QCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLI 505

Query: 520 LFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
           L  +++   QL+++CR+  +LED+DIDS+RR+++ +IWE+ EP T W KFW  VA
Sbjct: 506 LLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/543 (60%), Positives = 410/543 (75%), Gaps = 10/543 (1%)

Query: 32  KKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTP 91
           + + I   +  ++  E  E    G   + EVKR LK RH                  ++P
Sbjct: 30  ETLPIYSHSGDNAPCEKGE----GDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASP 85

Query: 92  LEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMY 151
           L +SGPVG+LIAYIF+G++ Y VTQSLGEMATFIPVTSS TVF+ RFLSP+ G A GYMY
Sbjct: 86  LSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMY 145

Query: 152 WFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAV 211
           WF+WA+T+A+E++VVGQ++ YWT AVP+AAWI+IFWV++T  N FPVKFYGE+EFWVA+V
Sbjct: 146 WFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASV 205

Query: 212 KVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWF 271
           KV+AIVG+LIY L +VCG    GP+GFRYWRNPGPWG G+      ISK+ N GRFLGW 
Sbjct: 206 KVIAIVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGI------ISKDVNEGRFLGWV 259

Query: 272 NSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDD 331
           +SLINAAFTYQGTELVGITAGEAANPRKTVPRAI KV FRIL FYI SLFFIGLLVP+DD
Sbjct: 260 SSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDD 319

Query: 332 PKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKT 391
            +L          PF+I+I+N+GTK+LP IFNAI++ITIISA NSN+YVGSR+L+SLA +
Sbjct: 320 LRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALS 379

Query: 392 GLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFI 451
           G APK     TK+GVP++ V+ TA+ G+LA++         F+WLVNI+ +AG  AWLFI
Sbjct: 380 GNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFI 439

Query: 452 LISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDF 511
            +SH+RFMQ LK RGISR+DLPFKA LMP  AYYA F + +III QGF AFTP F VSDF
Sbjct: 440 SLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDF 499

Query: 512 FAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWN 571
           F +YIS+IL  +++   QL+++CR+IW L+D+DIDS+RR+++ I+WED EPK  W+KFW 
Sbjct: 500 FTSYISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWEKFWV 559

Query: 572 VVA 574
            VA
Sbjct: 560 AVA 562

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/573 (55%), Positives = 412/573 (71%), Gaps = 14/573 (2%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60
           ++T  +  Q   R  +S   +     + +   +   I Q + S   E E +  +    D 
Sbjct: 7   LETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMS---EVESLYGN---DDP 60

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           +VKR+LK RH                  ++P+  +GPVGSL+AY+F+GT+ + VTQSLGE
Sbjct: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120

Query: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
           MATFIPVTSSFT++  RFLSP++GAA GY+YWFSW VTFALELS++GQ++ YWTFAVP++
Sbjct: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY 240
            WI +FW++LTA NM PV+FYGEIEFW+AA+KV++I GFLIY L MVCG    G +GFRY
Sbjct: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           W+NPGPWG G+      IS NK   RFLGW +SLI AAFTYQGTELVGITAGE+ NPRKT
Sbjct: 241 WKNPGPWGMGM------ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILP 359
           VP+AI KV FRIL FYI SLFF+GLLVP+ DP+L           PF++AI+NSGTK+LP
Sbjct: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419
            +FN +IL+TI+SAGNSNIY+GSR+L+ L+K+GLAP +  +T K+GVP+ +VL +++FG 
Sbjct: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414

Query: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479
           LAY+  +Q  + VFDWL+ ITA+AGF+AWL I +SHIRFMQVLK RGISR+DLPFKA  M
Sbjct: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474

Query: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539
           P  AYYA F + +II+ QGF +F P F  S+F A YISV LF + W  FQ+ FK R I +
Sbjct: 475 PWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILR 534

Query: 540 LEDVDIDSNRRDVEKIIW-EDPEPKTFWDKFWN 571
            EDVDID++RR+++ ++W +D EPKT   K W 
Sbjct: 535 KEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/576 (54%), Positives = 402/576 (69%), Gaps = 20/576 (3%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61
           DT  S + +  R  K G     T+  D ++      Q    ++    E+    G   + E
Sbjct: 5   DTAVSETSTRSRYIKKG----KTLENDIEL------QSVTPATGEFPEDHTEEGDYQETE 54

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           VKR LK RH                  ++PL  +GPVGSL+AYIF+GT+ Y++TQSLGEM
Sbjct: 55  VKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEM 114

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
           ATFIPVTSS TVF+ RFLSP+ G A GYMYWF+WA+TFA+ELSVVGQI+ YWT  VPIAA
Sbjct: 115 ATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAA 174

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYW 241
           WI IFWV++T +N FPV+FYGEIEFW+A+VKV+ IVG+LIY   +VCG    GP+G    
Sbjct: 175 WIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGL--- 231

Query: 242 RNPGPWGDGLTSNGVEISKNKNTGR--FLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
               P   G+ + G   S      R  FLGW +SLI AAFTYQGTELVGITAGE+ NPRK
Sbjct: 232 ----PATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRK 287

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKIL 358
            VP+AI KV FRIL FYIGSL F+GLLVP+DDP+L           PF+I+I+N+GTKIL
Sbjct: 288 NVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKIL 347

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           PDIFNA++LIT+ISA NSN+Y+GSR+ +SLA  G APK L+  TK+GVP+  VL T++ G
Sbjct: 348 PDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMG 407

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
           +++++       T FDWLVNI+ +AG  AWLFI ++HIRFMQ LK RGISRDDLPFKA  
Sbjct: 408 LMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKF 467

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIW 538
           MP  AYYA F + +II  QG+TAFTP FDV+ FF +YIS+ L  L++   Q+++KCR++W
Sbjct: 468 MPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLW 527

Query: 539 KLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
            +ED+DIDS+RR+++ I+WE+ EPK  WDKFW+ VA
Sbjct: 528 AVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/528 (57%), Positives = 384/528 (72%), Gaps = 8/528 (1%)

Query: 48  DEEMLNS-GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           DE  L + G  HD +VKR LK RH                  S PL  SGPVGSLIAYIF
Sbjct: 87  DESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIF 146

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           +G++ Y VTQSLGEMATFIPVTSS TVF  RFLSP++G + GYMYWF+WA+TFA ELSV 
Sbjct: 147 MGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVT 206

Query: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226
           GQI+ YWT+ VP+AAWI IFWVI+  LN FPVK YGEIEFWV++VKV+AIVG+LIY L +
Sbjct: 207 GQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVI 266

Query: 227 VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTEL 286
           VCG    GP+GFRYWR+   +GDG       ISKNK+  RFLGW +SLINAAFTYQGTEL
Sbjct: 267 VCGGSRQGPIGFRYWRHGYAFGDGY------ISKNKDEARFLGWVSSLINAAFTYQGTEL 320

Query: 287 VGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPF 346
           VGI+AGEAANPRKTVPRAI KV+FRI LFYI SLFFIGLLVP++D +L          PF
Sbjct: 321 VGISAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPF 380

Query: 347 IIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGV 406
           +I++ N+GT  LPDIFNA+ILIT++SA NS++Y+ SR+L++LA  G APK  +   + GV
Sbjct: 381 VISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGV 440

Query: 407 PWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRG 466
           P++ V  T + G LA++  +    T F+WL+NI+ +AG  AW FI  +HIRFMQ LK +G
Sbjct: 441 PYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKG 500

Query: 467 ISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWG 526
           ISRDDLPFKA  MP  AYYA F + +II  QG+ AFTP +D   FF +YIS+ILF +++ 
Sbjct: 501 ISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYL 559

Query: 527 AFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574
              ++++ R + K+ED+DID++R++VE  +WE+  P+ +W+KFW  VA
Sbjct: 560 GCLIYYRGRLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/550 (55%), Positives = 403/550 (73%), Gaps = 15/550 (2%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXX 82
           ST++      K  ++      +T+E E +      + ++VKRELK RH            
Sbjct: 16  STITAKPGAIKAEVLNH----NTSEVESLCEKP--NQSDVKRELKPRHVTMISLGGTIGT 69

Query: 83  XXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPS 142
                 ++P+ ++GPVGSL+AYIFV T+ Y VTQSLGEMATFIPVTSSFTVFASRF+SP+
Sbjct: 70  GLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPA 129

Query: 143 IGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYG 202
           +GAA GY+YW SW +TFALE+SV+G+++ YW+ AVPI AW++IFWV+LTA+N+ PVKFYG
Sbjct: 130 LGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYG 189

Query: 203 EIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNK 262
           E EFW+A++KV+AI+ FL Y L +VCG    G +GFRYW++PGPWG G+      +S+  
Sbjct: 190 EFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGI------VSQEI 243

Query: 263 NTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFF 322
           +T +FLGW +SLI AAFT+QGTELVG+TAGE  NPR+TVP+AI  V FRILLFYIGSL  
Sbjct: 244 HTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLV 303

Query: 323 IGLLVPFDDPKLXX--XXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYV 380
           IGLLV +DDP+L            PF++AI  +GTK+LPDI N +I++TIISAGNSNIYV
Sbjct: 304 IGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363

Query: 381 GSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNIT 440
           GSR+L+ L ++GLAP  +SRTT +GVP+V+VLAT++FG L Y+  +    +VFDWL++IT
Sbjct: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423

Query: 441 AIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFT 500
           A++GF+ WL I +SHIRFMQ LK RGISRDDLPFKA  MP  AYYA F +++II+ QGFT
Sbjct: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483

Query: 501 AFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDP 560
           AFTP F   DF A YIS  +F +IW  FQ  FK RW   ++++DID++RRD++ IIW+D 
Sbjct: 484 AFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWDDD 542

Query: 561 EPKTFWDKFW 570
           +P T W K W
Sbjct: 543 KPTTLWGKIW 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  340 bits (872), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/552 (33%), Positives = 306/552 (55%), Gaps = 26/552 (4%)

Query: 23  STMSQDD--DMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXX 80
           S + ++D  D++K N     ++    +D   ++ G      +K+ELK RH          
Sbjct: 10  SKLIREDIIDLEK-NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSL 68

Query: 81  XXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLS 140
                    T L   GP   LIAY FVG L + V   LGEMAT+IP+   FT +A+R+  
Sbjct: 69  GTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCD 127

Query: 141 PSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TFAVPIAAWISIFWVILTALNMFPV 198
           P++G AVGY Y F + +    +L+    ++ YW     V    WI+IF V++  +N   V
Sbjct: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187

Query: 199 KFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG---PWGDGLTSN 254
           +++GE EFW+++ K++ + G +++   ++ G G     +GFRYW+NPG   P+ + +T +
Sbjct: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247

Query: 255 GVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILL 314
                     G+F+ +    + A F Y G EL GI A EA NPR+ +PRAIK  ++RI+L
Sbjct: 248 ---------KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIIL 298

Query: 315 FYIGSLFFIGLLVPFDDPKLXXXXXXXXXX---PFIIAIENSGTKILPDIFNAIILITII 371
           FYI ++F +G+ V ++DP+L             PF++AI+NSG + LP IFN  +LI + 
Sbjct: 299 FYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVF 358

Query: 372 SAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQT 431
           SA NS++YVG+R L+SLA  G APK+ ++T + GVP+ ++    +F +LAYM  + G   
Sbjct: 359 SACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQ 418

Query: 432 VFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMV 491
           +F++ VN+ +I G  +W+ ILI++I F +    + + R+   ++A   P  AY  +F  V
Sbjct: 419 IFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCV 478

Query: 492 IIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRD 551
           +I   + FT F   FD   F   YI + L+ + +  +++ +K + + K E+ D+ S +  
Sbjct: 479 LIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEA 537

Query: 552 VEKIIWEDPEPK 563
           +++   E+ E K
Sbjct: 538 IDR---EEAEGK 546

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/517 (35%), Positives = 295/517 (57%), Gaps = 15/517 (2%)

Query: 54  SGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYA 113
            G      +K++LK RH                   T L  +GP   LIAY FVGTL + 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 114 VTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173
              +LGEMA +IP+   FT +ASR+  P++G AVGY Y F + +    +L+    ++ YW
Sbjct: 134 TMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 174 TF--AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG 231
                V    WI+IF V++ A+N   VK++GE EFW+++ K++ ++G +I+   ++ G G
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 232 VTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGIT 290
                +GFRYW+ PG +    +S+ V I  +  TG+F+ + N  + A F Y G EL GI 
Sbjct: 253 PNHDRLGFRYWKTPGAF-KPYSSSVVNIEGS--TGKFVAFVNVFVYALFAYLGIELTGIV 309

Query: 291 AGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXX---XPFI 347
           A EA NPR+ +PRAIK  V+RIL FY+ ++F +G+ V +DDP L             PF+
Sbjct: 310 AAEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFV 369

Query: 348 IAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVP 407
           +AI+NSG  +LP IFN  +L+ + SA NS++YVG+R L+SLA  G APKI ++T + GVP
Sbjct: 370 VAIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVP 429

Query: 408 WVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGI 467
           + ++    +F +LAYM  + G   +F++ VN+ +I G  +W  ILI+ I F + ++ +GI
Sbjct: 430 YNAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGI 489

Query: 468 SRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT-FDVSDFFAAYISVILFFLIWG 526
            R    + A   P  +Y+A+F  V++ + + F+ F    FD   F   YI + ++   + 
Sbjct: 490 DRSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFI 549

Query: 527 AFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPK 563
            ++L++K + + K  + D++S +  V++   E+ E K
Sbjct: 550 GYKLYYKTKTV-KPHEADLNSYKAAVDR---EEEEGK 582

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/534 (34%), Positives = 302/534 (56%), Gaps = 18/534 (3%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           +DM  ++ +      S  +D+ M + G      ++++LK RH                  
Sbjct: 54  NDMDNLSTVSSRLEDSEKQDDYM-DDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGT 112

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
              L  +GP+   IAY FVG L +    +LGEMA++IP+   FT +ASR+  P++G AVG
Sbjct: 113 GNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVG 171

Query: 149 YMYWFSWAVTFALELSVVGQIVDYW--TFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
           Y Y   + +    +L+    ++ YW     V    WI+IF VI+ A+N   VKF+GE EF
Sbjct: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231

Query: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTG 265
           W++  KV+ ++G +I    ++ G G T   +GFR++ +PG +     S  ++ SK    G
Sbjct: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKP--YSKSIDGSK----G 285

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           +F+ +   L+ A F Y G EL GI A EAANPRK++P+AIK  ++RI++FY+ ++F +G+
Sbjct: 286 KFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345

Query: 326 LVPFDDP---KLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382
            V +DDP   K           P+++AI NSG K LP IFNA +L+ + SA NS++YV S
Sbjct: 346 CVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405

Query: 383 RILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAI 442
           R L+ LA    APKI + T + GVP+ S+L ++ F +LAYM  + G   +F++ VN+ +I
Sbjct: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465

Query: 443 AGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV-FCMVIIIIFQGFTA 501
            G  +W+ ILI+++ F + +K + + R    ++A   P  +Y+ + FC++I  I + FT 
Sbjct: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI-KNFTV 524

Query: 502 F-TPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEK 554
           F    FD  +F   YI + +F + +  ++   K + IWK E+VD+ + +  +++
Sbjct: 525 FLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDE 577

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/556 (34%), Positives = 312/556 (56%), Gaps = 29/556 (5%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA-EVKRELKQRHXXXXXXXXXXX 81
           ++ +   D++ +++  Q D SS    E  LN    HD   +K+EL+ RH           
Sbjct: 18  NSNTTSKDVENLDLSNQDDISS---QESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLG 74

Query: 82  XXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSP 141
                   T L  +GPV  LIAY FVG L Y V   LGEMAT+IP+   FT +ASR+  P
Sbjct: 75  TGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDP 133

Query: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF--AVPIAAWISIFWVILTALNMFPVK 199
           ++G AVGY Y F + +    +L+    ++ YW     V    WI+IF VI+  +N+  VK
Sbjct: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVK 193

Query: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG---PWGDGLTSNG 255
           F+GE EFW+++ KV+ ++  ++    ++ G G +   +GFR++++PG   P+ + ++ + 
Sbjct: 194 FFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS- 252

Query: 256 VEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLF 315
                    G+F+ +    + A F Y GTEL GI A E  NPR+ VPRAIK  ++RI++F
Sbjct: 253 --------KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304

Query: 316 YIGSLFFIGLLVPFDDPKLXXX---XXXXXXXPFIIAIENSGTKILPDIFNAIILITIIS 372
           Y+ ++F +G+ V ++DP L             PF++AI+N+G  +LP IFNA +L+ + S
Sbjct: 305 YLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFS 364

Query: 373 AGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTV 432
           A NS++YV SR L+ LA    APKI ++T K GVP+ S++   +F +LAYM  + G   V
Sbjct: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424

Query: 433 FDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVI 492
           F++ VN+ +I G  +W+ ILI++I F + L+ +G+ +  L + A L    AY+A+F   +
Sbjct: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484

Query: 493 IIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRD 551
           I + + FT F    FD  +F   YI + +F + +  ++     +++ K E+ D+ + +  
Sbjct: 485 IALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFK-- 541

Query: 552 VEKIIWEDPEPKTFWD 567
            E I  E+ E K  WD
Sbjct: 542 -ELIDLEEEEGK-LWD 555

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  327 bits (837), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/561 (34%), Positives = 309/561 (55%), Gaps = 29/561 (5%)

Query: 19  VQTFSTMSQDDDMKK--------INIIQQTDASSTTEDEEM-------LNSGSVHDAEVK 63
           ++ FST+S   D  K        +NI  Q+D SS +  +         +  G      +K
Sbjct: 7   IRFFSTISPKGDNAKEVTASKLALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLK 66

Query: 64  RELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMAT 123
           ++LK RH                     L+ +GPV +LIAY FVG + +     LGEMAT
Sbjct: 67  KQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMAT 126

Query: 124 FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT--FAVPIAA 181
           FIP+   FT +ASR+  P++G AVGY Y   + +    +L+    ++ YW     V    
Sbjct: 127 FIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGI 185

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYC-LCMVCGAGVTGPVGFRY 240
           W+++ + ++T +N+F V+F+GE EFW++++KV+ ++G +I   + M+ GAG    +GFRY
Sbjct: 186 WVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRY 245

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           W++PG + D   S+ +    + + G+F+ +   L+   F Y G EL GI A EA+NPR++
Sbjct: 246 WKHPGAFND--YSDDI----SGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRS 299

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXX-XXXXXPFIIAIENSGTKILP 359
           VP+AIK   +RIL+FY+ S+F +G+ VP++D KL           PF IAI N+G  +LP
Sbjct: 300 VPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLP 359

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419
           DIFN  +LI + SA NS++YV SR L+SLA    APKI + T + G+P+ S+  + +F +
Sbjct: 360 DIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCL 419

Query: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479
           LAYM  +     VF + VN+ +IAG   W+ ILI++I F + ++ + + +    + A   
Sbjct: 420 LAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQ 479

Query: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539
           P  AY ++F   +I I + FT F   FD   F   YI + +F L +  +++  K   I  
Sbjct: 480 PYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSE-IRS 538

Query: 540 LEDVDIDSNRR--DVEKIIWE 558
              VD+ S +   D E++ +E
Sbjct: 539 ARYVDLVSQKSLVDREQVEYE 559

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/558 (35%), Positives = 306/558 (54%), Gaps = 23/558 (4%)

Query: 14  QRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA-EVKRELKQRHXX 72
           +R S  Q F     D  +  I     +D  +        +    HD   +K+ L+ RH  
Sbjct: 34  ERSS--QLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGK--HDGIRLKKALEARHVS 89

Query: 73  XXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFT 132
                            + L  +GP   LIAY FVG L + V   LGEMA +IP+   FT
Sbjct: 90  MIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFT 148

Query: 133 VFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF--AVPIAAWISIFWVIL 190
            +++R+  P++G AVGY Y F + +    +L+    ++ YW     V    WI+I  V +
Sbjct: 149 SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAI 208

Query: 191 TALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGD 249
             +N   V+F+GEIE++++AVK+  ++G +I  L + CG G    V GF+YW+NPG + +
Sbjct: 209 ITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKE 268

Query: 250 GLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVV 309
             T+    I+  K  GRF+ + +  + A F Y GTEL GI   E  NPRK VP+AIK  +
Sbjct: 269 YSTA----ITGAK--GRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTM 322

Query: 310 FRILLFYIGSLFFIGLLVPFDDPKL---XXXXXXXXXXPFIIAIENSGTKILPDIFNAII 366
           +RI++FY+ S+F +G+ VPF+DP L             PF++AI N+G  +LP I NA I
Sbjct: 323 YRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACI 382

Query: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426
           LI + SA NS++YV SR L+ LA    AP+I ++T K+GVP+ S+L   +F +LAYM  +
Sbjct: 383 LIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVS 442

Query: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYA 486
            G   VF + VN  +I G  +W+ ILI++IRF +  + +GI +  L +++ L P  A+++
Sbjct: 443 SGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFS 502

Query: 487 VFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDI 545
           +F  ++I + + F AF   TFD   F   YI +  + + +  ++LW+K + I   E+VD+
Sbjct: 503 LFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKIIPS-EEVDL 561

Query: 546 DSNRRDVEKIIWEDPEPK 563
            S +  V+    E+ E K
Sbjct: 562 VSFKEAVD---LEEEEGK 576

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/576 (32%), Positives = 302/576 (52%), Gaps = 38/576 (6%)

Query: 25  MSQDDDMKKINIIQQTDASS------TTEDEEMLNSGSVHDAE-----VKRELKQRHXXX 73
           MS   D+K        D  +       TE    LN+G     +     +K+ L+ RH   
Sbjct: 1   MSTARDLKDAGQTSIVDKQTGQVFELDTESLSALNTGGSESQKREPHTLKQGLQSRHIQL 60

Query: 74  XXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTS---- 129
                          S+ L   GP G L +YI +  + Y V  +LGEM  ++P +     
Sbjct: 61  IALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSG 120

Query: 130 -SFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWV 188
            S +   SR+  PS+G A G+ Y++ + +  A E +    +V YWT  VP AAWI+IF  
Sbjct: 121 GSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLG 180

Query: 189 ILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPW 247
           ++T LN  PVKFYGE EFW A +K++ IVG L     +  G G +   +GFRYW+ PG +
Sbjct: 181 VVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAF 240

Query: 248 GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIK 306
              +T+         NTGRFL  +  +I   F +  G ELV +T+ EA + R+ + +A +
Sbjct: 241 AYHITTG--------NTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASR 292

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDP----KLXXXXXXXXXXPFIIAIENSGTKILPDIF 362
           +  +R++ FY+ S   IG++V  +DP     L          PF+IAI+N+  KILP I 
Sbjct: 293 RFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHII 352

Query: 363 NAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAY 422
           NA IL +  S+GNS ++  SR L S+A+ G+APK+  +  + GVP+ +V  +A F  LAY
Sbjct: 353 NACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAY 412

Query: 423 METTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGL 482
           +  + G    F W  NI+ I+GF  W+ I ++++RF + + FRG+  D +PFK+   P  
Sbjct: 413 LNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYG 471

Query: 483 AYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQLWFK--CRWIWK 539
            Y+ +  + II +  G+  F P F   +DF AAYI++ +F ++W   +++ +    W+  
Sbjct: 472 TYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIP 531

Query: 540 LEDVDIDSNRRDVEKIIWE----DPEPKTFWDKFWN 571
           + +VD+ +   ++E++  E       P + W+KF +
Sbjct: 532 VAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  323 bits (827), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/556 (32%), Positives = 295/556 (53%), Gaps = 18/556 (3%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXX 82
           + + +D     +    +T + +  + E  L      +  +++ L  RH            
Sbjct: 7   ANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGT 66

Query: 83  XXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPS 142
                 S+ L + GP+   ++++ +  + Y V  +L EM  ++P   +     SR++ PS
Sbjct: 67  GLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPS 126

Query: 143 IGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYG 202
           +G A G+ Y +S+++  A ELS    +V YWT  V +A WI+IF VI+  LN  PVKFYG
Sbjct: 127 LGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYG 186

Query: 203 EIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKN 261
           E EFW A++K++ I+G LI  + +   GA     +GFRYW NPGP+   +T         
Sbjct: 187 ESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGG------- 239

Query: 262 KNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSL 320
            NTGRFL  + ++I + F +    EL+G+   EA + R+ + +A ++ ++RI+ FYI S 
Sbjct: 240 -NTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITST 298

Query: 321 FFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNS 376
             IG ++  DDPKL              PF+  I N+G  +L  I NA+IL +  S+ NS
Sbjct: 299 LCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANS 358

Query: 377 NIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWL 436
            +Y  SR + +LAK G APK+ +R  + GVP+ +V  +     L Y+  +     VF WL
Sbjct: 359 FMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWL 418

Query: 437 VNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIF 496
            NI  I+GF  W  I I+++RF + + +  +  + +PFK+ L P   Y+ V  +V++ + 
Sbjct: 419 SNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLT 477

Query: 497 QGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEK- 554
            G+  F P + + SDF AAYI++ +FFL++   ++WFK RW     ++D+ +   D E+ 
Sbjct: 478 NGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGLADAEEE 537

Query: 555 -IIWEDPEPKTFWDKF 569
             + +   PK  W+KF
Sbjct: 538 AKMTQPRTPKNMWEKF 553

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/580 (33%), Positives = 311/580 (53%), Gaps = 34/580 (5%)

Query: 14  QRKSGVQTFSTMSQD---DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRH 70
           Q+K   +TF T  ++   DD++  NI   T A    +   +   G      +K+ L+ R 
Sbjct: 23  QKKVDSKTFPTQERELLHDDLEN-NISLSTSAEDQNDSYNV--DGKTEGTRLKKVLEGRV 79

Query: 71  XXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSS 130
                                L  +GPV  LIAY FVG L +    SLGEMA++IP+   
Sbjct: 80  VSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DG 138

Query: 131 FTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TFAVPIAAWISIFWV 188
           FT +A+R+  P++G AVGY Y F + +    +L+    ++ YW     V    WI+IF V
Sbjct: 139 FTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLV 198

Query: 189 ILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPW 247
           ++ A+N   V+F+GE EFW+++ KV+ +   +I    ++ G G     +GFR+W++PG +
Sbjct: 199 VIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAF 258

Query: 248 GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKK 307
                 N    +   +TG+F+ + +  + A F Y GTELVGI  GEA NPRK+VP+AIK 
Sbjct: 259 ------NNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKL 312

Query: 308 VVFRILLFYIGSLFFIGLLVPFDDPKL---XXXXXXXXXXPFIIAIENSGTKILPDIFNA 364
            ++RI++FY+ S+  +G+ V +DDP L             PF++AI NSG K+LP IFNA
Sbjct: 313 TMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNA 372

Query: 365 IILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYME 424
            +L+ + SA NS++YV SR L+SLA    APKI +RT + G+P+ S+  + +F +LAYM 
Sbjct: 373 CVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMS 432

Query: 425 TTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAY 484
            + G   +F++ VN+ +I G  +W+ IL++++ F + ++ +GI +    + A      AY
Sbjct: 433 VSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAY 492

Query: 485 YAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLE-- 541
           +A+F   +I + + FT F    FD   F   YI + +FF+ +  ++L +K + I  LE  
Sbjct: 493 FALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLEVD 552

Query: 542 ----DVDIDSNRRD--------VEKIIWEDPEPKTFWDKF 569
                  ID    D         E+I       + F+DKF
Sbjct: 553 LYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDKF 592

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/528 (34%), Positives = 300/528 (56%), Gaps = 27/528 (5%)

Query: 58  HDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117
           H   +K+ L+ RH                   T L  +GP    IAY FVG L +    +
Sbjct: 95  HTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAA 154

Query: 118 LGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TF 175
           +GEMA++IP+   FT +ASR++ P++G AVGY Y F + +    +L+    ++ YW    
Sbjct: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213

Query: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235
            V    WI+IF V++  +N+  VKF+GE EFW+++ KV+ ++G ++    ++ G G    
Sbjct: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHD 273

Query: 236 -VGFRYWRNPG---PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITA 291
            +GFRYW++PG   P+ D +         + + G+F+ + +  + A F Y G EL GI A
Sbjct: 274 RLGFRYWQHPGAFKPYSDAI---------DGSVGKFVAFVSVFVYALFAYLGIELTGIVA 324

Query: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX---XXXXXXPFII 348
            EA NPRK+VPRA+K  V+RI++FY+ ++F +G+ V ++DP+L             PF++
Sbjct: 325 AEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVV 384

Query: 349 AIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPW 408
           AI+NSG ++LP IFNA +LI + SA NS++YVGSR L+SLA  G AP I  RTT  G+P 
Sbjct: 385 AIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPH 444

Query: 409 VSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGIS 468
            S+    +F +LAYM  + G   VF++ VN+ +I G  +W+ I I++I FM+ +K +G+ 
Sbjct: 445 YSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVD 504

Query: 469 RDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGA 527
           R    + A   P   Y+++   V I   + FT F   +FD  +F   YI + +F + +  
Sbjct: 505 RSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG 564

Query: 528 FQLWFKCRWIWKLEDVDIDS-----NRRDVE-KIIWEDPEPKTFWDKF 569
           ++   K + I K  +VD+ +     +++++E KI+ ++ + +   +KF
Sbjct: 565 YKFIKKTK-IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/507 (36%), Positives = 292/507 (57%), Gaps = 17/507 (3%)

Query: 47  EDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           +D   +  G   +  +K+ELK RH                   T L   GPV  LIAY F
Sbjct: 65  DDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 124

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           VG L +     LGEMA++IP+   FT +ASR++ P++G A+GY Y F + +    +L+  
Sbjct: 125 VGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 183

Query: 167 GQIVDYWTFA--VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV-VAIVGFLIYC 223
             ++ YW     V    WI+IF V++ A+N+  VKF+GE EFW+++ KV V +   L+  
Sbjct: 184 ALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLF 243

Query: 224 LCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQG 283
           + M+ G      +GFRYWR+PG + +  T+         +TG+F  +    + + F+Y G
Sbjct: 244 IIMLGGGPDHDRLGFRYWRDPGAFKEYSTA------ITGSTGKFTSFVAVFVYSLFSYTG 297

Query: 284 TELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX---XXX 340
            EL GI   EA NPRK+VP+AIK  V+RI++FY+ ++F +G+ V ++DP+L         
Sbjct: 298 IELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS 357

Query: 341 XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSR 400
               PF++AI+NSG K+LP IFNA +L+ + SA NS++YV SR L++LA  G APKI ++
Sbjct: 358 AAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAK 417

Query: 401 TTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQ 460
           T+K GVP+ +++ + +F  LAYM  + G   +F++ VN+ ++ G  +W+ ILI +I F +
Sbjct: 418 TSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDK 477

Query: 461 VLKFRGISRDDLPFKANLMPGLAYYAV-FCMVIIIIFQGFTAFT-PTFDVSDFFAAYISV 518
             + +GI +    + A      AY+A+ FC++I +I + FT F    FD   F   YI +
Sbjct: 478 ACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALI-KNFTVFLGHKFDYKTFITGYIGL 536

Query: 519 ILFFLIWGAFQLWFKCRWIWKLEDVDI 545
            ++ L W  ++L +K + I K  DVD+
Sbjct: 537 PVYILSWAGYKLIYKTKVI-KSTDVDL 562

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/556 (31%), Positives = 299/556 (53%), Gaps = 19/556 (3%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXX 82
           +++ + D+   ++ ++   + ++ E+ E  ++GS ++  + + L+ RH            
Sbjct: 8   ASIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYNT-LHKGLQSRHIQLIALGGCIGT 66

Query: 83  XXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPS 142
                 S  L + G    L+++I + T+ Y +  SL EM  ++P   S     SR++ PS
Sbjct: 67  GLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPS 126

Query: 143 IGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYG 202
           +G A G+ Y +++A+  A ELS    +V YW   VP+AAWI+IF V++  LN   VK+YG
Sbjct: 127 LGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYG 186

Query: 203 EIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKN 261
           E EFW A++K++ I+G L+  + +   GA      GFRYW+NPGP+   L          
Sbjct: 187 EAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPG------- 239

Query: 262 KNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSL 320
            +TGRFL  + ++I +AF +    EL+GI   EA + R+   +A ++ ++RI+ FY+   
Sbjct: 240 -STGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCA 298

Query: 321 FFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNS 376
             IG+++   DPKL              PF+  I N+G  +L  + N  IL +  SAGNS
Sbjct: 299 LMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNS 358

Query: 377 NIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWL 436
            +Y  +R++ +LA+ G APK L++  + GVP+ +V+   +   LAY+        VF WL
Sbjct: 359 FMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWL 418

Query: 437 VNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIF 496
            NI  I+GF  W  + I+ IRF + + F  + +  +P++  L P +AYY  F  V++ + 
Sbjct: 419 SNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLT 477

Query: 497 QGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKI 555
            GF  F    ++V DF AAY+++ ++ +++   +LWF+ RW   +E +D+ +   + E+ 
Sbjct: 478 NGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEE 537

Query: 556 IWEDPE--PKTFWDKF 569
               P   PK  W+KF
Sbjct: 538 SKMTPPRIPKNLWEKF 553

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/554 (34%), Positives = 310/554 (55%), Gaps = 24/554 (4%)

Query: 30  DMKKINIIQQTD---ASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXX 86
           D+++ N+  ++    + S  +D   +  G      ++++LK RH                
Sbjct: 46  DLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLI 105

Query: 87  XXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAA 146
              T L   GPV  LIAY FVG L +     LGEMA++IP+   FT +ASR++ P++G A
Sbjct: 106 GTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFA 164

Query: 147 VGYMYWFSWAVTFALELSVVGQIVDYWTFA--VPIAAWISIFWVILTALNMFPVKFYGEI 204
           +GY Y F + +    +L+    ++ YW     V    WI+IF V++ A+N+  VKF+GE 
Sbjct: 165 IGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEF 224

Query: 205 EFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKN 263
           EFW+++ KV+ ++G ++    ++ G G     +GFRYWR+PG + +   + G        
Sbjct: 225 EFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIG------GG 278

Query: 264 TGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFI 323
            G+F+ +    + + F+Y G EL GI   EA NPRK+VP+AIK  V+RI++FY+ ++F +
Sbjct: 279 KGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLL 338

Query: 324 GLLVPFDDPKLXXX---XXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYV 380
           G+ V ++DP+L             PF++AI+NSG K+LP IFNA +L+ + SA NS++YV
Sbjct: 339 GMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYV 398

Query: 381 GSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNIT 440
            SR L++LA  G APKI S+T K GVP+ +++ + +F  LAYM  + G   +F++ VN+ 
Sbjct: 399 SSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVV 458

Query: 441 AIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYA-VFCMVIIIIFQGF 499
           ++ G  +W+ ILI +I F +  + +GI +    + A      AY+A VFC+ I +I + F
Sbjct: 459 SMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALI-KNF 517

Query: 500 TAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNR----RDVEK 554
           T F    FD   F   YI + ++   W  ++L +K + I K  DVD+ + +    R+ E+
Sbjct: 518 TVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVI-KSTDVDLYTFKEIYDREEEQ 576

Query: 555 IIWEDPEPKTFWDK 568
              ED E +    K
Sbjct: 577 GKIEDQEKEERLKK 590

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/528 (34%), Positives = 302/528 (57%), Gaps = 19/528 (3%)

Query: 47  EDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           +D   +  G   +  ++++LK RH                   T L   GPV  LIAY F
Sbjct: 67  DDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 126

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           VG L +     LGEMA++IP+   FT +ASR++ P++G A+GY Y F + +    +L+  
Sbjct: 127 VGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 185

Query: 167 GQIVDYWTFA--VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV-VAIVGFLIYC 223
             ++ YW     V    WI+IF V++ A+N+  VKF+GE EFW+++ KV V +   L+  
Sbjct: 186 ALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLF 245

Query: 224 LCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQG 283
           + M+ G      +GFRYWR+PG + +  T+    I+  K  G+F+ +    + + F+Y G
Sbjct: 246 IIMLGGGPNHDRLGFRYWRDPGAFKEYSTA----ITGGK--GKFVSFVAVFVYSLFSYTG 299

Query: 284 TELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX---XXX 340
            EL GI   EA NPRK+VP+AIK  V+RI++FY+ ++F +G+ V ++DP+L         
Sbjct: 300 IELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS 359

Query: 341 XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSR 400
               PF++AI+NSG ++LP IFNA +L+ + SA NS++YV SR L++LA  G APKI ++
Sbjct: 360 AAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAK 419

Query: 401 TTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQ 460
           T++ GVP+ +++ + +F  LAYM  + G   +F++ VN+ ++ G  +W+ ILI +I F +
Sbjct: 420 TSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDK 479

Query: 461 VLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVI 519
             + +GI +    + A      AY+A+F  ++I + + FT F    FD   F   YI + 
Sbjct: 480 ACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLP 539

Query: 520 LFFLIWGAFQLWFKCRWIWKLEDVDIDSNR----RDVEKIIWEDPEPK 563
           ++ + W  ++L +K + I K  DVD+ + +    R+ E+   +D E +
Sbjct: 540 VYIISWAGYKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKE 586

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/591 (32%), Positives = 320/591 (54%), Gaps = 37/591 (6%)

Query: 2   DTLESSSQSVPRQR-KSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60
           D  E   + +P++  K  +Q    +  +DD+++ NI   + ASS  E++     G     
Sbjct: 13  DQYEEYFEQLPKKEFKLPIQEEELI--NDDLER-NI---SSASSQDENDSYNIDGKTEGT 66

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            +K+ LK RH                   T L  +GPV +LIAY FVG L +     LGE
Sbjct: 67  RLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGE 126

Query: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI- 179
           MAT+IP+   FT +ASR+  P++G AVGY Y F + +    +L+    ++ YW     + 
Sbjct: 127 MATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185

Query: 180 -AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VG 237
              W++IF V++ ++N+F V+F+GE EFW+++ KV+ ++G ++    ++ G G     +G
Sbjct: 186 PGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLG 245

Query: 238 FRYWRNPGPWGD-GLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           FRYWR+PG + +   T  G       +TGRF+ + +  + A + Y G EL GI A EA N
Sbjct: 246 FRYWRHPGSFKEYSETITG-------DTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP---KLXXXXXXXXXXPFIIAIENS 353
           PRK++P+AIK  ++RI++FY+ S+F +G+ V +DDP   K           PF++AI NS
Sbjct: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINS 358

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
           G   LP I NA +L+ + SA NS++YV SR L+SLA    APKI ++T + G+P+ ++  
Sbjct: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
           + +F +LAYM  +     +F++ VN+ +I G  +W+ ILI++I F + ++ +G+ +    
Sbjct: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAF-TPTFDVSDFFAAYISVILFFLIWGAFQLWF 532
           + A   P  A++++F   +I + + FT F    FD  +F   YI + +FF  +  ++  +
Sbjct: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538

Query: 533 KCRWIWKLE------DVDIDSNRRD--------VEKIIWEDPEPKTFWDKF 569
           K + I  L+         ID    D         E+I       + F+DKF
Sbjct: 539 KTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKF 589

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/528 (34%), Positives = 301/528 (57%), Gaps = 19/528 (3%)

Query: 47  EDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           +D   +  G      ++++LK RH                   T L   GPV  LIAY F
Sbjct: 65  DDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGF 124

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           VG L +     LGEMA++IP+   FT +ASR++ P++G A+GY Y F + +    +L+  
Sbjct: 125 VGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 183

Query: 167 GQIVDYWTFA--VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV-VAIVGFLIYC 223
             ++ YW     V    WI+IF V++ A+N+  V+F+GE EFW+++ KV V +   L+  
Sbjct: 184 ALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLF 243

Query: 224 LCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQG 283
           + M+ G      +GFRYWR+PG + +  T+    I+ +K  G+F+ + +  + + F+Y G
Sbjct: 244 IIMLGGGPDHDRLGFRYWRDPGAFKEYSTA----ITGSK--GKFVAFASVFVYSLFSYTG 297

Query: 284 TELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX---XXX 340
            EL GI   EA NPRK+VP+AIK  V+RI++FY+ ++F +G+ V ++DP+L         
Sbjct: 298 IELTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMS 357

Query: 341 XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSR 400
               PF++AI+NSG K+LP IFN  +L+ + SA NS++YV SR L++LA  G APKI ++
Sbjct: 358 AAASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAK 417

Query: 401 TTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQ 460
           T+K GVP+ +++ + +F  LAYM  + G   +F++ VN+ ++ G  +W+ ILI +I F +
Sbjct: 418 TSKWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDR 477

Query: 461 VLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVI 519
             + +G+ +    + A      AY+A+F  ++I + + FT F   TFD   F   YI + 
Sbjct: 478 ACRAQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLP 537

Query: 520 LFFLIWGAFQLWFKCRWIWKLEDVDIDSNR----RDVEKIIWEDPEPK 563
           ++   W  ++L +K + + K  D D+ + +    R+ E+   +D E +
Sbjct: 538 IYVFSWVGYKLIYKTK-VVKPADADLYTLKEIYDREEEQGKLQDQEKE 584

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  315 bits (807), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 182/553 (32%), Positives = 299/553 (54%), Gaps = 18/553 (3%)

Query: 6   SSSQSVPRQRKSGVQTFSTMSQDD------DMKKINIIQQTDASSTTEDEEMLNSGSVHD 59
           S  +SV     S  +      Q D      D+++ +I   +  +S+  D ++ + G    
Sbjct: 2   SGLKSVGNSNNSKFEMTDLQKQSDQVTISSDLEQNSISIASSRNSSIGDRDIFDDGKTEG 61

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
             +K+ LK RH                   T L  +GP    I Y FVG L +     LG
Sbjct: 62  FRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLG 121

Query: 120 EMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           EMA FIP+   FT +ASR++ P++G AVGY Y   + +  A +L+    +V YW     +
Sbjct: 122 EMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTL 180

Query: 180 --AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-V 236
               +I+IF +++  +N+F VK +GE EFW+++ KV+ ++G ++    ++ G G     +
Sbjct: 181 NPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRL 240

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           GFRYWR+PG +    +S    IS + +TG+F+ + +  + A F Y G EL GI A EA N
Sbjct: 241 GFRYWRDPGSFKPYSSS---IISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQN 297

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP---KLXXXXXXXXXXPFIIAIENS 353
           PRK +P+AIK  ++RI++FY+ ++  + + V ++DP   K           PF++AIENS
Sbjct: 298 PRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENS 357

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
           G  ILP IFN  +L  ++SA NS++YV SR L+SLA    APK   +T K G+P+ S+  
Sbjct: 358 GINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAF 417

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
           +  F  LAYM  +     VF++ VN  +I G  +W+ IL+++I F +  K +G+ + +  
Sbjct: 418 STAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFT 477

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWF 532
           + A   P  AY+A+F   ++ + + FT F    FD  +F   YI + +FF+ +  +++ +
Sbjct: 478 YVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVY 537

Query: 533 KCRWIWKLEDVDI 545
           K +   + E+VD+
Sbjct: 538 KTK-THRPEEVDL 549

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  315 bits (806), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 185/579 (31%), Positives = 306/579 (52%), Gaps = 27/579 (4%)

Query: 8   SQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELK 67
           + S PR  K   +T     Q   + +++    +  +++        +       +K+ L+
Sbjct: 51  AMSTPRDLKDAGETSIVDKQTGQVFELDTESLSALNTSGSPGSGAAAAGAEANGLKKGLQ 110

Query: 68  QRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV 127
            RH                  S+ L   GP G L +YI +  + Y V  SLGEM  F+P 
Sbjct: 111 SRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEMVCFLPG 170

Query: 128 TS-----SFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAW 182
           ++     S +   +R+  PS+G A G+ Y++ + +  A E +    +V YWT AVP  AW
Sbjct: 171 SNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTAVPKGAW 230

Query: 183 ISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYW 241
           I+IF  ++T LN  PVK YGE EFW A +K++ IVG L     +  G G T   +GFRYW
Sbjct: 231 IAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDRLGFRYW 290

Query: 242 RNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKT 300
           ++PG +   +T+         NTGRFL  +  +I   F +  G ELV IT+ EA + R+ 
Sbjct: 291 QHPGAFAYHITTG--------NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP----KLXXXXXXXXXXPFIIAIENSGTK 356
           + +A ++  +R++ FY+ S   IG++V   DP     L          PF+IAI+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           +LP I NA IL +  S+GNS ++  SR L S+A+ G AP+IL R  ++GVP+ +V  +A 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
           F  LA++  + G    F W  NI+ I+GF  W+ I +++++F + + FRG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFK--C 534
            L P   Y+ +  + +I +  G+ +F   ++ SDF AAYI++ +F ++W   +++ +   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 535 RWIWKLEDVDIDSNRRDVE---KII-WEDPEPKTFWDKF 569
            W+  + +VD+ +   ++E   KI+  +   P   W KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  313 bits (801), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/566 (31%), Positives = 304/566 (53%), Gaps = 40/566 (7%)

Query: 27  QDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXX 86
           +D  + K+ +   +D S+ + +E+  N+       +K+ LK RH                
Sbjct: 48  KDSGLNKV-LTVSSDTSTNSLEEDYTNT-------LKQGLKSRHVQLIALGGCIGTGLFV 99

Query: 87  XXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-----VTSSFTVFASRFLSP 141
             S+ L   GP G  IAY  + ++ Y +  ++GEM  ++P        S T    R++  
Sbjct: 100 GTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDE 159

Query: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFY 201
           S+  A G+ Y++ + +  A E +    +V+YWT AVP AAWI+IF  I+  LNM  VK++
Sbjct: 160 SLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYF 219

Query: 202 GEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISK 260
           GE EFW A++K++ I+G +I    +  G G +   +GFRYW+NPG +   +T   +    
Sbjct: 220 GETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGSL---- 275

Query: 261 NKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
               G FL  ++ +I  AF +  G ELV +T+ E ++ R+ + +A K+ ++R++ FYI  
Sbjct: 276 ----GNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILG 331

Query: 320 LFFIGLLVPFDDPKLXXXXXXXX----XXPFIIAIENSGTKILPDIFNAIILITIISAGN 375
              IG++V ++DP L              PF+I I+N+G ++LP I NA IL +  S+GN
Sbjct: 332 TLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGN 391

Query: 376 SNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDW 435
           + ++  SR LF++A+ G APKI  R  K GVP+++V+ + +   LAY+  +     VF W
Sbjct: 392 AFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTW 451

Query: 436 LVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIII 495
           L NI+ I+GF  W+   I+++RF + + +  +  D +PFK    P L  +++  + II I
Sbjct: 452 LSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITI 510

Query: 496 FQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQLW--FK-----CRWIWKLEDVDIDS 547
             G+  F P F +VSDF AAYI++ +F  ++   +++  FK      +  + +ED+D+ +
Sbjct: 511 TNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVIT 570

Query: 548 NRRDVEKIIWEDPE----PKTFWDKF 569
              ++E    E  E    P   W++F
Sbjct: 571 GLDEIETKTCELDENRILPTNRWERF 596

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  311 bits (798), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 182/567 (32%), Positives = 301/567 (53%), Gaps = 35/567 (6%)

Query: 32  KKINIIQQTDASSTTEDEEMLNSG--SVHDAEVKRELKQ----RHXXXXXXXXXXXXXXX 85
           +K   + + D  S T +    N G     DA+++ +L+Q    RH               
Sbjct: 20  QKTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEGKLQQGLSARHIQLIALGGAIGTGLF 79

Query: 86  XXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-----VTSSFTVFASRFLS 140
              S+ L   GP G  I+Y+ + T+ Y +  + GEM  ++P        S +    R++ 
Sbjct: 80  VGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVD 139

Query: 141 PSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKF 200
           PS+  A G+ Y++ + +  A E +    +V YWT AVP AAWI+IF  I+  LN+  VK+
Sbjct: 140 PSLSFATGWNYFYCYVILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKY 199

Query: 201 YGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEIS 259
           YGE EFW A++KV+ IVG +I    +  G G     +GFRYW+NPG +   +T       
Sbjct: 200 YGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGG----- 254

Query: 260 KNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIG 318
              N G FL  ++ +I  AF +  G EL+ + + E  + R+ + +A K+ V+R++ FYI 
Sbjct: 255 ---NLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYIL 311

Query: 319 SLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAG 374
               I ++V  +DP L              PF+I I+N+G KILP I NA IL +  SAG
Sbjct: 312 GALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAG 371

Query: 375 NSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFD 434
           N+ ++  SR L ++A  G APKI  +  + GVPWV+V  +A+   LAY+  +     VF 
Sbjct: 372 NAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFA 431

Query: 435 WLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIII 494
           W  NI+ I+GF  W   L++++RF + +K+ G+  + LP+       + ++++  + ++I
Sbjct: 432 WFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLPYAPRFQQYMVWWSILVVTLVI 490

Query: 495 IFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQLW---FKCRWIWKLEDVDIDSNRR 550
              G+  F P F +VSDF AAYI++ LF ++W   +++   FK +W + +E++D+ +   
Sbjct: 491 FTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFK-KWWYPVEEIDVVTGLT 549

Query: 551 DVEK----IIWEDPEPKTFWDKFWNVV 573
           ++E+    +  E  EPK  + KF + +
Sbjct: 550 EIEERTRILDEERVEPKGAFPKFMDAL 576

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  308 bits (790), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 164/520 (31%), Positives = 280/520 (53%), Gaps = 19/520 (3%)

Query: 34  INIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLE 93
           + +++ T + S +  +E    GS ++A + REL                       T L 
Sbjct: 8   VTVVEPTLSDSASSRDE---GGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALA 64

Query: 94  DSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWF 153
             GP+   +AY+F G++   V  SL EMA F P+   F+ + ++++ P+ G A G+ Y+ 
Sbjct: 65  RGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFL 124

Query: 154 SWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV 213
            +A+  +  L+  G ++ YW   + +A W+++ +     +N   V+++G++E ++   K+
Sbjct: 125 KYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKL 184

Query: 214 VAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG--PWGDGLTSNGVEISKNKNTGRFLGW 270
             ++   I CL + CG G     +GFRYWR  G  P+               NTG+FLGW
Sbjct: 185 TILLLIFIVCLVITCGGGPDHTTIGFRYWRESGFLPY-----------LVKGNTGKFLGW 233

Query: 271 FNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD 330
           +  +I + F + G+E++GI  GE ANPRKT+P+A + V+ RI +FYI  +F +GL V   
Sbjct: 234 WACVIQSIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPH 293

Query: 331 DPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLA 389
           + KL           PF+IAI  SG K+LP   NA +L+ I S+  ++IY+ SR L+ LA
Sbjct: 294 NAKLVHAHSTDANASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLA 353

Query: 390 KTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWL 449
           K G APKI  R  K  +P V  +  ++ G LAYM T +   TVF ++ +  ++ G   W 
Sbjct: 354 KDGAAPKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWF 413

Query: 450 FILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVS 509
           +IL+++I + +V+K  G+  D++PF+    P  AY A+F + +I  F G++AF   F+  
Sbjct: 414 YILVAYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYK 473

Query: 510 DFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNR 549
            F  +YI +    L+   ++L++K +W+ K E++  +  +
Sbjct: 474 LFITSYIGIFANVLLVLGYKLYYKTKWV-KPEEITFEKKQ 512

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  310 bits (794), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/517 (34%), Positives = 278/517 (53%), Gaps = 26/517 (5%)

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
            + +KR LK RH                     L   GP   +IA+I  G++ Y+V Q+L
Sbjct: 86  SSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQAL 145

Query: 119 GEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVP 178
           GE+A  +PV+ S+  + SRF+ PS G A+ Y Y     +T  LEL      V+YW     
Sbjct: 146 GELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSK 205

Query: 179 IA-AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT--GP 235
            A A++++F++++  +N+F VK YGE EF  + +KV AIVGF+I  + +VCG G +  G 
Sbjct: 206 YADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGY 265

Query: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           +G RYW NPG +  G                F G+    + +AF++ G+E+  + A E  
Sbjct: 266 IGARYWYNPGGFAHG----------------FKGFAAIFVTSAFSFAGSEMFALAAAETE 309

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKL-XXXXXXXXXXPFIIAIENSG 354
           NPRK +PRA K+V +RI LFY+ SL  IG LVP+ D  L           PF+IAI  +G
Sbjct: 310 NPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAG 369

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            K LP + N +ILI ++S GN  +Y  SR + SLA  G  P+      +KG P V +L  
Sbjct: 370 IKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLC 429

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           A+FG+L+++  +     VFDW++ I+ +  F+ W  I + H+RF + L  +G S D+L +
Sbjct: 430 AIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSY 489

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFFLIWGAFQLW 531
           KA      + Y +  + I++ FQ + A  P   + + + FF+AY+S+ +    +   +L+
Sbjct: 490 KAQTGIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLY 549

Query: 532 FKC-RWIWKLEDVDIDSNRR--DVEKIIWEDPEPKTF 565
            +   ++ K  D+DID+ RR  D+E +  E  E + +
Sbjct: 550 TRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQY 586

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  310 bits (794), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 175/562 (31%), Positives = 304/562 (54%), Gaps = 27/562 (4%)

Query: 15  RKSGVQT--FSTMSQDDDMKK--INIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRH 70
            K+ VQ   F  +  + ++ +   N  ++   S+  + E+  ++G   D ++K+ +K RH
Sbjct: 45  EKTSVQNSGFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDKGDNKLKKTIKSRH 104

Query: 71  XXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTS 129
                                L + GP G +I Y  +G+  Y + Q+ GE+A  +  ++ 
Sbjct: 105 VVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSG 164

Query: 130 SFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVI 189
            F  + S  + P++G +V ++Y   W     LEL      + YWT +V    +++IF+V+
Sbjct: 165 GFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVV 224

Query: 190 LTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWG 248
           +  +N+F  + Y E EF+    KV+ I GFLI  + + CG AG  G +G +YW +PG + 
Sbjct: 225 IITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSF- 283

Query: 249 DGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKV 308
                     S +K    F G  ++L+ AAF +  TE + +TA E ANPRK++P A KK+
Sbjct: 284 ----------SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKI 333

Query: 309 VFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIIL 367
           ++RIL+ Y+GS+  IG LVP +  +L           P++IAI + G K++P + NA+IL
Sbjct: 334 LYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHLINAVIL 393

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
           +++IS GNS  Y  SR+L +LA+ G AP  L    ++G P ++++ ++VFG+++++  + 
Sbjct: 394 LSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASP 453

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
             +TVF WL+ I+ ++  + W  I +SHIRF + +K +G S  +L FK+ +    +YYA 
Sbjct: 454 KEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYAT 513

Query: 488 FCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL--E 541
             M++I+I Q +TA  P      D   FF  Y+++ +   ++  +++W K  W   +   
Sbjct: 514 GMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVW-KRDWTLYIPAS 572

Query: 542 DVDIDSNRR--DVEKIIWEDPE 561
            +D+ SNRR  D + +  ED E
Sbjct: 573 KIDLISNRRIFDEDVLKQEDAE 594

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  306 bits (785), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 174/527 (33%), Positives = 276/527 (52%), Gaps = 17/527 (3%)

Query: 32  KKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTP 91
           KK  ++ +  AS   EDE         +  + RELK R                    + 
Sbjct: 4   KKGTVVLERPASG--EDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61

Query: 92  LEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMY 151
           L   GP+   IAY+F G+L   V  SL EMA+F P+   F+ + +R++ P+ G A G+ Y
Sbjct: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121

Query: 152 WFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAV 211
           +  +A+  +  L+  G ++ YW   V +  W+++ +V +  +N   VK++GEIE  +   
Sbjct: 122 FLKYAIVLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVF 181

Query: 212 KVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPG--PWGDGLTSNGVEISKNKNTGRFL 268
           K++ +V   I CL + CG        GFRYWR  G  P+   L   G        TG+FL
Sbjct: 182 KLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPY---LVGGG--------TGKFL 230

Query: 269 GWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLV- 327
           GW+  ++ + F + G+E++GI  GE ANP+KT+P++   V FRI   Y+  +F +GL + 
Sbjct: 231 GWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAIS 290

Query: 328 PFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFS 387
           P +   +          PF+IAI +SG K+LP+  NA +L+ IIS+ N++IY+ SR L+ 
Sbjct: 291 PVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYG 350

Query: 388 LAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWA 447
           LAK G APKI     +  VP V  +  ++ G LAYM T +   TVF ++ +  ++ G   
Sbjct: 351 LAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILN 410

Query: 448 WLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFD 507
           W +ILI++I + + +K +GIS DD+PF+    P  AY  +F + II  F G+ AF   F 
Sbjct: 411 WFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFH 470

Query: 508 VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEK 554
              F  +YI V    L+   ++L+FK +++   E      N  + E+
Sbjct: 471 YKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISFRTRNEHEGEE 517

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  307 bits (786), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 182/543 (33%), Positives = 298/543 (54%), Gaps = 33/543 (6%)

Query: 25  MSQDDDMKKIN--IIQQTDASS----TTEDEEMLNS------GSVHDAEVKRELKQRHXX 72
           M+ D  M+K N  ++   +       T E E  + S      G      +K+EL+ RH  
Sbjct: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60

Query: 73  XXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFT 132
                            + L  +GPV  LI+Y FVG L Y V   LGEMA FIP+   FT
Sbjct: 61  MIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFT 119

Query: 133 VFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA--VPIAAWISIFWVIL 190
            +ASR++ P++G AVGY Y F + +    +L+    ++ +W     V    WI+IF  ++
Sbjct: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179

Query: 191 TALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG---P 246
             +N   V+F+GE EFW+++VKV+ ++G ++    ++ G G      GFR+WR+PG   P
Sbjct: 180 VLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKP 239

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
           + + ++ +          G+F+ + +    A F Y GTEL GI A EA NPR++VPRAIK
Sbjct: 240 YSEAISGS---------KGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIK 290

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLXXX---XXXXXXXPFIIAIENSGTKILPDIFN 363
             ++RI++FY+ ++  +G+ V ++DP+L             PF++AIEN+   +LP IFN
Sbjct: 291 LTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFN 350

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
             +L+ + SA NS++YV SR L+ LA  G AP+I + T K GVP+ S+  + +F +LAYM
Sbjct: 351 VCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYM 410

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
             + G   VF++ VN+ +I G  +W+ ILI++IRF + ++ +   +  L + A   P   
Sbjct: 411 NVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWST 470

Query: 484 YYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLED 542
           Y A+F   +I + + +T F    FD   F + YI + ++ + +  +++ ++ + I K ED
Sbjct: 471 YVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPED 529

Query: 543 VDI 545
           VD+
Sbjct: 530 VDL 532

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  305 bits (781), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 191/552 (34%), Positives = 305/552 (55%), Gaps = 19/552 (3%)

Query: 14  QRKSGVQTFSTMSQDDDMKK----INIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQR 69
           Q  S V +FS  S + D KK    I+I +++  S   +D      G   D  +K++LK R
Sbjct: 10  QGSSIVPSFSNHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKAR 69

Query: 70  HXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTS 129
           H                     L  +GPV  LI+Y FVG L + V   +GEMA +IP+  
Sbjct: 70  HVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPL-D 128

Query: 130 SFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TFAVPIAAWISIFW 187
            FT +ASR+  P++G AVGY Y   + +    +L+    ++ YW     V    WI+I  
Sbjct: 129 GFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVL 188

Query: 188 VILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYC-LCMVCGAGVTGPVGFRYWRNPGP 246
           V++  +N F VKF+GE EFW+++ KV+ ++G +I   + M+ G      +GFRYW++PG 
Sbjct: 189 VVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGA 248

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
           + +         S + + GRF+ + +  +   F Y G EL GI A EA NPRK +P+AIK
Sbjct: 249 FKE------YSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIK 302

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKL---XXXXXXXXXXPFIIAIENSGTKILPDIFN 363
             ++RI++FYI ++F +G+ V  +DP L             PF++AI NSG + LP IFN
Sbjct: 303 LTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFN 362

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
           A +L+ + SA NS++YV SR L+SLA    APKI ++T + G+P+ S+    +F +LAYM
Sbjct: 363 ACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYM 422

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
             + G   +F++ VN+ +I G   W+ ILI++I F + ++ +GI +    + A L P  A
Sbjct: 423 SVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGA 482

Query: 484 YYAVFCMVIIIIFQGFTAF-TPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLED 542
           Y+++F   ++ + + FT F    FD  +F   YI + LFF+ +  ++   K + I K E+
Sbjct: 483 YFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTK-IRKPEE 541

Query: 543 VDIDSNRRDVEK 554
           VD+ S +  +++
Sbjct: 542 VDLFSFKAAIDQ 553

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  305 bits (781), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 177/575 (30%), Positives = 301/575 (52%), Gaps = 36/575 (6%)

Query: 26  SQDDDMKKINII----QQTDASSTTEDEEMLNSGSV----HDAEVKRELKQRHXXXXXXX 77
           ++D   K I  +    QQ+ +S+T  ++     G      ++  +++ LK RH       
Sbjct: 33  AKDKYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALG 92

Query: 78  XXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-----VTSSFT 132
                      S+ L   GP G  I+YI + ++ Y +    GEM  ++P      + S  
Sbjct: 93  GAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAA 152

Query: 133 VFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTA 192
              +R++  S+G A  + Y++ + +  A E +    +V+YWT AVP   WI IF  I+  
Sbjct: 153 HLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVI 212

Query: 193 LNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGL 251
           LN  PVK+YGE EFW A++K++ IVG +I    +  G G     +GFRYW+ PG + + +
Sbjct: 213 LNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHI 272

Query: 252 TSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVF 310
              G         GRFL  ++ +I   F +  G ELV +T+ E  + R+ + +A ++ ++
Sbjct: 273 MKGGF--------GRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIW 324

Query: 311 RILLFYIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAII 366
           R++ FY+     I ++V ++DP L              PF+I I+N+G ++LP I NA I
Sbjct: 325 RLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACI 384

Query: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426
           L +  SAGN+ ++  +R L ++A+ G AP++  +  + GVP+V++  +     LA++  +
Sbjct: 385 LSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVS 444

Query: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYA 486
                VF+W  NI+ I+GF  W+   +++IRF + + F G+  D LPFK    P   YY+
Sbjct: 445 SSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYS 503

Query: 487 VFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLW---FKCRWIWKLED 542
           +F + +I +  G+  F P  +  SDF AAYI++ +F ++W   +LW   F  RW  +++ 
Sbjct: 504 LFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQ 563

Query: 543 VDIDSNRRDVE---KIIWEDP-EPKTFWDKFWNVV 573
           +D+ +   D+E   KI+ E   EP T W KF + V
Sbjct: 564 IDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  304 bits (779), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 176/565 (31%), Positives = 292/565 (51%), Gaps = 26/565 (4%)

Query: 13  RQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXX 72
           +  K   +T  T  Q   + +I+I   +  S           G   D  +K+ LK RH  
Sbjct: 5   QDLKDAGETTVTDKQTGQVYEIDIESYSQISGPKVSSSDAPQG---DHTLKKGLKSRHIQ 61

Query: 73  XXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFT 132
                           S+ L   GP G   +Y  +  + Y V  +LGEM  ++P   S +
Sbjct: 62  LIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSS 121

Query: 133 V-----FASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFW 187
                   +R++ PS+G A G+ Y++ + +  A E +    +V YWT AVP  AWI+IF 
Sbjct: 122 GGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFL 181

Query: 188 VILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGP 246
            ++  LN   VKFYGE EFW A++K++ I+G L     +  G G     +GFRYW+ PG 
Sbjct: 182 GVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGA 241

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAI 305
           +   +TS         NTGRFL  +  +I   F +  G ELV +T+ EA + R+ + +A 
Sbjct: 242 FAYHITSG--------NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKAS 293

Query: 306 KKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDI 361
           ++ V+R++ FY+ S   IG +V ++D  L              PF+I I+N+G K+LP I
Sbjct: 294 RRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHI 353

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
            N  IL +  S+GNS ++  SR L S+++ G APKIL R  + GVP+ +V  T++   +A
Sbjct: 354 INVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIA 413

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           Y+  +     VF W  NI+ I+GF  W+ I I+++RF + + F+ +  + +PFK    P 
Sbjct: 414 YLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQPY 472

Query: 482 LAYYAVFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFKC--RWIW 538
             ++ +  + +I +  G+  F P  ++VSDF AAY+++ +F ++W   +LW +    W  
Sbjct: 473 GTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAI 532

Query: 539 KLEDVDIDSNRRDVEKIIWEDPEPK 563
            + ++D+ +  +++E+   E  E +
Sbjct: 533 PVPEIDVTTGLKEIEEESKECDEKR 557

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  305 bits (780), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/524 (34%), Positives = 290/524 (55%), Gaps = 32/524 (6%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           G      +K++L+ RH                   + L  +GP+  LIAY  +G + + V
Sbjct: 51  GKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTV 110

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
              LGEMA +IP+   FT +A+R+  P++G AVGY Y F + V    +L+    ++ YW 
Sbjct: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 175 F--AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV 232
               V    WI++F  ++  +N+  VKF+GE EFW+++ KV+ +       LC++    V
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVM-------LCVMTLLLV 222

Query: 233 T--------GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGT 284
                      +GFRYW++PG  G    S  V I   K  G+F+ + +  + A F Y GT
Sbjct: 223 LVLGGGPSHNRLGFRYWKDPG--GFKPYSGAVSIPGGK--GKFVSFASVFVYALFAYLGT 278

Query: 285 ELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXX---XXXXX 341
           EL GI A E  NPR+ VPRAIK  ++RI++FY+ ++F +GL V ++DP L          
Sbjct: 279 ELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSA 338

Query: 342 XXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRT 401
              P+++AI+N+G  +LP IFNA +L  + SA NS++YVGSR L+ LA    APKI ++T
Sbjct: 339 AASPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKT 398

Query: 402 TKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQV 461
              GVP+ S+    +F  LAYM  +   +T+F + VN+T+I G  +W+ ILI++I F + 
Sbjct: 399 NSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRA 458

Query: 462 LKFRGISRDDLPFKANLMPGLAYYAV-FCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVI 519
            + +GI ++ L ++A   P  A+ A+ FC+++ ++ + FT F   TFD   F   YI + 
Sbjct: 459 FRVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALV-KNFTVFLGDTFDYKTFITGYIGIP 517

Query: 520 LFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPK 563
           ++ L +  +++  K +WI K  +VD+ + +  ++    E+ E K
Sbjct: 518 VYILCFVCYKIVHKTKWI-KSANVDLFTYKTAID---LEEEEGK 557

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  304 bits (779), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 178/546 (32%), Positives = 283/546 (51%), Gaps = 23/546 (4%)

Query: 26  SQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXX 85
           S+  D KK +     ++ +    E    +    D+   ++L  RH               
Sbjct: 34  SEAPDFKKADAASGNESWALENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLF 93

Query: 86  XXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGA 145
               + L   GP   +I ++ + T  + +  +LGE+++  PV   F V+ SRF+ PS G 
Sbjct: 94  VNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGF 153

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
           AV   Y   WAV   LEL      + YW   +   AW++IF+ I+   N+  VK +GE E
Sbjct: 154 AVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETE 213

Query: 206 FWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNT 264
           F ++ VK++AI+GF I  + + CG G  G     +YW NPG +             N ++
Sbjct: 214 FVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAF-----------VGNTSS 262

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
            RF G  +  + AAF+Y GTEL+ ++A E+ NPR T+P+A K+  + I + YI  L  +G
Sbjct: 263 QRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVG 322

Query: 325 LLVPFDDPKLXXXXXXX--XXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382
            LVP DDP+L            P +IAIEN G K LP + NAIILI ++S  NS +Y  S
Sbjct: 323 CLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACS 382

Query: 383 RILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAI 442
           R + S+A+ G  PK  S   +KG P  ++LAT +FG+L+++  +   +TVF WL  ++ +
Sbjct: 383 RCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWLSALSGL 442

Query: 443 AGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGL--AYYAVFCMVIIIIFQGFT 500
           +  + W  I +SHIRF   +K RG S D+LPF +  M G+  +YY    + ++++   +T
Sbjct: 443 STLFCWFAINVSHIRFRYTMKQRGRSLDELPFVS--MTGVWGSYYGCVIIFVVLVVCFWT 500

Query: 501 AFTPTFD----VSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVEKI 555
           A  P+ +       FF  Y+S  +  + +   +L+ K  R +    ++DIDS RR V+  
Sbjct: 501 ALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIE 560

Query: 556 IWEDPE 561
           + +D +
Sbjct: 561 VLKDEK 566

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  304 bits (779), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 184/513 (35%), Positives = 280/513 (54%), Gaps = 24/513 (4%)

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           ++R LK RH                   + L   GP   LI +  +G + Y+V  ++GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIA 180
           A   PV   FT +  RF+  S G A+ Y+Y   W V   LE+      V+YW T A    
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-R 239
            ++++F+V++  +NMF VK YGE EF  + +KV  +VGF+I  + ++CG G  G     +
Sbjct: 200 GFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGK 259

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTG-RFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           YW NPG +      NG       N G RF    +  + AAF++ GTELVG+ A E  NPR
Sbjct: 260 YWHNPGAF------NG------DNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPR 307

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKI 357
           K +PRA K+V +RI LFYI SL  IGLLVP+    L           PF++AI+  G   
Sbjct: 308 KALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISG 367

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           LP + N +ILI+++S GNS++Y  SR L +LA  G  P+I S   +KG P V +LAT  F
Sbjct: 368 LPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTF 427

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           G+L ++  ++    VF+WL+ ++ ++  + W FI I H+RF + L  +G S D+L F + 
Sbjct: 428 GLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSY 487

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFFLIWGAFQLWFKC 534
           +    +Y+ V  + ++ I Q + A  P   T + SDFF AY+SV++    + A +L+ + 
Sbjct: 488 VGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTR- 546

Query: 535 RWIW--KLEDVDIDSNRR--DVEKIIWEDPEPK 563
            W +  + +D+DID+ RR  D++ +  E  E K
Sbjct: 547 NWTFAKRAKDIDIDTGRRELDLDALKQEIAEEK 579

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  305 bits (781), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 180/580 (31%), Positives = 303/580 (52%), Gaps = 38/580 (6%)

Query: 23  STMSQDD--DMKKINIIQQTDASSTTEDEEMLN---------SGSVHDAEVKRELKQRHX 71
           S   +DD   M+KI+  Q   ++ T  ++ +++          G     ++K+ L+ RH 
Sbjct: 56  SDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHV 115

Query: 72  XXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSF 131
                            S+ L   GP G  I+YI +  + Y +  +LGEM  F+P   S 
Sbjct: 116 QLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSD 175

Query: 132 TV-----FASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIF 186
           +        +R++ PS+G A G+ Y++ + +  A E +    +V+YWT AVP   WI+IF
Sbjct: 176 SAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIF 235

Query: 187 WVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG 245
             ++  LN   VK YGE EFW A++K++ IVG +I    +  G G     +GFRYW++PG
Sbjct: 236 LCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPG 295

Query: 246 PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRA 304
            +   LT   +        G F   +  +I  AF +  G ELV +T+ E A+ R+ + +A
Sbjct: 296 AFAHHLTGGSL--------GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKA 347

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPD 360
            ++ V+R++ FY+     I ++VP++DP L              PF+I I+N+G K+LP 
Sbjct: 348 SRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPH 407

Query: 361 IFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVL 420
           I N  IL +  SA N+ ++  +R L ++A+TG APK L R  K GVP+V+V  + +   L
Sbjct: 408 IINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCL 467

Query: 421 AYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMP 480
           AY+  +     VF+W  NI+ I+GF  W+   I+++RF + + + G+  D LPFK    P
Sbjct: 468 AYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTWGQP 526

Query: 481 GLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQLWFKC--RWI 537
              ++++  + II I  G+  F P +  V+DF AAYI++ +F ++W   +L+ +   +W 
Sbjct: 527 YTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWW 586

Query: 538 WKLEDVDIDSNRRDVEKIIWEDPE----PKTFWDKFWNVV 573
             + ++D+ +   ++E+   E  E    P  F DKF + +
Sbjct: 587 LPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDAL 626

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  306 bits (783), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 183/592 (30%), Positives = 306/592 (51%), Gaps = 41/592 (6%)

Query: 11  VPRQRKSGVQTFSTMSQDDD---MKKINIIQQTDASSTTEDEEMLNSGSVHDAE-----V 62
           V     SG +T    ++ DD   M+KI+  Q   ++ T  +E  L      D +     +
Sbjct: 103 VTESPSSGSRTHHYEAEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRL 162

Query: 63  KRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA 122
           K+ L+ RH                  S+ L   GP G  I+YI +  + Y +  +LGEM 
Sbjct: 163 KQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMV 222

Query: 123 TFIPVTSSFTVFAS-----RFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
            F+P   S +  +S     R++  S+G A G+ Y++ + +  A E +    +V+YWT AV
Sbjct: 223 CFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAV 282

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-V 236
           P   WI+IF  ++  LN   VK YGE EFW A++K++ IVG +I    +  G G     +
Sbjct: 283 PKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRL 342

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAA 295
           GFRYW++PG +   L    +        G F   +  +I  AF +  G ELV +T+ E A
Sbjct: 343 GFRYWQHPGSFAHHLAGGSL--------GNFTDIYTGIIKGAFAFILGPELVCMTSAECA 394

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIE 351
           + R+ + +A ++ V+R++ FY+     I ++VP++DP L              P++I I+
Sbjct: 395 DQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQ 454

Query: 352 NSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSV 411
           N+G K+LP I N  IL +  SA N+ ++  +R L ++A+TG APK L +  + GVP+V+V
Sbjct: 455 NAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAV 514

Query: 412 LATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDD 471
             + +   LAY+  +     VF+W  NI+ I+GF  W+   I+++RF + + F G+  D 
Sbjct: 515 GVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDR 573

Query: 472 LPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQL 530
           LPFK    P   ++++  + II I  G+  F P + +V+DF AAYI++ +F ++W   +L
Sbjct: 574 LPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKL 633

Query: 531 WFKC--RWIWKLEDVD-------IDSNRRDVEKIIWEDPEPKTFWDKFWNVV 573
           + +    W   + ++D       I+   RD+E++      P TF +KF + +
Sbjct: 634 YTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEEL---RLPPATFKEKFMDAL 682

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  303 bits (776), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 175/506 (34%), Positives = 270/506 (53%), Gaps = 26/506 (5%)

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
            + +K  LK RH                   T L  +GP G LI +   GT+ Y++  ++
Sbjct: 76  QSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAV 135

Query: 119 GEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAV 177
           GE+A   PV   FT +A+RF+  S G A  ++Y   W V   LE+      V+YW T   
Sbjct: 136 GELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPK 195

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-V 236
               ++++F+V++  +NMF VK YGE EF  + +KV+ ++GF+I  + ++CG G     +
Sbjct: 196 YRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYI 255

Query: 237 GFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           G +YW NPG + GD                +F G+    + AAF++ G+ELVG+   EA 
Sbjct: 256 GAQYWYNPGAFVGDTAGQ------------QFQGFCTVFVTAAFSFAGSELVGLAGSEAE 303

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSG 354
            PRK+VP A K+V +RI LFYI  L  IG+LVP D P+L           PF+IAI N G
Sbjct: 304 EPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHG 363

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            K LP + N +ILI ++S GNS IY  SR L +LA  G  P I     + G P V +  +
Sbjct: 364 IKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAIS 423

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           A FG++A++  ++    VF+WL+ ++ ++  + W  I + HIR+   L  +G S D+LPF
Sbjct: 424 AFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPF 483

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF---DVSDFFAAYISVILFFLIWGAFQLW 531
           +A      +Y+  F  +++ I Q +    P     +  DFF AY+S  +F  ++   ++W
Sbjct: 484 QAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIW 543

Query: 532 FKCRWIWK----LEDVDIDSNRRDVE 553
            +    WK    L+D+DID+ RR+V+
Sbjct: 544 KRN---WKLFIPLKDLDIDTGRREVD 566

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  303 bits (775), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/532 (34%), Positives = 291/532 (54%), Gaps = 22/532 (4%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K++ + ++ D + T  ++  + +     + ++ +LK RH                  
Sbjct: 59  DSFKRVEV-EEVDPNLTDLEKIAIKTAR---SPLQHKLKSRHLQMIAIGGAIGTGLFVGS 114

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
              L  +GP G LI +   GT+ + +  +LGE+A   PV+  FT +A+RF+  S G A  
Sbjct: 115 GRALRTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACN 174

Query: 149 YMYWFSWAVTFALELSVVGQIVDYWTFAVPIA-AWISIFWVILTALNMFPVKFYGEIEFW 207
           + Y   W V   LE+      V YW   V     ++++FW+++  +NMF V+ YGE EF 
Sbjct: 175 FNYMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFV 234

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGR 266
            + +KV A++GF+I  + +VCG G  G     RYW NPG +  G TS            +
Sbjct: 235 FSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAF-VGSTSGQ----------K 283

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G+ +  + AAF++ G+EL+G+   EA NPRK VP A K+V +RILLFYI  L  IG L
Sbjct: 284 FHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFL 343

Query: 327 VPFDDPKLXXXXXXXXXX-PFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRIL 385
           VP++DP+L           PF+IAI   G   LP + N +ILI+++S GNS IY  SR L
Sbjct: 344 VPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTL 403

Query: 386 FSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
            +L++ G  PKI+S   +KG P V +  ++ FG++A++  +     +F+WL+ I+ ++ F
Sbjct: 404 VALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSF 463

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP- 504
           + W  I I HIRF   LK +G   D+LPF +      +Y+ +F  ++++I Q + A  P 
Sbjct: 464 FTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPI 523

Query: 505 --TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVE 553
             +    +FF+AY++  +    + A +LW K  +++  LEDVDID+ RRD +
Sbjct: 524 GGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTD 575

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  301 bits (772), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 192/571 (33%), Positives = 306/571 (53%), Gaps = 39/571 (6%)

Query: 7   SSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKREL 66
           SS    +  KS  Q F      D  K++ + ++ D + T  ++  + +     + ++R L
Sbjct: 31  SSPGQTQASKSRWQDF-----KDGFKRVEL-EELDPNLTEAEKIAIITA---QSPLQRHL 81

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
           K RH                     L   GP G LI +  +G + Y V  S+GE+A   P
Sbjct: 82  KNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFP 141

Query: 127 VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAAWISI 185
           V+  FT +A+RF+  S G A+ Y Y   W V   LE+      V++W T       ++++
Sbjct: 142 VSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVAL 201

Query: 186 FWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNP 244
           F++++  +N F V+ YGE EF  + +KV+ ++GF+I  + +VCG G  G     +YW NP
Sbjct: 202 FYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNP 261

Query: 245 GPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRA 304
           G +           S +    RF G  +  + AAF++ GTELVG+ + E ANPRK +PRA
Sbjct: 262 GAF-----------SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRA 310

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFN 363
            K+V +RILLFYI SL  IGLLVP    +L           PF++AI+  G K LP + N
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVIN 370

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
            +ILI+++S GNS +Y  SR + +LA+ G  P I +   +KG P V+++ T VFG+L+++
Sbjct: 371 VVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFI 430

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
             ++    VF+WL+ ++ ++  ++W  I I HIRF + L  +G S D+L F +      +
Sbjct: 431 AQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGS 490

Query: 484 YYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYIS--VILFFLIWGAFQLWFKCRWIW 538
           Y+ V  +++++I Q + A  P   + +  DFF+AY+S  V+L F I+   ++W +    W
Sbjct: 491 YFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIF--HKIWKRN---W 545

Query: 539 KL----EDVDIDSNRR--DVEKIIWEDPEPK 563
           KL    +D+DID+ RR  D E +  E  E K
Sbjct: 546 KLFTRAKDIDIDTGRREMDTEALRQEIAEEK 576

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  301 bits (770), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 174/534 (32%), Positives = 280/534 (52%), Gaps = 29/534 (5%)

Query: 56  SVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVT 115
           + +D+++ ++L  RH                     L   GP   ++A++ V T  + + 
Sbjct: 82  TANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIV 141

Query: 116 QSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF 175
            +LGE+A   PV   F V+ +RF+ PS G AV   Y   WAV   LEL      + YW  
Sbjct: 142 NALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNN 201

Query: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235
            +   AW++IF+  +   NM  VK +GE EF ++ +K++AI+GF I  + + CG G +G 
Sbjct: 202 TINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGE 261

Query: 236 -VGFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
            +G RYW +PG + GD                RF G     + AAF+Y GTELV ++A E
Sbjct: 262 YIGGRYWNDPGAFVGD------------TPGRRFKGVCAVFVTAAFSYSGTELVAVSAAE 309

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIE 351
           + NPR T+P+A K+  + I L YI  L  IG LVP++D +L            P +IAIE
Sbjct: 310 SHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIE 369

Query: 352 NSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSV 411
           N G K LP + NAIILI I+S  NS +Y  SR + ++A+ G  PK L+   K+G P  ++
Sbjct: 370 NGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAI 429

Query: 412 LATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDD 471
            AT +FG+L+++  +   + VF WL  ++ ++  + W  I +SHIRF Q +K +  S ++
Sbjct: 430 FATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNE 489

Query: 472 LPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGA 527
           LPF +      ++Y    + +++I   +T+  P      D   FF  Y+S+ +F + +  
Sbjct: 490 LPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLG 549

Query: 528 FQLWFKC-RWIWKLEDVDIDSNRRDVE--------KIIWEDPEPKTFWDKFWNV 572
            +++ K  R   K +D+D+D+ RR+++        ++  E    K F+ +F NV
Sbjct: 550 HKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQMAQKPFYIRFLNV 603

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  301 bits (770), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 184/538 (34%), Positives = 291/538 (54%), Gaps = 29/538 (5%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
           ++ D + T  +   +N+     A +K  LK RH                  ST L  +GP
Sbjct: 74  EEVDPNLTEAERIAINTA---KAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGP 130

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAV 157
            G +I +    T+ Y +  +LGE+A   PV+  FT +A+RF+  S G A  + Y   W  
Sbjct: 131 AGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLA 190

Query: 158 TFALELSVVGQIVDYW-TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAI 216
           T  LE+      V+YW T       ++++FW+++  +N+F V+ +GE EF  + +KV+ +
Sbjct: 191 TLPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTV 250

Query: 217 VGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLI 275
           +GF+I  + +V G G  G     RYW NPG +          +  N  T +F G  +  +
Sbjct: 251 IGFIILGIVLVAGGGPEGGFVGGRYWHNPGAF----------VGDNAGT-QFKGVCSVFV 299

Query: 276 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX 335
            AAF++ G+ELVGITA EAANPRK+VPRA K+VV+RI+LFY+GSL  IGLLVP+ DP+L 
Sbjct: 300 TAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLI 359

Query: 336 XXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLA 394
                     PF+IAI   G + LP + N +ILI ++S GNS I+ GSR + +L++ G  
Sbjct: 360 GASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFL 419

Query: 395 PKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILIS 454
           P+I     +KG P V ++  + FG++A++  ++    VF WL+ ++ ++  + W  I + 
Sbjct: 420 PEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLC 479

Query: 455 HIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSD---F 511
           HIRF   LK +G S ++LPF +      + + +F ++++ I Q + A  P         F
Sbjct: 480 HIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVF 539

Query: 512 FAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPK 563
           F +Y+S  +    +   +++ K    WKL    ED+DID+ RR  D+E +  E  E K
Sbjct: 540 FESYLSFPIVLAFYFGHKIYKKN---WKLFIKAEDMDIDTGRRETDLELLKQEIEEEK 594

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 172/568 (30%), Positives = 297/568 (52%), Gaps = 34/568 (5%)

Query: 20  QTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXX 79
           + F  M  D D+  +       +SST +        + H  E+K+ LK RH         
Sbjct: 42  EKFGKMPGDVDVFSL-------SSSTEKHSPHYTDMTGH--ELKQGLKSRHVQLIALGGA 92

Query: 80  XXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSS----FTVF- 134
                    S+ L   GP G  I+Y  + ++ Y + Q +GEM  ++P + S    F  + 
Sbjct: 93  IGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYL 152

Query: 135 ASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALN 194
             +++  S+G A  + Y++ + +  A E +    +V+YWT +VP AAWI+IF   +  LN
Sbjct: 153 VGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILN 212

Query: 195 MFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTS 253
              VKFYGE EFW A++K++ IVG +I    +  G G     +GFRYW+NPG +   +  
Sbjct: 213 FTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHI-- 270

Query: 254 NGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRI 312
                 +  + G FL  +  +I   F +  G E++ +T+ E  + R+ + +A ++ V+R+
Sbjct: 271 ------RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRL 324

Query: 313 LLFYIGSLFFIGLLVPFDDPKLXXXXXXXX----XXPFIIAIENSGTKILPDIFNAIILI 368
           + FYI     I ++V ++DP L              PF+I I+N+G K+LP I NA IL 
Sbjct: 325 MFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILS 384

Query: 369 TIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQG 428
           +  SAGN+ ++  SR L ++A+ G AP+I ++  + GVP+ +V  ++    LAY+  +  
Sbjct: 385 SAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSS 444

Query: 429 GQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVF 488
              VF+W  NI+ I+GF  W+ + I++IRF + + F G+ +  LP+ A  MP L Y+ + 
Sbjct: 445 TADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLL 503

Query: 489 CMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQLW----FKCRWIWKLEDV 543
            + II +  G+  F P F D  +F AAYI++ +F+++W   +++    F  +W   +E++
Sbjct: 504 VISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEI 563

Query: 544 DIDSNRRDVEKIIWEDPEPKTFWDKFWN 571
           D+ +   ++E+   E    +    K+W 
Sbjct: 564 DVVTGVEEIEEKTRECDASRVLPTKWWE 591

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  299 bits (765), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/509 (33%), Positives = 284/509 (55%), Gaps = 21/509 (4%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           G      +K+ L+ RH                   + L  +GP   LI+Y FVG L Y V
Sbjct: 44  GKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTV 103

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
              LGEMA FIP+   FT +ASR++ P++G AVGY Y F + +    +L+    ++ YW 
Sbjct: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 175 F--AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV 232
               V    WI+IF V++  +N   V+F+GE EFW+++VKV+ ++G ++    ++ G G 
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 233 TGP-VGFRYWRNPG---PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVG 288
                GFRYWR+PG   P+ + ++ +          G+F+ + +    A F Y GTEL G
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGS---------KGKFVSFASVFALALFAYTGTELCG 273

Query: 289 ITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP---KLXXXXXXXXXXP 345
           I A EA NPR++VPRAIK  ++RI+LFY+ S+  +G+ V ++DP   K           P
Sbjct: 274 IVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASP 333

Query: 346 FIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKG 405
           F++AI+N+G  +LP IFNA +L+ + SA NS++YV SR L+ LA    APKI ++T   G
Sbjct: 334 FVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWG 393

Query: 406 VPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFR 465
           VP+ S+  + +F +LAYM  + G   +F++ VN+ +I G  +W+ ILI+++RF + +  +
Sbjct: 394 VPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ 453

Query: 466 GISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLI 524
              +    + A   P   + ++F   +I + + +T F   TFD   F + YI + ++ + 
Sbjct: 454 FGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAIC 513

Query: 525 WGAFQLWFKCRWIWKLEDVDIDSNRRDVE 553
           +  ++L  + + I K EDVD+ + +  ++
Sbjct: 514 YVGYKLVHRSKLI-KPEDVDLYTFKAAID 541

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  299 bits (765), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 181/597 (30%), Positives = 304/597 (50%), Gaps = 43/597 (7%)

Query: 1   MDTLESSSQSVPRQRKSGV-QTFSTMSQDDDMKKI--NIIQQTDASSTTEDEEMLNSGSV 57
           M T+   S S   + K  V      +  + D++ +    I ++D+SS  E E        
Sbjct: 2   MSTISYPSYSKEEEEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEAEG------- 54

Query: 58  HDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117
            + ++K+ L  RH                  S  L+  GP G +I+YI + T+ Y +  +
Sbjct: 55  -NGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNA 113

Query: 118 LGEMATFIP-----VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDY 172
           LGEM  ++P        S      R++  S+  A G+ Y++ + +  A E +    +V Y
Sbjct: 114 LGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTY 173

Query: 173 WTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV 232
           WT +VP A WI+IF  I+T LN   VK++GE EFW A++K++ I+G ++    +  G G 
Sbjct: 174 WTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGP 233

Query: 233 TG-PVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGIT 290
           +   +GF YW++PG +   +T          + G FL  +  +I  AF +  G ELV +T
Sbjct: 234 SHVRLGFHYWKDPGTFAHHITGG--------SWGSFLDIYTGIIKGAFAFILGPELVALT 285

Query: 291 AGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP----KLXXXXXXXXXXPF 346
           + E  + R+ + +A K+ ++R++ FYI     I ++V ++DP     L          PF
Sbjct: 286 SSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPF 345

Query: 347 IIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGV 406
           +I I+N+G K+LP I NA IL +  SAGNS ++  SR L ++A  G APKI  +  + GV
Sbjct: 346 VIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGV 405

Query: 407 PWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRG 466
           P+ SV  +A+   LA++  +     VFDW  NI+ I+GF  W+  +I+++RF + + +  
Sbjct: 406 PYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNN 465

Query: 467 ISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIW 525
           +  D LPFK    P L +Y++  + +I +  G+  F P F   SDF AAYI++ LF ++W
Sbjct: 466 M-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILW 524

Query: 526 GAFQLWFK-------CRWIWKLEDVDIDSNRRD----VEKIIWEDPEPKTFWDKFWN 571
              + W +        +  + ++++D+ +   +     EK+      P T+W KF N
Sbjct: 525 VGHKFWARYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKFIN 581

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  299 bits (766), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 190/566 (33%), Positives = 305/566 (53%), Gaps = 35/566 (6%)

Query: 4   LESSSQSVPRQ----RKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHD 59
           LES S  + ++     ++G +  S   Q  D  K   + + D + T  ++E +   + H 
Sbjct: 30  LESESIDIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLT--EQERIAIITAH- 86

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
             +K  LK RH                   T L  +GP   +I +   G++ Y++  ++ 
Sbjct: 87  TPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVA 146

Query: 120 EMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           EMA   P++  FT +A+RF+  S G A  + Y   W V   LE+      V+YW    P 
Sbjct: 147 EMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYW--GTPT 204

Query: 180 A---AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV 236
                ++++FW+++  +N+F VK YGE EF  + +KV+ +VGF+I  L +VCG G TG  
Sbjct: 205 KYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGY 264

Query: 237 GF-RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
              +YW +PG +  G T+            +F G+ +  + AAF++ G+EL+GI   EA 
Sbjct: 265 VGAKYWHDPGAF-VGATAGA----------QFQGFCSVFVTAAFSFSGSELIGIAGSEAE 313

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX-XXXXXXXXXPFIIAIENSG 354
           NPRK VP A K+V +RILLFYI SL FIGLLVP +D +L           PF+IAI   G
Sbjct: 314 NPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHG 373

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            + LP + N +ILI ++S GNS IY  SR L +LA+ G  PK++S   + G P V +  +
Sbjct: 374 IRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAIS 433

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           + FG++A++  +     VF+WL+ I+ ++ F+ W  I + HIRF   LK +  S D+LPF
Sbjct: 434 SFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPF 493

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFD---VSDFFAAYISVILFFLIWGAFQLW 531
            + L    +Y+ +F +V+++  Q + A  P  D    ++FF+AY+S+ +  +++ A +LW
Sbjct: 494 VSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLW 553

Query: 532 FKCRWIWK----LEDVDIDSNRRDVE 553
            K    WK    L  +D+D+ R+ ++
Sbjct: 554 TKN---WKIFIPLGQLDLDTGRKQLD 576

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  298 bits (764), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 172/502 (34%), Positives = 270/502 (53%), Gaps = 24/502 (4%)

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           ++ +LK RH                   T L  +GP G LI +I  G++ Y +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIA 180
           A   PV   FT +A+RF+  S G A  + Y   W VT  LE+      V+YW T      
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-R 239
            ++++FWV++  +NMF V+ YGE EF  +  K++ IVGF+I  + ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           YW +PG +           + + +  +F G+ +  + AAF++ G+ELVG+ A EA+NPRK
Sbjct: 264 YWYHPGAF-----------AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRK 312

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXX-XXXXXXXXPFIIAIENSGTKIL 358
            VP A K+V +RI +FY+  L  IG+LVP+ DP+L           PF+IAI+N G   L
Sbjct: 313 DVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGL 372

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           P + N +ILI ++S GNS +Y  SR L +LA  G  PK  S   + G P V +  T+ FG
Sbjct: 373 PTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFG 432

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
           ++A++  +     VFDWL+ ++ ++  + W  I + HIRF + L  +G S ++L F +  
Sbjct: 433 LIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPA 492

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTPTF---DVSDFFAAYISVILFFLIWGAFQLWFKCR 535
               A + +F  +I++  Q + A  P       +DFF  Y+S+ +   +W   ++W K  
Sbjct: 493 GVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKN- 551

Query: 536 WIWKL----EDVDIDSNRRDVE 553
             WKL    ED+DID+ RR+++
Sbjct: 552 --WKLFIKAEDMDIDTGRRELD 571

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  298 bits (764), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 177/536 (33%), Positives = 293/536 (54%), Gaps = 30/536 (5%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K+++ +      +  +   +L S S     ++R+LK RH                  
Sbjct: 55  DSFKRMDSVDLDPNLTDAQKIAILTSQS----PLQRKLKNRHLQMIAIGGAIGTGLFIGS 110

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
           S  L  +GP G LI +  + T+   +  SLGEMA   PV+  +T +A+RF+  S G A  
Sbjct: 111 SKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANN 170

Query: 149 YMYWFSWAVTFALELSVVGQIVDYWTFAVPI-AAWISIFWVILTALNMFPVKFYGEIEFW 207
             Y     V   LE+      VDYW       AA++++FW+ + ++NMF VK YGE EF 
Sbjct: 171 INYMMQALVVLPLEIVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFV 230

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPW-GDGLTSNGVEISKNKNTG 265
            + +KVV ++GF+I  + +VCG G T   +G ++W NPG + GD                
Sbjct: 231 FSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQ------------ 278

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           +F G  +  + AAF++  TELVG+ A E  +PRK+VP+A K+V +RI LFYI SL  +GL
Sbjct: 279 KFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGL 338

Query: 326 LVPFDDPKLX-XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           LVP+ DP+L           PF++A++N G K LP + N +IL  ++S GNS+++  SR 
Sbjct: 339 LVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRC 398

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L +L++ G  P +     +KG P VS++ ++ FG+L ++  +   Q +FDW+++++ ++ 
Sbjct: 399 LTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSS 458

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            + WL I + HIRF + L  +  S D+L F + +    +YY+VF +++++I Q + A  P
Sbjct: 459 LFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFP 518

Query: 505 TFD---VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRRDVE 553
                  S+FF AY+S+ +   ++   +++ K    WKL    + +DID+ RR+++
Sbjct: 519 GHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKN---WKLLIDPKYMDIDTGRRELD 571

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  297 bits (760), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 178/560 (31%), Positives = 287/560 (51%), Gaps = 33/560 (5%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE--VKRELKQRHXXXXXXXXXXXXXXXX 86
           + MK++   ++T  +S +  E   NS  V D E  +K+ L  RH                
Sbjct: 17  NGMKEVKSNEETYRTSHSNLESQ-NSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGLFV 75

Query: 87  XXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAA 146
             S+ L   GP    +++I + T+ Y +  +L EM  ++P   S     +R++ PS+G A
Sbjct: 76  GTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFA 135

Query: 147 VGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
            G+ Y +S+A+  A EL+    IV YWT  VP   WI+IF +++  LN   V+FYGE EF
Sbjct: 136 AGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEF 195

Query: 207 WVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTG 265
           W A++K++ I+  L+  + +   GA     VGFRYWRNPG +G  +T          N G
Sbjct: 196 WFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGG--------NLG 247

Query: 266 RFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
           RFL  + ++I +AF +    ELVG+   EA + R+ + +A ++ ++RI+ FY+ S   IG
Sbjct: 248 RFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIG 307

Query: 325 LLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYV 380
           ++V  +D  L              PF+  I NSG  +L  + N  IL +  SAGNS  Y 
Sbjct: 308 VIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYA 367

Query: 381 GSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNIT 440
            SR + +L+K G APKI S+  + GVP+ +V   ++   LAY+  +     VF WL NI 
Sbjct: 368 SSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNIC 427

Query: 441 AIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFT 500
            I+GF  W  I +++IRF + + F  +  D +P+++ L P  AY+    + II +  G+ 
Sbjct: 428 TISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYV 486

Query: 501 AFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSN--------RRD 551
            F    +D  DF  +YIS+ +F   +   +  +K R+   ++ +D+ +         +  
Sbjct: 487 VFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEEAEEEAKLS 546

Query: 552 VEKIIWEDPEPKTFWDKFWN 571
           V ++      PK  W+KF N
Sbjct: 547 VVRV------PKNAWEKFIN 560

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  298 bits (764), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 180/595 (30%), Positives = 307/595 (51%), Gaps = 39/595 (6%)

Query: 4   LESSSQSVPRQRKSGVQTFSTMSQD----DDMKKINIIQ-QTDASSTTEDEEMLNSGSVH 58
           LE  S S  R  K  +   S+  ++    D +   ++ Q   + + T   EE++N     
Sbjct: 40  LEYDSNSSLRIEKETLTFNSSKLEECKIEDKISNFDLSQIGYNGNETIISEELINEDGRK 99

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
           + ++K+ L  RH                     L   GP G + +Y+ + T+ Y +   L
Sbjct: 100 N-KLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNVL 158

Query: 119 GEMATFIPVTSSFTV-----FASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173
           GEM  ++P   S +         R+L  S+  A G+ Y++ + +  A E +    +V+YW
Sbjct: 159 GEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYW 218

Query: 174 TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT 233
           T  VP  AWI +F +I+  LNM PV+ YGE EFW A  K++ IVG +I    +  G G  
Sbjct: 219 TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGPN 278

Query: 234 GP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITA 291
              +GFRYW  PG + + +T        N + G FL  +  +I  AF++  G ELV + +
Sbjct: 279 HDRLGFRYWITPGSFANTIT--------NGSFGNFLDVYKGIILGAFSFILGPELVVLPS 330

Query: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX----XXPFI 347
            E ++PR+ + +A K+ ++R++ FYI     I ++V ++DP L              PF+
Sbjct: 331 SECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFV 390

Query: 348 IAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVP 407
           I I+N+G  +LP I N  ILI+  S+GN+ ++  SR L ++A    APK L +  + GVP
Sbjct: 391 IGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVP 450

Query: 408 WVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGI 467
           +V+V+ + +   +AY+  ++    VF W  N++ I+GF  W+ + ++++RF + +++ G+
Sbjct: 451 YVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM 510

Query: 468 SRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWG 526
            +D LP+     P L  Y++   +II I  GF    P  ++VSDF AAY+++ +F +IW 
Sbjct: 511 -KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWI 569

Query: 527 AFQLW---FK-----CRWIWKLEDVDIDSNRRDV----EKIIWEDPEPKTFWDKF 569
             + +   FK     CRW +++ED+D+ +   ++    EK   E  +P+T   KF
Sbjct: 570 GHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFESEYVKPETVGGKF 624

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  298 bits (763), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 177/600 (29%), Positives = 307/600 (51%), Gaps = 40/600 (6%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDD----MKKINIIQQTDASSTTEDEEMLN------- 53
           E +   V     SG++       + D    M+KI+      ++ T  ++ +++       
Sbjct: 40  EDNVVQVTESLSSGLRRNHPYDNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSP 99

Query: 54  --SGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLT 111
              G     ++K+ L+ RH                  S+ L   GP G  I+YI +  + 
Sbjct: 100 SVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVI 159

Query: 112 YAVTQSLGEMATFIPVTSSFTV-----FASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           Y +  +LGEM  F+P   S +        +R++  S+G A G+ Y++ + +  A E +  
Sbjct: 160 YPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAA 219

Query: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226
             +V+YWT AVP   WI+IF  ++  LN+  VK YGE EFW A++K++ IVG +I    +
Sbjct: 220 SGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFIL 279

Query: 227 VCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGT 284
             G G     +GFRYW++PG +   LT   +        G F   +  +I  AF +  G 
Sbjct: 280 FWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL--------GNFTDIYTGIIKGAFAFILGP 331

Query: 285 ELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX---- 340
           ELV +T+ E A+ R+ + +A ++ V+R++ FY+     I ++VP++DP L          
Sbjct: 332 ELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPG 391

Query: 341 XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSR 400
               PF+I I+N+G K+LP I N  IL +  SA N+ ++  +R L ++A+TG APK L R
Sbjct: 392 AGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGR 451

Query: 401 TTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQ 460
             + GVP+V+V  + +   LAY+  +     VF+W  NI+ I+GF  W+   I+++RF +
Sbjct: 452 INRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRK 511

Query: 461 VLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVI 519
            + + G+  D LPFK    P   + ++  + II +  G+  F P +  ++DF AAYI++ 
Sbjct: 512 AIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLP 570

Query: 520 LFFLIWGAFQLWFK--CRWIWKLEDVDIDSNRRDVEKIIWEDPE----PKTFWDKFWNVV 573
           +F ++W   +L+ +   +W   + ++D+ +   ++E+   E  E    P +F DKF + +
Sbjct: 571 IFLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMDAL 630

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  297 bits (761), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 176/595 (29%), Positives = 298/595 (50%), Gaps = 67/595 (11%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTE----------------DEEMLNSGSVHDAEVKREL 66
           +T S D++ K   II    + S  E                ++E     S  + E+K+ L
Sbjct: 41  ATASNDNNKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGL 100

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
           K RH                  S+ L + GP G  I+Y+ + T  Y +  +LGEM  F+P
Sbjct: 101 KSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLP 160

Query: 127 VTSSFTV-----FASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA--VPI 179
              S +         +++ PS+G A  + Y++ + +  A E+S    +++YW +A  VP 
Sbjct: 161 GNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPK 220

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG--VTGPVG 237
            AWI+IF  ++  LN  PV  YGE EFW A++K++ I G +I    +  G G    G +G
Sbjct: 221 GAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILG 280

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAAN 296
           FRYW+NPG +   +T  G         G FL  +  +I   F+   G ELV +T+ E A+
Sbjct: 281 FRYWKNPGSFAHHITGGG--------GGNFLDIYTGIIKGGFSVILGPELVCLTSSECAD 332

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP----KLXXXXXXXXXXPFIIAIEN 352
            R+ + +A K+ V+R++ FYI     IG++V ++DP     L          PF+I I+N
Sbjct: 333 QRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQN 392

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
           +G + +P I N  IL +  SAGN+ ++  SR L ++A+ G APKI  R  + GVP+ +V 
Sbjct: 393 AGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVG 452

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
           A+ +   LAY+  +     VF+W  NI+ I+GF  W+   +++IRF + + +  ++   +
Sbjct: 453 ASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH-RI 511

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLW 531
           PF+A       +Y++F + +I +  G+  F P  ++V DF AAYI++ +F ++W   +++
Sbjct: 512 PFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVF 571

Query: 532 FKC---RWIWKLEDVDI--------------DSNRRDVEKIIWEDPEPKTFWDKF 569
            +     W+  ++ +D+              ++NR+           PK  W+KF
Sbjct: 572 TRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQ----------APKNKWEKF 616

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  295 bits (754), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/564 (30%), Positives = 287/564 (50%), Gaps = 23/564 (4%)

Query: 8   SQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELK 67
           +++ P + +S    + +     D K+ +++  ++  +    +         DA   ++L 
Sbjct: 18  AETQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQDARYNKDLS 77

Query: 68  QRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV 127
            RH                     L   GP   +I ++ + T  + +  +LGE+++  PV
Sbjct: 78  VRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPV 137

Query: 128 TSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFW 187
              F V+ SRF+ PS G AV   Y   WAV   LEL      + YW   +   AW++IF+
Sbjct: 138 VGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFY 197

Query: 188 VILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGP 246
            I+   N+  VK +GE EF ++ VK++AI+GF I  + + CG G  G     +YW NPG 
Sbjct: 198 TIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGA 257

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
           +      +           RF G  +  + AAF+Y GTEL+ ++A E+ NPR T+P+A K
Sbjct: 258 FVGHTAGD-----------RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACK 306

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKILPDIFNA 364
           +  + I + YI  L  +G LV  DDP+L            P +IAIEN G K LP + NA
Sbjct: 307 RTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNA 366

Query: 365 IILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYME 424
           IILI ++S  NS +Y  SR + S+A+ G  PK+ +   +KG P  +++AT +FG+L+++ 
Sbjct: 367 IILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIA 426

Query: 425 TTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGL-- 482
            +   + VF WL  ++ ++  + W  I +SHIRF + +K RG + D+LPF +  M G+  
Sbjct: 427 ASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVS--MTGVWG 484

Query: 483 AYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWI 537
           +YY    + I+++   +T+  P      +   FF  Y+S  +    +   +L+ +  R +
Sbjct: 485 SYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLL 544

Query: 538 WKLEDVDIDSNRRDVEKIIWEDPE 561
              +++D+DS RR V+  + +D +
Sbjct: 545 TPTKEIDLDSGRRAVDLELMKDEK 568

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 178/600 (29%), Positives = 310/600 (51%), Gaps = 37/600 (6%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDD-DMKKINIIQQTDASSTTEDEEMLN------- 53
           D +   ++S     ++  Q +     DD  M+KI+  Q   ++ T  +E +++       
Sbjct: 35  DNVVQVTESASSGSRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKSP 94

Query: 54  --SGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLT 111
              G     ++K+ L+ RH                  S+ L   GP G  I+YI +  + 
Sbjct: 95  SADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVI 154

Query: 112 YAVTQSLGEMATFIPVTSSFTV-----FASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           Y +  +LGEM  F+P   S +        +R++  S+G A G+ Y++ + +  A E +  
Sbjct: 155 YPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAA 214

Query: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226
             +V+YWT AVP   WI++F +++  LN   VK YGE EFW A++K++ IVG +I    +
Sbjct: 215 SGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 274

Query: 227 VCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGT 284
             G G     +GFRYW++PG +   LT   +        G F   +  +I  AF +  G 
Sbjct: 275 FWGGGPKHDRLGFRYWQHPGAFAHHLTGGSL--------GNFTDIYTGIIKGAFAFILGP 326

Query: 285 ELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP----KLXXXXXX 340
           ELV +T+ E A+ R+ + +A ++ V+R++ FY+     I ++VP++DP     L      
Sbjct: 327 ELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPG 386

Query: 341 XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSR 400
               PF+I I+N+G K+LP I N  IL +  SA N+ ++  +R L ++A+TG APK L +
Sbjct: 387 AGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGK 446

Query: 401 TTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQ 460
             + GVP+V+V A+ +   LAY+  +     VF+W  NI+ I+GF  W+   I+++RF +
Sbjct: 447 INRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRK 506

Query: 461 VLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVI 519
            + + G+  D LPFK    P   ++++  + II I  G+  F P +  V+DF AAY+++ 
Sbjct: 507 AIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLP 565

Query: 520 LFFLIWGAFQLWFKC--RWIWKLEDVDIDSNRRDVEKIIWEDPE----PKTFWDKFWNVV 573
           +F ++W   +L+ +   +W   + ++D+     ++E+   E  E    P +  DKF + +
Sbjct: 566 IFLVLWLGHKLYTRTWHQWWLPVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKFMDTL 625

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 177/572 (30%), Positives = 306/572 (53%), Gaps = 30/572 (5%)

Query: 15  RKSGVQT--FSTMSQDDDMKK--INIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRH 70
            K+ VQ   F  +  + ++ +   N  ++   S+  + E+  ++G   D ++K+ +K RH
Sbjct: 45  EKTSVQNSDFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDKGDNKLKKTIKSRH 104

Query: 71  XXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTS 129
                                L + GP G +I Y  +G+  Y + Q+ GE+A  +  ++ 
Sbjct: 105 VVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSG 164

Query: 130 SFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVI 189
            F  + S  + P++G +V ++Y   W     LEL      + YWT +V    +++IF+V+
Sbjct: 165 GFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVL 224

Query: 190 LTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWG 248
             A+N+F  + Y E EF+    KV+ I GF I  + + CG AG  G +G +YW +PG + 
Sbjct: 225 TIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSF- 283

Query: 249 DGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKV 308
                     S +K    F G  ++L+ AAF +  TE + +TA E ANPRK++P A KKV
Sbjct: 284 ----------SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKV 333

Query: 309 VFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIIL 367
           ++RI++ ++GS+  +G LVP +  +L           P++IAI + G K++P   NA+IL
Sbjct: 334 LYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHFINAVIL 393

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
           ++++S GNS  Y  SR+L SLA+ G AP  L    ++G P ++++ +AVFG+++++  + 
Sbjct: 394 LSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASP 453

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
             +TVF WL+ I+ ++  + W  I +SHIRF + +K +G S  +L FK+ +    +YYA 
Sbjct: 454 KEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYAT 513

Query: 488 FCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL--E 541
             M++I+I Q +TA  P      D   FF  Y+++ +   ++  +++W K  W   +   
Sbjct: 514 GMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVW-KRDWTLYIPAS 572

Query: 542 DVDIDSNRR--DVEKIIWEDPEPKTFWDKFWN 571
            +D+ SNRR  D + +  ED E   F +K  N
Sbjct: 573 KIDLISNRRIFDEDVLKQEDAE---FREKLRN 601

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  293 bits (751), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 186/585 (31%), Positives = 300/585 (51%), Gaps = 42/585 (7%)

Query: 16  KSGVQTFSTMSQDDDMKKINIIQQTD-----ASSTTED----EEMLNSGSVHDAEVKREL 66
           KS  + FS+  + ++++ +  + +++          ED    E+ + + +     + R+L
Sbjct: 16  KSWTKLFSSFKRMEEVEVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDL 75

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
             RH                   + L   GP   +IA+  + T  + +  +LGE+A   P
Sbjct: 76  SIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFP 135

Query: 127 VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIF 186
           V   F V+ +R + PS+G AV   Y   WAV   LEL      + YW  +V   AW+++F
Sbjct: 136 VVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSDAWVAVF 195

Query: 187 WVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG-VTGPVGFRYWRNPG 245
           +V +   ++  VK +GE EF ++ VK++AI GF I  + ++CG G   G +G +YW +PG
Sbjct: 196 YVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPG 255

Query: 246 PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 305
            +        V  S      +F G  +  + AAF+Y GTELVG++A E+ANPR T+P+A 
Sbjct: 256 SF--------VGASPGS---QFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKAS 304

Query: 306 KKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXX--XXXPFIIAIENSGTKILPDIFN 363
           K+  + I L Y+  L  IG LV  DDPKL            P +IAIEN G + LP + N
Sbjct: 305 KRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMN 364

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
           AIILI IIS  NS++Y  SR + S+A+ G  P+I +    +G P V+++ T VFG+L+++
Sbjct: 365 AIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFI 424

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
             +   + +F WL  ++ ++  + WL I ISHIRF + L  +G S D+LP+ +  M G+ 
Sbjct: 425 AASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLS--MTGVI 482

Query: 484 YYAVFCMVIIIIFQG------FTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537
                C+VII++         F A +   D   FF  Y+S+ +F   +   +L +K  W 
Sbjct: 483 GSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKL-YKRNWS 541

Query: 538 WKLED--VDIDSNRRDVEKIIW--------EDPEPKTFWDKFWNV 572
           W +    +D+++ RR ++K           E    K+F  K WN+
Sbjct: 542 WMIRSNKIDVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKLWNL 586

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  291 bits (744), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 169/497 (34%), Positives = 266/497 (53%), Gaps = 15/497 (3%)

Query: 31  MKKINIIQ--QTDASSTTEDEEMLNSGSVHDAE--VKRELKQRHXXXXXXXXXXXXXXXX 86
           +K+++ +    +D     E  E+    ++ ++   ++R  KQRH                
Sbjct: 11  VKRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVI 70

Query: 87  XXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAA 146
              T L+  GP   LIA+IF G+L   V  SL EMA+F P+  SF+ +A+R++ P++G A
Sbjct: 71  GTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFA 130

Query: 147 VGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
            G+ Y+  +A+  A ELS +G +V YW   + IA +I +F V+L +LN   +KFYGE+EF
Sbjct: 131 TGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEF 190

Query: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTG 265
           W A +K + ++   +  L + CG G +   +GFRYWR             V       TG
Sbjct: 191 WSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAF---------VPYLVKGTTG 241

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           RFLGW+  +I + + Y G+E +G+  GEA NP+KT+P A + V+FRI  FYI  +  +GL
Sbjct: 242 RFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGL 301

Query: 326 LV-PFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           ++ P D              PF+IA  N+G K LP   NA++++ I SA N+ +YV SR 
Sbjct: 302 IISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRT 361

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
            + LAK G+APKI     + GVP+   L   +  +L++M  +     +F +L +   + G
Sbjct: 362 AYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFG 421

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
              WL +LIS+I + +   F  + RD +PF+    P  AY  +F + +II F G++AF  
Sbjct: 422 TLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIA 481

Query: 505 TFDVSDFFAAYISVILF 521
            F    F  +YI + +F
Sbjct: 482 GFKYKSFIVSYIGIAVF 498

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  292 bits (747), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 184/564 (32%), Positives = 304/564 (53%), Gaps = 42/564 (7%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K+I + ++ D + T  ++  + +     + +K  LK RH                  
Sbjct: 58  DSFKRIEL-EELDPNLTDAEKIAIATAR---SPLKHTLKSRHLHMIAVGGAIGTGLFVGS 113

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
              L  +GP G LI +   GT+ Y++  ++GE+A   PV+  FT +A+RF+  S G A+ 
Sbjct: 114 GKALRTAGPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAIN 173

Query: 149 YMYWFSWAVTFALELSVVGQIVDYWTFAVPIA-AWISIFWVILTALNMFPVKFYGEIEFW 207
           + Y   W +T  LE+      V+YW         ++++FWV    +N+F VK YGE EF 
Sbjct: 174 FNYMLQWLITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFV 233

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPW-GDGLTSNGVEISKNKNTG 265
            A +KVV I+GF+I  + ++CG G  G     +YW +PG + GD                
Sbjct: 234 FAIIKVVTIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAFVGDTAGQ------------ 281

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           +F G+    I A+F++ G+E+VG+   E+ NPRK+VP A K+V +RI LFY+  L  IG+
Sbjct: 282 KFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGM 341

Query: 326 LVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           LVP++D +L           PF+IA+ N G + LP + N +ILI+++S GNS+IY+ SR 
Sbjct: 342 LVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRT 401

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L +LA+ G  PKI++   + G P V++   + FG++A++  +     VF+WL+ ++ ++ 
Sbjct: 402 LTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSS 461

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            ++W  I I HIRF + L  +G S D+LPF + +    +Y+ +F  V+++I Q +    P
Sbjct: 462 LFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFP 521

Query: 505 ---TFDVSDFFAAYIS--VILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRRDVEKI 555
              + +  DFF AY+S  ++L F I+   ++W K    WKL    ED+DID+ RR+V++ 
Sbjct: 522 AGASPNAKDFFMAYLSFPIVLAFYIF--HKIWKKN---WKLYIKAEDMDIDTGRREVDRD 576

Query: 556 IWE--------DPEPKTFWDKFWN 571
           + +        D   +  W + W 
Sbjct: 577 LLKQEVAAERADLAARPIWYRCWK 600

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  290 bits (743), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/532 (31%), Positives = 277/532 (52%), Gaps = 27/532 (5%)

Query: 57  VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQ 116
           +++  + + L  RH                   T L D GP   ++ ++ + T  + V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 117 SLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA 176
           SLGE+A   P+   F V+ +RF+ PS+G AV   Y   W V   LEL      + YW   
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 177 VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGP 235
           +   AW++IF+V +   NM  VK +GE EF ++ VK++AI+GF I  + +   G    G 
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           +GF+YW NPG +  G            N  +F G  +  + AAF++ G E++ ++A E+ 
Sbjct: 218 LGFKYWNNPGAFVGG-----------TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESK 266

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX--XXXXPFIIAIENS 353
           NPRK +P+A K+  + +   Y+  L  +G LVP++D +L            P +IAIEN 
Sbjct: 267 NPRKVIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENG 326

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
           G K LP + NAIILI I+S  NS +Y  SR + S+A  G  PK+LS+  KKG P  +++ 
Sbjct: 327 GIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIV 386

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
           T +FG+L+++  +     VF WL  ++ ++  + W+ I  S IRF + ++ +  S D+LP
Sbjct: 387 TLIFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELP 446

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQ 529
           + +      A+Y V  + ++I+   +T+  P      D   FF +++S+ +  + +   +
Sbjct: 447 YLSQTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHK 506

Query: 530 LWFKCRWIWKL--EDVDIDSNRR--DVEKIIWEDPEPK-----TFWDKFWNV 572
           L+F   W  ++  E++DIDS R+  D E +  E  E +     +F  KFW+V
Sbjct: 507 LYFARNWRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWHV 558

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  291 bits (746), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 175/583 (30%), Positives = 298/583 (51%), Gaps = 35/583 (6%)

Query: 7   SSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKREL 66
           +S  +P +    + T+ T S+  +      I+ T +   +  +E +N        + ++L
Sbjct: 43  TSSPIPEKSSDNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDINE------NLNKDL 96

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
             RH                     L   GP   +I ++ + T  + V  +LGE+A   P
Sbjct: 97  SIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYP 156

Query: 127 VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIF 186
           V   F V+ +RF+ PS+  A+   Y   W V   LEL      + YW   +   AW++IF
Sbjct: 157 VVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIF 216

Query: 187 WVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGPVGFRYWRNPG 245
           + ++   NM  VK +GE EF ++ VK++AI+GF I  + + C G    G +G  YW +PG
Sbjct: 217 YSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPG 276

Query: 246 PW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRA 304
            + GD            K   +F G  +  + AAF+Y G EL  ++A E+ +PRKT+P+A
Sbjct: 277 SFVGD------------KPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKA 324

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKILPDIF 362
            K+  + +   Y+  L  IG LVPFDDP+L            P +I+I+N+G K L  + 
Sbjct: 325 TKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLM 384

Query: 363 NAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAY 422
           NAIILI+I+S  NS +Y  SR + S+A  G  PK+LSR  K+G P  ++L+T  FG+L++
Sbjct: 385 NAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSF 444

Query: 423 METTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGL 482
           +  +     VF WL  ++ ++  + W+ I  SHIRF   +K +  + D+LP+ +      
Sbjct: 445 IAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIG 504

Query: 483 AYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFK-CRWI 537
           ++Y V  + ++++   +T+  P    T DV+ FF  Y+S+ +    +   +L+ +  + +
Sbjct: 505 SWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVL 564

Query: 538 WKLEDVDIDSNRRDVE------KIIWEDP--EPKTFWDKFWNV 572
            KLED+D+++ R+ ++      +I+ E      K+F  +FW+V
Sbjct: 565 VKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHV 607

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  291 bits (745), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 168/587 (28%), Positives = 293/587 (49%), Gaps = 42/587 (7%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTT--------------E 47
           +T  + +   P Q +  V +F    Q ++  +I      D SS                E
Sbjct: 33  ETSATPNTPAPSQFRRFVDSFKRAEQQNN-SEITSAASCDGSSENLDKDGKEVADLEVQE 91

Query: 48  DEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFV 107
           ++ +    +  + E+K+ +K RH                  +  L ++GP G LI Y  +
Sbjct: 92  NQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIM 151

Query: 108 GTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           GT  Y + Q+ GE+A ++  ++  F V+ S  + P+ G +V ++Y   W     LEL   
Sbjct: 152 GTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTA 211

Query: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226
              + YWT  V    ++ IF+V++  +N F  + Y E EF+    K++ ++GF I  + +
Sbjct: 212 SMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVI 271

Query: 227 -VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTE 285
              GAG  G +G RYW  PG +           + ++    F G   +++ AAF +  TE
Sbjct: 272 NTGGAGNDGYIGDRYWHTPGAF-----------AGDRPIDHFKGIMATMVTAAFAFGATE 320

Query: 286 LVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXX 344
            + +TA E +NPRK +P A KKV++RIL  ++GS+  +G LVP+D  +L           
Sbjct: 321 FIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKAS 380

Query: 345 PFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKK 404
           P+++A+   G K++P   NA+IL++++S GNS  Y  SR+L+SLA+ G APK      ++
Sbjct: 381 PYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDRE 440

Query: 405 GVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKF 464
           G P+ +++   VF ++++   +   + VF WL+ I+ ++  + W  I +SHIRF + +  
Sbjct: 441 GRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFV 500

Query: 465 RGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVIL 520
           +  S  ++ FKA      +YY  F +V+I+I Q + A  P      D   FF  Y+++ +
Sbjct: 501 QKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPI 560

Query: 521 FFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPE 561
             L +  +++W K    W L     ++D+D +R+  D E +  ED E
Sbjct: 561 LILFYVGYKIWKK---DWSLFIRANNIDLDKHRQIFDEELLKQEDEE 604

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  290 bits (742), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 181/561 (32%), Positives = 283/561 (50%), Gaps = 38/561 (6%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
           D+ ++ +N     DA+ST  +       SV +  + + L  RH                 
Sbjct: 47  DNGIEVVN-----DATSTVSN------ASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVN 95

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
               L   GP   +I ++ + T  + V  +LGEMA   PV   F V+ +RF+ PS+G AV
Sbjct: 96  SGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAV 155

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFW 207
              Y   W V   LEL      + YW   +   AW++IF+ ++   NM  VK +GE EF 
Sbjct: 156 NINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFV 215

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGR 266
           ++ VK++AI+GF I  + + CG G  G     +YW NPG +  G TS            +
Sbjct: 216 LSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSF-VGHTSGT----------K 264

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G  +  + AAF+Y G E+  ++A E+ +PR+T+P+A K+  + I   YI  L  IG L
Sbjct: 265 FKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCL 324

Query: 327 VPFDDPKLXXXXXX--XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           VP+D+P+L            P +IAIEN G K LP + NAIILI+IIS  NS +Y  SR 
Sbjct: 325 VPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRC 384

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           + ++A  G  P++L    KKG P  ++L T  FG+L+++  +     VF WL  ++ ++ 
Sbjct: 385 MVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLST 444

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            + W+ I ISHIRF Q +K +  S D+LP+ +      ++Y V  + +++I   +T+  P
Sbjct: 445 IFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFP 504

Query: 505 T----FDVSDFFAAYISVILFFLIWGAFQLWFKCRWI-WKLEDVDIDSNRRDVEKII--- 556
                 D   FF  Y+S  +    +   +L ++ + I   LED+DID+ RR V+  I   
Sbjct: 505 LGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQ 564

Query: 557 -----WEDPEPKTFWDKFWNV 572
                 E     +F+ +F +V
Sbjct: 565 EMKEEQEHLAKSSFFARFLHV 585

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  289 bits (740), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 168/575 (29%), Positives = 293/575 (50%), Gaps = 23/575 (4%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGS--VH 58
           +  + SS ++ P+  KS  +  S        + +N  ++ +     +D ++       V 
Sbjct: 12  LTEVSSSPKTTPQHSKSSYEPASRQDSTMIHRFVNSFKRAEQPPLKQDSDLEEDTDTIVT 71

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
           D ++K+ +K RH                  +  L  +GP   +IAY  V  +TY + Q+ 
Sbjct: 72  DTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAA 131

Query: 119 GEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           GEMA   P +  +F  + S F+S   G A  ++++  W     LEL      V YW  ++
Sbjct: 132 GEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSI 191

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPV 236
               ++ IF+V L  ++ F VK YGE EF     K++ + GF+I+ + + V GAG +G +
Sbjct: 192 NADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYI 251

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           G +YW +PG +           + + N GRF G    L+ A F+Y G EL  ++  E  N
Sbjct: 252 GAKYWHDPGAF-----------TSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQEN 300

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGT 355
           PR++ P A K+ ++RI++ Y+ ++  +G  VP +  +L           P+++A    G 
Sbjct: 301 PRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGV 360

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
           K++P I NA+ILI++IS GNS +Y   R++ +LA+ G APK +    ++G P  +++  +
Sbjct: 361 KVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCS 420

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
           VFGV+ ++  +   + VF+WL  I  +A  + W  I+ISHIRF Q +K +  S D++ +K
Sbjct: 421 VFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYK 480

Query: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLW 531
           +      +Y+ VF  +++ + Q + A  P          FF +Y++  +FF  +  + +W
Sbjct: 481 SPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIW 540

Query: 532 FKCRWIWK-LEDVDIDSNRR--DVEKIIWEDPEPK 563
            +   ++  LE VD+D +RR  D E +  ED E K
Sbjct: 541 KRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKK 575

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/553 (33%), Positives = 287/553 (51%), Gaps = 43/553 (7%)

Query: 41  DASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGS 100
           D  S  E+  M ++    D  +K+ +K RH                  +  L   GP   
Sbjct: 49  DEKSDLEEMSMEST----DRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGAL 104

Query: 101 LIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTF 159
           +I YI V  +TY + Q+ GEMA   P +  SF  + S F+S  +G A  +++   W    
Sbjct: 105 VIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVL 164

Query: 160 ALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGF 219
            LEL      + YW  ++    WI IF+V L  +++F VK YGE+EF     K++ I GF
Sbjct: 165 PLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGF 224

Query: 220 LIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAA 278
           +I+ + +   GAG  G +G +YW+NPG +           + + + GRF      L+ A 
Sbjct: 225 IIFSIVVNAGGAGTDGYIGAKYWKNPGSF-----------ASSTSAGRFKDVCYVLVTAY 273

Query: 279 FTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX 338
           F+Y GTEL  ++  E ANPR++ P+A K+ ++RIL+ Y+ ++  IG  VP D+ +L    
Sbjct: 274 FSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAG 333

Query: 339 -XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKI 397
                  P+++A    G K++P I NA+ILI + S GNS++Y   R+  SLA+ G APK 
Sbjct: 334 GSSTHASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKC 393

Query: 398 LSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIR 457
           L+   ++G P +++ A AV GV+A+   +   + VF WL  I A++  + W  IL+SHIR
Sbjct: 394 LAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIR 453

Query: 458 FMQVLKFRGISRDDLPFKA-----NLMPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVS 509
           F   +K +G   ++L +KA       M G      FC V++ I Q + A +P   T    
Sbjct: 454 FRMAMKVQGKDLNELGYKALTGVWGSMWGFG----FC-VLVFIAQFWVALSPPGGTISAE 508

Query: 510 DFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK--- 563
            FF +Y++  L+   + A+ LW +   ++ KLED+D+D++RR  D E +  ED E K   
Sbjct: 509 GFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKI 568

Query: 564 ---TFWDK---FW 570
              +FW K   FW
Sbjct: 569 RNSSFWIKMKYFW 581

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 171/551 (31%), Positives = 284/551 (51%), Gaps = 28/551 (5%)

Query: 20  QTFSTMSQDDDMKKINIIQQTDASSTTE---------DEEMLNSGSVHDAEVKRELKQRH 70
            +F T  + + +K+ N++ QT +S  T+         D  ML+   +  + + ++L  RH
Sbjct: 38  SSFITEKRSNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLSKEDIDGSNLNKDLNIRH 97

Query: 71  XXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSS 130
                                L   GP   +I ++ V T  + V  SLGE+A   PV   
Sbjct: 98  LLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGG 157

Query: 131 FTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVIL 190
           F+V+ +RF+ PSI  ++   Y   W V   LEL      + YW   +   AW+SIF+ ++
Sbjct: 158 FSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVI 217

Query: 191 TALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGPVGFRYWRNPGPWGD 249
             LNM  VK +GE EF ++ +K++AI+GF I  + + C G  V G +G +YW +PG +  
Sbjct: 218 GLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF-V 276

Query: 250 GLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVV 309
           G T+            +F G  +  + AAF+Y G E++ ++A E+ +PRKT+P A K+  
Sbjct: 277 GHTAG----------SQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTF 326

Query: 310 FRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKILPDIFNAIIL 367
           + I   Y+  L  IG LVP+DDP+L            P +IAIEN G K LP + NAIIL
Sbjct: 327 WLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIIL 386

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
           I ++S  NS +Y  SR + S+A  G  PK L R  KKG P  + L T  FG+++++  + 
Sbjct: 387 IAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASD 446

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
               VF WL  ++ ++  + W+ I ISHIRF + +  +G S +++P+ + +    ++Y  
Sbjct: 447 KQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGC 506

Query: 488 FCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLED 542
             + +++I   +T+  P      + + FF  Y+S+ +    +   + +FK  R      +
Sbjct: 507 IILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNE 566

Query: 543 VDIDSNRRDVE 553
           +D+DS +RD++
Sbjct: 567 IDLDSGKRDID 577

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  290 bits (742), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 175/565 (30%), Positives = 285/565 (50%), Gaps = 28/565 (4%)

Query: 14  QRKS----GVQTFSTMSQDDDMKKINIIQQTDASSTT-EDEEMLNSGSVHD--AEVKREL 66
           QR S    G++    +  D  +  +   QQ +   TT +DEE+L      D  AE+++ +
Sbjct: 104 QRSSPFSNGLEDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAELRQTI 163

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFI 125
           K RH                  + PL  +GP   +I Y  +GT  Y + Q+ GEMA  + 
Sbjct: 164 KPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYG 223

Query: 126 PVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISI 185
            +T SF  F S  + P    AV ++Y   W     LEL      + YWT  V    ++ I
Sbjct: 224 NLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVI 283

Query: 186 FWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGA-GVTGPVGFRYWRNP 244
           F+V++  +N F  K Y E EF     KV+ I GF I  +C+  GA G  G +G +YW +P
Sbjct: 284 FYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDP 343

Query: 245 GPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRA 304
           G +                  RF G  ++ + AAF +  TE + +TA E +NPRK +P A
Sbjct: 344 GAF-----------RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSA 392

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTKILPDIFN 363
            KK+++R+L+ ++ ++  IG LVP+D D  L          P+++AI   G ++     N
Sbjct: 393 AKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFVN 452

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
           A+ILI++IS GNS  Y  SR+L SLA+ G APKI     ++G P +++  +AV  V+A+ 
Sbjct: 453 AVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFC 512

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
            T+     VF WL+ I  ++  + W  I +SH+RF + +K +G S  ++ + +      +
Sbjct: 513 ATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGS 572

Query: 484 YYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIW 538
            YA   M++ +I Q + A  P    T D + FF+ Y+++ +  + +  +++W +  R   
Sbjct: 573 LYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFI 632

Query: 539 KLEDVDIDSNRR--DVEKIIWEDPE 561
           + +D+D+ S+R   D E +  ED E
Sbjct: 633 RAKDIDLISHRTIYDEELLRQEDEE 657

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  287 bits (735), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 159/500 (31%), Positives = 269/500 (53%), Gaps = 24/500 (4%)

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           +KR LK RH                     L   GP   ++A+I  G++ Y+V Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA- 180
              +PV+ S+  + SRF+ PS G A+ Y Y     VT  LE+      VDYW      A 
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV--TGPVGF 238
            ++++F+V +  +N   VK YGE EF  + +KV+AIVGF+I  + +VCG G   TG +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 239 RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           +YW NPG +  G                F G+    + +AF++ G+E+  + A E+ NPR
Sbjct: 264 KYWHNPGGFAHG----------------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPR 307

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKL-XXXXXXXXXXPFIIAIENSGTKI 357
           + +P+A K+V +RI LFY+ SL  IG LVP+ +  L           PF+IAI+ +G   
Sbjct: 308 RDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISG 367

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           LP + N +IL+ ++S GN+ ++  SR   SLA  G  PK  +   +KG P   ++ + VF
Sbjct: 368 LPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVF 427

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           G+L+++ +++    VF+W++ ++ +  F+ W  I + H+RF Q L+ +G S D+L FKA 
Sbjct: 428 GLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQ 487

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFFLIWGAFQLWFKC 534
                + Y +  + +++ FQ + A  P   +     FF  Y+S+ +  + +   +++ + 
Sbjct: 488 TGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN 547

Query: 535 -RWIWKLEDVDIDSNRRDVE 553
            R +   +++D+D+ RR+V+
Sbjct: 548 WRLVIPAKELDLDTGRREVD 567

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  287 bits (734), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 169/536 (31%), Positives = 272/536 (50%), Gaps = 24/536 (4%)

Query: 26  SQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXX 85
           S D  +    I   TD +S    E+ +N     +  + + L  RH               
Sbjct: 44  SLDSKVPHEKIQTTTDFASVISHEDDIN-----NVNLNKNLSIRHLLTLAVGGSIGVGLF 98

Query: 86  XXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGA 145
                 L   GP   +I +I + T  + V  +LGEMA   PV   F V+ +RF+ PS+G 
Sbjct: 99  VNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITRFIDPSVGF 158

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
           AV   Y   W V   LEL      + YW   +   AW++IF+ ++   NM  VK +GE E
Sbjct: 159 AVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETE 218

Query: 206 FWVAAVKVVAIVGFLIYCLCMVC-GAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNT 264
           F ++ +K++AI+GF I  + + C G    G +G +YW +PG +          +  N  T
Sbjct: 219 FVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF----------VGHNSGT 268

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
            +F G  +  + AAF+Y G E+  ++A E+ +PR T+P+A K+  + I   Y+  L  IG
Sbjct: 269 -KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIG 327

Query: 325 LLVPFDDPKLXXXXXX--XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382
            LVP+DDP+L            P +IAIEN G K LP + NAIILI+IIS  NS +Y  S
Sbjct: 328 CLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVANSAVYACS 387

Query: 383 RILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAI 442
           R + ++A  G  P+IL+R   KG P  +++ T  FG+L+++  +     VF WL  ++ +
Sbjct: 388 RCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGL 447

Query: 443 AGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAF 502
           +  + W+ I +SHIRF Q +  +  S D+LPF +      ++Y    + ++++   +T+ 
Sbjct: 448 STIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSL 507

Query: 503 TP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCR-WIWKLEDVDIDSNRRDVE 553
            P    + D   FF  Y+S  +    +   +L+ + R ++  L D+D+D+ RR V+
Sbjct: 508 FPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVD 563

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  286 bits (731), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 173/583 (29%), Positives = 288/583 (49%), Gaps = 45/583 (7%)

Query: 23  STMSQDDDMKKINI-IQQTDASSTTED-----------EEMLNSGSVHDA--EVKRELKQ 68
           S MS+  DM   NI +   +  +  +D           E  + SG+   +   +K  L+ 
Sbjct: 3   SDMSESSDMATTNISVYDKNDKNNIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHGLQS 62

Query: 69  RHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVT 128
           RH                  S+ L + GP   +I+YI + T+ Y +    GEM  ++P  
Sbjct: 63  RHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGN 122

Query: 129 SS-------FTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
                         S+++  S+G A  + Y++ + V  A E +    IV+YWT  +P A 
Sbjct: 123 DDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAV 182

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP----VG 237
            I +F  ++  LN  PVKFYGE EFW A +K+  I G +I    + CG          VG
Sbjct: 183 LIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVG 242

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAAN 296
           F YW+NP  + D +T        N + G FL  +N+LI  AF +  G ELV +T+ E  +
Sbjct: 243 FHYWKNPSSFRDYVT--------NGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVD 294

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX----XXPFIIAIEN 352
            R+ + +A ++ V+R++ FYI     I ++VP++DP L              PF+I I+N
Sbjct: 295 QRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQN 354

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
           +G  ILP I N  IL + +SAGN+ ++  +R L ++ K G AP+I SR  + GVP+V++ 
Sbjct: 355 AGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALS 414

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
            + +   LA++  +     VF W  NI+ I+GF  W    I+++RF + + + G+  D L
Sbjct: 415 LSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRL 473

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAFQL- 530
           PFK      L +Y+   + I+I+  G+    P F +  DF AAYI++ +F +++    + 
Sbjct: 474 PFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIY 533

Query: 531 ---WFKCRWIWKLEDVDIDSNRRDVE-KIIWEDPEPKTFWDKF 569
              W + +W   ++++D+ +   ++E K    D E +    +F
Sbjct: 534 SGRWRQRKWWKPVDEIDVVTGLEEIELKTKIADEERQGHSGRF 576

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  287 bits (735), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 167/574 (29%), Positives = 290/574 (50%), Gaps = 30/574 (5%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60
           +D+ + + Q   +Q        + ++    M  ++ +Q    +  T + +M       + 
Sbjct: 89  IDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQ----NKPTGNGQM----KFEEE 140

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            +K+ +K RH                  +  L ++GP G +I Y  +G+  Y + Q+ GE
Sbjct: 141 ALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGE 200

Query: 121 MAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           MA  +  +   F  + S  + P  G AV ++Y   W     LEL      + YWT  V  
Sbjct: 201 MAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNP 260

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGF 238
            A++ IF+V++  + +F  + Y E EF+    K++ I+GF I  + +   GAG  G +G 
Sbjct: 261 DAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGA 320

Query: 239 RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           +YW +PG +     +NG++        RF G   + ++AAF +  TE + +TA E +NPR
Sbjct: 321 KYWHDPGAF---RGTNGIQ--------RFKGIMATFVSAAFAFGATEFIALTAAEQSNPR 369

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGTKI 357
           K +P A KKV++R++  ++G++  +G LVP+D  +L           P+++AI   G ++
Sbjct: 370 KAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRV 429

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           +P   NA+ILI++ S  NS  Y  SR+L  LA+ G APK      ++G P+ ++   A+F
Sbjct: 430 VPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALF 489

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           GV+A+   +     VF WL+ I+ ++  + W+ I +SHIRF + +  +G S  ++ FKA 
Sbjct: 490 GVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQ 549

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
           L    +YYA   MV+ +I Q + A  P       D   FF  Y+++ +    +  ++LW 
Sbjct: 550 LGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWK 609

Query: 533 KC-RWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           +  R   + +D+D+DS R+  D E +  ED E K
Sbjct: 610 RDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYK 643

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  286 bits (732), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 159/531 (29%), Positives = 281/531 (52%), Gaps = 30/531 (5%)

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
           + ++K+ ++ RH                   T L  +GP G +I Y  + T  Y V Q++
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 119 GEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           GEMA  ++ +   F+ +    + P +  AV ++Y   W     LEL      + YWT  V
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 178 PIAAWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGP 235
               ++ IF++++  +N+F   + Y E EF+    K++ + GF I  + ++CG AG +G 
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 236 VGFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEA 294
           +G RYW +PG + GD    NG+         RF G  ++L+ AAF + GTE + ITA E 
Sbjct: 276 IGARYWHSPGAFRGD----NGIN--------RFKGIVSTLVTAAFAFGGTEFLAITASEQ 323

Query: 295 ANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXX-XXXXXPFIIAIENS 353
           ANPRK +P A KKV++R L+ Y+GS+  +G LVP++  +L           P++IA+ + 
Sbjct: 324 ANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASH 383

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
           G +++P   NA+ILI++ S  +S  Y  SR+L +LA+ G APKI +   K+G P +  + 
Sbjct: 384 GIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVV 443

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
            A+  ++++   +     VF+WL++I+ ++  + W  I +SHIRF + +K +G S D++ 
Sbjct: 444 GAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIG 503

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQ 529
           FK+      + YA   M++++I Q +    P    + D   FF AY+++ +F +++  ++
Sbjct: 504 FKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYK 563

Query: 530 LWFKC-RWIWKLEDVDIDSNR--------RDVEKIIWEDPEPKTFWDKFWN 571
           +W +  R   + +++D+ ++R        R   K + E       W K +N
Sbjct: 564 IWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYN 614

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  285 bits (729), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 177/589 (30%), Positives = 298/589 (50%), Gaps = 30/589 (5%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQT--------DASSTTEDEEML 52
           M  L+S++ S   +R S         +DD   +     +T        D +S  + E   
Sbjct: 21  MQELKSNTGSESVERISLPGDDYKFHEDDSKSRFRRFARTFHRADGLGDGASGNDVEFGA 80

Query: 53  NSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTY 112
                 + ++K+ +  RH                     L + GP G +I Y  +G+  Y
Sbjct: 81  EVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLY 140

Query: 113 AVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVD 171
            + Q+ GE+A ++  ++ +F  + S  +  + G +V ++Y   W     LEL      + 
Sbjct: 141 CIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIK 200

Query: 172 YWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-A 230
           YWT +V    +++IF+V++  +NMF  + Y E EF+    KV+ I+GF I  + + CG A
Sbjct: 201 YWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGA 260

Query: 231 GVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGIT 290
           G  G +G RYW NPG +              K    F G  ++++ AAF +  TE + +T
Sbjct: 261 GNDGYIGGRYWNNPGAF-----------YGTKPIHHFKGIISTMVTAAFAFGATEFIALT 309

Query: 291 AGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX-XXXXXXXPFIIA 349
           A E ANPR+ +P A KKVV+RILL ++  +  IG LVP + P+L           P++IA
Sbjct: 310 AAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIA 369

Query: 350 IENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWV 409
           + + G +++P   NA+IL++++S GNS  Y  SR+L +LA    AP  L    + G P  
Sbjct: 370 VASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMR 429

Query: 410 SVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISR 469
           ++L + VFG+++++  +   +TVF WL+ I+ ++  + W+ I +SHIRF + L  +G   
Sbjct: 430 AMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPI 489

Query: 470 DDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIW 525
            +L +K+      +YYA F M  I+I Q + A  P      D + FF  Y+++ LF +++
Sbjct: 490 GELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLY 549

Query: 526 GAFQLWFKC-RWIWKLEDVDIDSNRR--DVEKIIWEDPE-PKTFWDKFW 570
             F++W +  R    LE +D+DS+R+  D E +  ED E  +   +K W
Sbjct: 550 FGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  285 bits (728), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 281/528 (53%), Gaps = 32/528 (6%)

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           +K  LK RH                   T L   GP   LI +   GT+ Y++  +LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIA 180
           A   P++  FT +A+RF+  S G A  + Y   W V   LE+      V++W T      
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-R 239
            ++++FW+++  +NMF VK YGE EF  + +KV+ +VGF+I  + + CG G  G     +
Sbjct: 206 GFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGK 265

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           YW +PG +           + +    +F G  +  + +AF++ G+ELVG+ A E+ +PRK
Sbjct: 266 YWHDPGAF-----------AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRK 314

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKIL 358
           +VP+A K+V +RI LFYI SL  +GLLVP++DP L           PF+IAI+  G K L
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGL 374

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           P + N +ILI ++S GNS IY  SR + +LA+    P+I +   +KG P V +  T+ FG
Sbjct: 375 PTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFG 434

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
           ++A++  ++    VF+WL+ ++ ++  + W  I I HIRF + L  +G   D+L FK+  
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFFLIWGAFQLWFKCR 535
               +Y+ +F +VI+ I Q + A  P   +     FF AY+S  L   ++   +++ +  
Sbjct: 495 GVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRN- 553

Query: 536 WIWKL----EDVDIDSNRR--DVEKIIWEDPEPKTF------WDKFWN 571
             WKL    ED+DID+ RR  D+E +  E  E K        W + WN
Sbjct: 554 --WKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWN 599

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  285 bits (728), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 180/579 (31%), Positives = 291/579 (50%), Gaps = 39/579 (6%)

Query: 5   ESSSQSVPRQRKSG----VQTFSTMSQDDDMKKINIIQQTDASSTTEDE-EMLNSGSVHD 59
            SSS+    ++KSG    +  F+   +  +       Q  + +S  ED  E + S    D
Sbjct: 33  SSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITS----D 88

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
           +++K+ +K RH                  +  L   GP   +I YI V  +TY + Q+ G
Sbjct: 89  SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAG 148

Query: 120 EMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVP 178
           EMA   P + ++F  ++S F+S S G A  ++Y F W     LEL      + +W   + 
Sbjct: 149 EMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKIN 208

Query: 179 IAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVG 237
              +I IF+V L  ++ F VK YGE EF     K++ I GF+I  + + CG AG  G +G
Sbjct: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
             YW NPG +           + + + GRF      L+ A F++ G EL  ++  E +NP
Sbjct: 269 ATYWHNPGAF-----------AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNP 317

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGTK 356
           RK+ P A K+ ++RI++ Y+ ++  IG  VP++D +L           P+++A    G K
Sbjct: 318 RKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVK 377

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           I+P I NA+ILI+++S  NS++Y G R++ SLA+ G APK L    ++G P  +++   V
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
           FGV+A++  +   + VF WL  I  ++  + W  I++SH+RF Q +K +G S D+L +KA
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLW 531
                 + Y VF  +++ + Q + A  P       D   FF  Y++    F IW AF   
Sbjct: 498 TTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLA----FPIWLAFYFG 553

Query: 532 FKC-----RWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           +         +  L+ +D+D +RR  D E +  ED E K
Sbjct: 554 YMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  284 bits (726), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 175/591 (29%), Positives = 304/591 (51%), Gaps = 32/591 (5%)

Query: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEV 62
           T + + +S P   +  ++  +   Q    K    I  ++ SS  E+++        + ++
Sbjct: 14  TWDKADKSDPIISEVDIEANTITEQLTKDKHKETIDYSETSSLDEEKQQQPE---ENGKL 70

Query: 63  KRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA 122
           K+ LK RH                  S  L   GP G   +Y+ + T  Y +  + GEM 
Sbjct: 71  KQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMV 130

Query: 123 TFIPVTSSFTVFAS-----RFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA- 176
            ++P   S +  +S     +++  S+G A  + Y++ + +  A E +    +V+YW +A 
Sbjct: 131 CYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWAL 190

Query: 177 -VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235
            VP  AWI+IF   + ALNM PV FYGE EFW A++K++ I+G +I    +  G G +  
Sbjct: 191 KVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHD 250

Query: 236 -VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGE 293
            +GFRYW+ PG + D +T        +   G FL  +  +I   F +  G ELV +T+ E
Sbjct: 251 RLGFRYWQRPGAFADHIT--------DGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSE 302

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX----XXPFIIA 349
             + R+ + +A ++ V+R+++FY+     I ++V ++DP L              PF+I 
Sbjct: 303 CHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIG 362

Query: 350 IENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWV 409
           I+N+G K+LP I N  I+ +  SAGN+ ++  SR L ++A  G APK  S+  + GVP+V
Sbjct: 363 IQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYV 422

Query: 410 SVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISR 469
           +V  + +F  LAY+  +     VF+W  NI+ I+GF  W+   +++IRF + + F  +  
Sbjct: 423 AVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-Y 481

Query: 470 DDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF-DVSDFFAAYISVILFFLIWGAF 528
           D LP+K      L +Y++F + +I +  G+  F P F D  DF AAYI++ +F ++W   
Sbjct: 482 DRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGH 541

Query: 529 QLWFKC--RWIWKLEDVDIDSNRRDVEKIIWEDPE----PKTFWDKFWNVV 573
           +L  +   +W   ++ +D+ +   ++E++  E  E    P   WDKF + +
Sbjct: 542 KLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKFLDAL 592

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  284 bits (726), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/526 (31%), Positives = 290/526 (55%), Gaps = 14/526 (2%)

Query: 37  IQQTDASSTTEDEEM-LNSGSVHDA-EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLED 94
           ++ T +S+  E + +  N    H+   +K++L+ RH                   + L  
Sbjct: 32  LRHTHSSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMR 91

Query: 95  SGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFS 154
           +GP   LIAY  +G + + V   LGEMA +IP+   FT +A+R+  P++G AVG+ Y F 
Sbjct: 92  AGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFK 150

Query: 155 WAVTFALELSVVGQIVDYWTFAVPIA--AWISIFWVILTALNMFPVKFYGEIEFWVAAVK 212
           + V    +L+    ++ +W  A  ++   WI++   ++  +N   V+F+GE EFW+++ K
Sbjct: 151 YLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFK 210

Query: 213 VVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWF 271
           V+ ++  +I  L +  G G T   +GFRYW +PG + +    +  +       G+F+ + 
Sbjct: 211 VLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKE---YSKKDTHIKGGLGKFVAFL 267

Query: 272 NSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDD 331
           +  + A F Y GTEL GI A E  +PR+ VPRAIK  ++RI++FY+ ++F +G+ V ++D
Sbjct: 268 SVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYND 327

Query: 332 PKLXXXXXXXXXX---PFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSL 388
           P L             P+++AIEN+   +LP++FNA +L  + SA NS++YVGSR L+ L
Sbjct: 328 PLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGL 387

Query: 389 AKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAW 448
           A  G APK+ +RT K GVP+ ++    +F  LAYM  ++  +T F + VN+T+I G  +W
Sbjct: 388 AIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSW 447

Query: 449 LFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFD 507
           + ILI++I F +  + +GI +  L + A   P   + A+   + + + + F AF     D
Sbjct: 448 VSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVD 507

Query: 508 VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVE 553
           V  F   YI + ++   +  +++  K +WI   ++VD+ + +  ++
Sbjct: 508 VPTFITGYIGLPIYIFCFIGYKIVHKTKWI-PSKEVDLFTFKEAID 552

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 177/588 (30%), Positives = 295/588 (50%), Gaps = 34/588 (5%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60
           MDT +    S+    +S  +   T S +  +K +   ++ D +   + E+ + +    D+
Sbjct: 8   MDTKQQDLSSLSEVGQSFAKE-ETWSVEKQLKPL--AEEKDYADMNDVEKAIYN--TKDS 62

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           ++ ++L  RH                     L   GP   +IA+  + T  + +  SLGE
Sbjct: 63  KLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGE 122

Query: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
           ++   PV   F V+ +RF+ PS G AV + Y   WA+   LEL      + YW  ++   
Sbjct: 123 LSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPD 182

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGPVGFR 239
           AW+SIF+V +   NM  VK +GE EF ++ VK++AI+GF I  + ++C G    G +G +
Sbjct: 183 AWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGK 242

Query: 240 YWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           YW +PG + GD                RF G     I AAF+Y G ELVG++A E+ NPR
Sbjct: 243 YWNDPGAFVGD------------TPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPR 290

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTK 356
            T+P+A K+  + I + Y+  L  IG LVP +DP L            P +IAI+N G K
Sbjct: 291 VTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIK 350

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
            LP + NAIILI ++S  NS +Y  SR + S+A+ G  P+ L+   KKG P  ++  T +
Sbjct: 351 GLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLL 410

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
            G+L+++  +     VF WL  ++ ++  + W  I ++H+RF   +K +  S ++LP+ +
Sbjct: 411 VGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVS 470

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWF 532
                 ++Y    + +++I   +T+  P      D + FF +Y+S+ +F   +   ++W 
Sbjct: 471 MTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWK 530

Query: 533 K-CRWIWKLEDVDIDSNRRDVEKIIWEDPEP--------KTFWDKFWN 571
           +  R   KL +VD+DS R D +    +  +         K F+ + WN
Sbjct: 531 RNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWN 578

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 185/561 (32%), Positives = 290/561 (51%), Gaps = 36/561 (6%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K++  I+     S  E   ++ +       +K  LK RH                  
Sbjct: 57  DSFKRVKPIEVDPNLSEAEKVAIITA----QTPLKHHLKNRHLQMIAIGGAIGTGLLVGS 112

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
            T L   GP   LI +   GT+ YA+  +LGE+A   P++  FT +A+RF+  S G A  
Sbjct: 113 GTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANN 172

Query: 149 YMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFW 207
           + Y   W V   LE+      V++W T       ++++FW+ +  +NMF VK YGE EF 
Sbjct: 173 FNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFV 232

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGR 266
            + +KV+ +VGF+I  + + CG G TG     +YW +PG +           + +    +
Sbjct: 233 FSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----------AGDTPGAK 281

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G  +  + AAF++ G+ELVG+ A E+  PRK+VP+A K+V +RI LFYI SL  IGLL
Sbjct: 282 FKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLL 341

Query: 327 VPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRIL 385
           VP++D  L           PF+IAI+  G K LP + N +ILI ++S GNS IY  SR +
Sbjct: 342 VPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTM 401

Query: 386 FSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
            +LA+    P+I S   +KG P V +  T+ FG++A++  ++    VF+WL+ ++ ++  
Sbjct: 402 VALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSL 461

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT 505
           + W  I I HIRF + L  +G   D+L FK+      +Y+ +F ++I+ I Q + A  P 
Sbjct: 462 FTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPV 521

Query: 506 FD---VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKII 556
            D      FF AY+S  L  +++   +++ +    WKL    E +DID+ RR  D++ + 
Sbjct: 522 GDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRN---WKLFIPAEKMDIDTGRREVDLDLLK 578

Query: 557 WEDPEPKTF------WDKFWN 571
            E  E K        W + WN
Sbjct: 579 QEIAEEKAIMATKPRWYRIWN 599

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  283 bits (724), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 174/576 (30%), Positives = 287/576 (49%), Gaps = 34/576 (5%)

Query: 13  RQRKSGVQTF--STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRH 70
            Q+     TF  ST       +  N I  ++ S   +D E ++   +++  + ++L  RH
Sbjct: 38  EQKSQTDSTFPLSTKGSPGMKQTTNDITSSERSRDNDDVEQVD---INNTNLNKDLSVRH 94

Query: 71  XXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSS 130
                              T L   GP   +I ++ +GT  + V  SLGE++   PV   
Sbjct: 95  LLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGG 154

Query: 131 FTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVIL 190
           F V+  RF+ PS   AV   Y   W V   LEL      + YW   +   AW++IF+  +
Sbjct: 155 FNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATI 214

Query: 191 TALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGPVGFRYWRNPGPWGD 249
              NM  VK +GE EF ++ +K+++I+GF I  + + C G    G +G +YWRNPG +  
Sbjct: 215 ALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF-- 272

Query: 250 GLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVV 309
                   +  N  T +F G  +  + AAF+Y G E+  ++A E+ NPR+T+P+A K+  
Sbjct: 273 --------VGHNSGT-KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTF 323

Query: 310 FRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKILPDIFNAIIL 367
           + I   Y+  L  IG LVP +DP+L            P +IAIEN   K LP + NAIIL
Sbjct: 324 WLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIIL 383

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
           I ++S  NS +Y  SR + ++A  G  PK L+R  K+G P  ++L T  FG+L+++  + 
Sbjct: 384 IAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASN 443

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
               VF WL  ++ ++  + W+ I +SHIRF + +K +  S D+LPF +      ++Y  
Sbjct: 444 KEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYGF 503

Query: 488 FCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWFKCRW--IWKLE 541
             + +++I   +T+  P          FF  Y+S  +  + +   +++ +  W  + K+E
Sbjct: 504 VVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTR-NWTLMVKIE 562

Query: 542 DVDIDSNRRDVE--------KIIWEDPEPKTFWDKF 569
           D+D+D+ R+ V+        KI  E+   K+F  +F
Sbjct: 563 DIDLDTGRKQVDLTLRREEMKIERENLAKKSFITRF 598

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  285 bits (728), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 172/574 (29%), Positives = 285/574 (49%), Gaps = 27/574 (4%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDM--KKINII---QQTDASSTTEDEEMLNSGSVHD 59
           E+ + S     ++ V+ +S    D+D+  KK N+     + D ++   D + +      +
Sbjct: 89  ETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD-EN 147

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
           A++K+ +K RH                   TPL  +GP   +I Y  +GT  Y + Q+ G
Sbjct: 148 AQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACG 207

Query: 120 EMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVP 178
           E+A  +  V  SF  F S  + P    AV ++Y   W     LEL      + YWT  V 
Sbjct: 208 ELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD 267

Query: 179 IAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGA-GVTGPVG 237
              ++ IF+V++  +N F  K Y E EF+    KV+ ++GF I  +C+  GA G  G +G
Sbjct: 268 PDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            +YW +PG +                  RF G  ++ + AAF +  TE + +TA E +NP
Sbjct: 328 AKYWNDPGAF-----------RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 376

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTK 356
           RK +P A KKV +RILL ++ S+  IG LVP++ D  +          P+++A    G  
Sbjct: 377 RKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           ++    NA+IL++++S  NS  Y  SR+L  LA+ G APK      + G P  S+L  A+
Sbjct: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAI 496

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
             V+A+  T+     VF WL+ I+ ++  + W  I +SHIRF + ++ +G S  +L F+A
Sbjct: 497 IAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
                 +YYA   + + ++ Q + A  P    T D  +FF  Y+++ +   ++  F+LW 
Sbjct: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616

Query: 533 K-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           +  R   + +++D+ S+R   D E +  ED E K
Sbjct: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  285 bits (728), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 170/585 (29%), Positives = 296/585 (50%), Gaps = 37/585 (6%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTED--EEMLNSGSVHDAEV 62
           E S  + P    S     + +S +D   +++       S  TE   ++       +   +
Sbjct: 84  EGSHPNSPDSSNSIGGGATPISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQNQENL 143

Query: 63  KRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA 122
           K+ +K RH                  S  L ++GP G +I Y  +G+  Y + Q+ GE+A
Sbjct: 144 KKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELA 203

Query: 123 T-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
             +  +   F  + S  + P++G +V ++Y   W     LEL      + YWT  V    
Sbjct: 204 VIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDV 263

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRY 240
           ++ IF+V++  +N+F  K Y E +F+    K++ I+GF I  + + CG AG  G +G RY
Sbjct: 264 FVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRY 323

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTG--RFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           W NPG +               NTG  RF G   + + AAF +  +E + +TA E +NPR
Sbjct: 324 WHNPGAF-------------RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPR 370

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPF-DDPKLXXXXXXXXXXPFIIAIENSGTKI 357
           K +P A KK+++RIL  ++GSL  +G LVP+  D  L          P++IA+ + G ++
Sbjct: 371 KAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRV 430

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           +P   NA+IL++++S  N   Y  SRIL SLAK G APK      ++G P V++L +++F
Sbjct: 431 VPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIF 490

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           G++A+  ++   + VF WL+ I+ ++  + W+ I +SHIRF + +K +G S  ++ +K+ 
Sbjct: 491 GIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 550

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
           +    + YA+  MV+ +I Q + A +P           FF  Y+++ +   ++  +++W 
Sbjct: 551 VGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWK 610

Query: 533 KCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPKTFWDKFWN 571
           K    W L    + +D+ ++R+  D E +  ED E   + +K  N
Sbjct: 611 K---DWTLFIPADKIDLVTDRQIFDEELLKQEDEE---YQEKLRN 649

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  283 bits (723), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 173/557 (31%), Positives = 276/557 (49%), Gaps = 26/557 (4%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61
           D  E SS + P +        S+   DD +K        D  +T E    +    +++  
Sbjct: 35  DNFELSSVNSPVR-----VNVSSSGNDDILKGDTKEYPRDVKATPEAASYVED--INNTN 87

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           + ++L  RH                     L   GP   +I ++ V T  + V  SLGE+
Sbjct: 88  LNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGEL 147

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
           A   PV   F V+ +RF+ PS   A+   Y   W V   LEL      + YW   +   A
Sbjct: 148 AAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDA 207

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RY 240
           W++IF+  +   NM  VK +GE EF ++ VK++AI+GF I  + + CG G  G     +Y
Sbjct: 208 WVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKY 267

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           W NPG +             +    +F G  +  + AAF+Y G E+  ++A E+ NP++T
Sbjct: 268 WHNPGAF-----------VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKIL 358
           +P+A K+  + I + Y+G L  IG LVP++DP+L            P +IAIEN G K L
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGL 376

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           P + NAIILI I+S  NS +Y  SR + S+A  G  PK LS+  K+G P  ++L T  FG
Sbjct: 377 PSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFG 436

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
           +L+++  +   + VF WL  ++ ++  + W+ I +S IRF   +K +G S D++PF +  
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQS 496

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKC 534
               A+Y V  + ++++   +T+  P    T     FF  Y+S+ +    +   +LW + 
Sbjct: 497 GTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRD 556

Query: 535 -RWIWKLEDVDIDSNRR 550
            R +  L ++D+DS RR
Sbjct: 557 WRLLVPLMEMDLDSGRR 573

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  284 bits (726), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 177/596 (29%), Positives = 300/596 (50%), Gaps = 40/596 (6%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFST-MSQDDDMKKINIIQQTDASSTTED--EEMLNSGSV 57
           +D+   +  S P    S     ST +S  D   +++      +S  T D  ++       
Sbjct: 81  IDSFRRAEGSHPNSPDSTNLNGSTPISTKDSSSRLDNELNPKSSYITVDGIKQSSQEQEP 140

Query: 58  HDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117
               +K+ +K RH                  S  L ++GP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 118 LGEMAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA 176
            GE+A  +  +   F  + S  + P++G +V +++   W     LEL      + YWT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 177 VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGP 235
           V    ++ IF+V++  +N+F  K Y E +F+    K++ I GF I  + + CG AG  G 
Sbjct: 261 VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGY 320

Query: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           +G RYWR+PG +  G TS            RF G   + + AAF +  +E + +TA E +
Sbjct: 321 IGSRYWRDPGAF-RGDTS----------IQRFKGVVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPF-DDPKLXXXXXXXXXXPFIIAIENSG 354
           NPRK +P A KK+++RIL  ++ SL  +G LVP+  D  L          P++IA+ + G
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHG 429

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            +++P   NA+IL++++S  NS  Y  SRIL SLAK G APK      ++G P V+++ +
Sbjct: 430 VRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVS 489

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           AVFGV+A+  +++  + VF WL+ I+ ++  + W+ I +SHIRF + +K +G S  ++ +
Sbjct: 490 AVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGY 549

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQ 529
           K+ +    + YAV  MV+ +I Q + A +P           FF  Y+++ +   ++  ++
Sbjct: 550 KSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYK 609

Query: 530 LWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPKT------FWDK---FW 570
           +W   +  W L    + +D+ S+R   D E +  ED E K       FW +   FW
Sbjct: 610 VW---KRDWSLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFW 662

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  282 bits (721), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 158/550 (28%), Positives = 284/550 (51%), Gaps = 29/550 (5%)

Query: 39  QTDASSTTEDEEMLNSGSVHDAEVKRELKQ--------RHXXXXXXXXXXXXXXXXXXST 90
           +TD +     + + +   V  ++V  EL +        RH                   T
Sbjct: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGT 127

Query: 91  PLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGY 149
            L  +GP G +I Y  + +  Y + Q++GEMA  ++ +   F  +    + P++  ++ +
Sbjct: 128 TLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187

Query: 150 MYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFP-VKFYGEIEFWV 208
           +Y   W     LEL      + YWT  V    ++ IF++++ A+N+F   + Y E EF  
Sbjct: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247

Query: 209 AAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRF 267
            + K++ ++GF I  + ++CG AG  G +G +YWR+PG +             +    RF
Sbjct: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----------RGSDGPNRF 296

Query: 268 LGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLV 327
            G  ++L+ AAF++  TE + ITA E +NPRK +P A KKV++R LL Y+ S+  +GLLV
Sbjct: 297 KGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356

Query: 328 PFDDPKLX-XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILF 386
           P+D  +L           P+++A+   G +++P   NA+ILI++ S  +S  Y  SR+L 
Sbjct: 357 PYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLL 416

Query: 387 SLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFW 446
           +LA+ G APK+ +   + G P +  L  AV  V+A+   +     VF+WL+ I+ ++  +
Sbjct: 417 TLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVF 476

Query: 447 AWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-- 504
            W  I +SHIRF + +K +G S D++ +K+ +    + YA   M++I+I Q +    P  
Sbjct: 477 TWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG 536

Query: 505 --TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVEKIIWEDPE 561
             + DV  FF  Y+++ +F +++  +++W +  R   + +D+D+ S+R   +  I    E
Sbjct: 537 EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQ-E 595

Query: 562 PKTFWDKFWN 571
            + + +K  N
Sbjct: 596 REEYQEKLRN 605

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  280 bits (716), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 167/528 (31%), Positives = 274/528 (51%), Gaps = 23/528 (4%)

Query: 49  EEMLNSGSVHD--AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           +E +  G +H+   ++K+ LK RH                     L+ +GPVG LIAY+ 
Sbjct: 31  DETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVL 90

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFAL----E 162
           VG +      ++ E+A+F+P T +    + +F+  ++G      + F W  T++     E
Sbjct: 91  VGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPGE 144

Query: 163 LSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222
           LS    ++ YWT   P A +I+IF V+    N++ ++FYGEIE++   +K+  I   +I 
Sbjct: 145 LSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIIT 203

Query: 223 CLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282
            L +  G      +GF YWRNPGP+ + L           +TG+F+G++ +L +  ++Y 
Sbjct: 204 GLVIDLGGTKQERLGFHYWRNPGPFAEYLVGG--------DTGKFVGFWAALSSVVYSYS 255

Query: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX 342
           G + + I AGE  N R  +    K V  RI+L Y+ ++F + L+VP++D  +        
Sbjct: 256 GIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNAR 315

Query: 343 XXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTT 402
             PF+IA+E +G K+LP I NA+IL +  SAGN  I  GSR LF LA    APKI  +T+
Sbjct: 316 SSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTS 375

Query: 403 KKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVL 462
           K+G+PWV VL  + F  LAYM  ++   TVF W   + +      W+ I  +HI   + L
Sbjct: 376 KRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRAL 435

Query: 463 KFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILF 521
           + +G SR DLP+   + P  A+++     I ++  GF  F    FD+  FF+ Y  + L 
Sbjct: 436 RAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLA 495

Query: 522 FLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKF 569
             ++  ++L+ K R++ +  +VD+ S   D+ +     PE    W + 
Sbjct: 496 IALFTFWKLFKKTRYL-RPHEVDLQSIFEDIRENPEYIPETTPLWKRL 542

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 178/563 (31%), Positives = 286/563 (50%), Gaps = 39/563 (6%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
           D DM+    +        T+ E  +   + + +++ + L  RH                 
Sbjct: 79  DSDME----VDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVN 134

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
               L   GP   LIA+  + T  + +  SLGE+A+  PV   F V+ +RF+ PS G AV
Sbjct: 135 SGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAV 194

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFW 207
              Y   WAV   LEL+     + YW   +   AW++IF+V +   NM  VK +GE EF 
Sbjct: 195 NISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFV 254

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPW-GDGLTSNGVEISKNKNTG 265
           ++ VK++AI GF I    ++CG G  G     +YW +PG + GD                
Sbjct: 255 LSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGD------------TPGA 302

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           +F G  +  + AAF+Y GTELVG++A E+ NPR T+PRA K+  + I   Y+  L   G 
Sbjct: 303 QFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGC 362

Query: 326 LVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSR 383
           LVP +DP+L            P +IAIEN G + +P + NAIILI IIS  NS++Y  SR
Sbjct: 363 LVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSR 422

Query: 384 ILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIA 443
            + S+A+ G  PK+ +   +KG P V++LAT VFG+L+++  +   + +F WL  ++ ++
Sbjct: 423 CMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLS 482

Query: 444 GFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT 503
             + W  I ISHIRF + +  +  S D+LP+ +      ++Y    ++ +++   +T+  
Sbjct: 483 TLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLF 542

Query: 504 PTF----DVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVE 553
           P          FF  Y+S  +F + + + +L+   +  W+L      +D+DS RR  D+E
Sbjct: 543 PPGSSGPSAESFFEGYLSFPIFLICYISHKLY---KRDWRLFIPAGQIDVDSGRRALDIE 599

Query: 554 KI----IWEDPE--PKTFWDKFW 570
           ++    + E  E   K F+ ++W
Sbjct: 600 ELKEQKLREQAETAKKPFYVRWW 622

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 168/500 (33%), Positives = 269/500 (53%), Gaps = 17/500 (3%)

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
           ++ ++  LK RH                   T L  +GP G LI +   GT+ Y++  +L
Sbjct: 78  NSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAL 137

Query: 119 GEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAV 177
           GE+A   PV+  FT +A+RF+  S G A    Y   W V   LE+      V+YW T   
Sbjct: 138 GELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPR 197

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG-VTGPV 236
               ++++FW+ +  +N+F VK YGE EF  + +KV+ +VGF+I  + + CG G V G +
Sbjct: 198 YRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYI 257

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           G RYW +P          G  +  +    RF G  +  + AAF++ G+ELVG+ + E AN
Sbjct: 258 GGRYWHHP---------YGAFVGDSAGA-RFKGVCSVFVTAAFSFAGSELVGLASAETAN 307

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGT 355
           PRK+VP+A K+V +RI LFY+ +L  +GLLVP+ + +L           PF+IAI   G 
Sbjct: 308 PRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGI 367

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
           + LP + N +ILI ++S GNS IY  SR L +LA+    PK      + G P  S+L T+
Sbjct: 368 RGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTS 427

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
            FG++A++  ++    VF+WL+ ++ ++  + W  I + HIRF + L  +G   D+L F 
Sbjct: 428 GFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFV 487

Query: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF---DVSDFFAAYISVILFFLIWGAFQLWF 532
           +      +Y+ +F ++++ I Q + A  P     +   FF AY+S  +    +   +++ 
Sbjct: 488 SPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYK 547

Query: 533 KCRWIW-KLEDVDIDSNRRD 551
           K   I+ K ED+DID+ R+D
Sbjct: 548 KNWKIFIKAEDMDIDTGRKD 567

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 179/569 (31%), Positives = 287/569 (50%), Gaps = 50/569 (8%)

Query: 9   QSVPRQRKSGVQTFSTMSQDDD---------MKKINIIQQT-DASSTTEDEEMLNSGSVH 58
           +++   + S  +TF+  S+DDD             NI Q+  D+     D      GS H
Sbjct: 28  KALDSYKSSSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCIDSFKPPLD------GSFH 81

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
              +KR LK RH                     L   GP+  +I +   GT        L
Sbjct: 82  THNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGL 141

Query: 119 GEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVP 178
           GE+    PV  +F  +++RFL PSI   +  +Y   W     LE+      + YW  ++ 
Sbjct: 142 GEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSID 201

Query: 179 IAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VG 237
              W++IF+ ++ ++N+F  + +GE EF  +++KV+ I+GF+I C+ ++CG G     VG
Sbjct: 202 PVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVG 261

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            RYW +PG    G                F G  + L+ A+++  GTE+V + +GE  NP
Sbjct: 262 ARYWHDPGCLSHG----------------FPGVLSVLVVASYSLGGTEMVCLASGET-NP 304

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKI 357
           R+ +P AIK+  +RIL F++ SL  IG LVP+ +P L          PF+IAI+    K 
Sbjct: 305 RE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS-PFVIAIKLHHIKA 362

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           LP I NA+ILI+I+S GNS I+  SR L S+A  GL PK      + G P   +L  ++F
Sbjct: 363 LPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLF 422

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           G+LA++  +     VFDWL+ I  +A    WL I ISHIRF   +K +G S D+L F + 
Sbjct: 423 GLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSA 482

Query: 478 L-MPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSD-------FFAAYISVILFFLIWGAFQ 529
           + M G AY A+    +I+I Q + A  P     D       FF +Y+  ++   ++   +
Sbjct: 483 VGMWGSAYSALI-NSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHK 541

Query: 530 LWFK---CRW--IWKLEDVDIDSNRRDVE 553
           ++++    +W  I  L+ +D++++R++++
Sbjct: 542 VFYRYKTGKWWAIMDLDKIDLETDRKNID 570

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 159/513 (30%), Positives = 269/513 (52%), Gaps = 23/513 (4%)

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            +K+ +K RH                   T L D GP GS I ++ +G   Y V Q+ GE
Sbjct: 89  NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGE 148

Query: 121 MA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TFAV 177
           +A  +  +   F  + S  + P++G A  ++Y   W   F LEL      + +W  + +V
Sbjct: 149 LAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSV 208

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGA-GVTGPV 236
               +++IF+V++  +N F  + Y E EF+  + KV+ ++GF I  + +  GA G +G +
Sbjct: 209 NPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYI 268

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           G +YWR+PG  G              +   F G   +L+NAAF+   +E V +TA E AN
Sbjct: 269 GGKYWRDPGSLGG-----------RTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQAN 317

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGT 355
           PRK++P A KK++++I + ++GS+  IG LVP D  +L           P++IA+   G 
Sbjct: 318 PRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGV 377

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
            ++P   NA+IL++++S GNS  Y  SR+L SLA+   APKI     + G P ++++ + 
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
           +FG + ++  +   + VF WL+ I+ ++  + W  I +SHIRF + L  +G S D+L FK
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF----DVSDFFAAYISVILFFLIWGAFQLW 531
           A      +Y +   MV+ +I Q + +  P      D   FF  Y+++ +F L +  +++W
Sbjct: 498 AQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 532 FKC-RWIWKLEDVDIDSNRR--DVEKIIWEDPE 561
            K  R   + + +D+ S+RR  D + +  ED E
Sbjct: 558 NKDWRLFIRADQIDLVSHRRIFDADVLKQEDIE 590

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  280 bits (717), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 170/538 (31%), Positives = 277/538 (51%), Gaps = 24/538 (4%)

Query: 39  QTDASSTTEDEEMLNSGSVH-DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
            +D    ++D E  +  SV  +++ K+ +K RH                     L   GP
Sbjct: 58  NSDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGP 117

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWA 156
            G LI Y  V  + Y + Q+ GEMA   P +  +F V++S F+S S G A  ++Y   W 
Sbjct: 118 AGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWL 177

Query: 157 VTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAI 216
               LEL      + YW  ++   A+I+IF+ ++  ++ F    YGE EF  +  KV  I
Sbjct: 178 TVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMI 237

Query: 217 VGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLI 275
            GF+I  + + CG   TG      YWRNPG +  G              G F G    L+
Sbjct: 238 AGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----------SPIGHFKGIAYVLV 286

Query: 276 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX 335
            A F+Y G EL  +T  E ANPRK VP A KK ++RIL+ Y+ ++  IG LVP++  +L 
Sbjct: 287 TAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELM 346

Query: 336 XXX--XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGL 393
                      P++IA+ + G K++P I NA+ILI+++S GNS +Y   R+L SLA+ G 
Sbjct: 347 GSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGY 406

Query: 394 APKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILI 453
           APKI S   + G P V+++  ++FG+L+++  +   + VF WL  I  ++  + W  I +
Sbjct: 407 APKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICL 466

Query: 454 SHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDV 508
           SH+RF   +K++G S  +L +K+      + YA+F  +I+ + Q + A  P       D 
Sbjct: 467 SHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADA 526

Query: 509 SDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVEKII--WEDPEPK 563
             FF +Y++  ++   +  ++++ K  + +  L+++D++S+R   +K I   ED E K
Sbjct: 527 EAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHK 584

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  280 bits (716), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 182/582 (31%), Positives = 293/582 (50%), Gaps = 37/582 (6%)

Query: 7   SSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKREL 66
           SS  V     +    F+  S+D  ++  NI   + +S T ED          +  + ++L
Sbjct: 33  SSSQVHSFTSNTPSPFNEKSKDSPIED-NIDITSQSSVTKEDI---------NKSLNKDL 82

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
             RH                     L   GP   +I ++ + T  + V  SLGE+A   P
Sbjct: 83  SIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFP 142

Query: 127 VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIF 186
           V   F V+ +RF+ PS   AV   Y   W V   LEL      + YW   +   AW++IF
Sbjct: 143 VVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIF 202

Query: 187 WVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGPVGFRYWRNPG 245
           + ++T  NM  VK +GE EF ++ VK++AI+GF I  + + C G    G +G +YW NPG
Sbjct: 203 YTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPG 262

Query: 246 PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 305
            +  G TS            +F G  +  + AAF+Y G E+  ++A E+ +PRKT+P+A 
Sbjct: 263 AF-VGHTSG----------TKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAA 311

Query: 306 KKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX--XXXXPFIIAIENSGTKILPDIFN 363
           K+  + I   Y+  L  +G LVP+DDP+L            P +IAIEN G K L  + N
Sbjct: 312 KRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMN 371

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
           AIILI+IIS  NS +Y  SR + S+A  G  PK L +  K+G P  + L T  FG+L+++
Sbjct: 372 AIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFI 431

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
             +     VF WL  ++ ++  + W+ I ISHIRF Q +  +  S D++P+ +      +
Sbjct: 432 AASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGS 491

Query: 484 YYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIW 538
            Y V  + ++++   +T+  P    + DV  FF  Y+S+ +  + +   +L+FK   W+ 
Sbjct: 492 LYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVV 551

Query: 539 KLEDVDIDSNRRDVE------KIIWEDP--EPKTFWDKFWNV 572
            LE++D+D+ R+ ++      ++I E+      +F  +FW+V
Sbjct: 552 TLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHV 593

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  279 bits (714), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 172/537 (32%), Positives = 280/537 (52%), Gaps = 26/537 (4%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
           + T  S   ED E+    S    ++++ ++ RH                  +  L   GP
Sbjct: 42  EDTSRSGDLEDGEI---NSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGP 98

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWA 156
            G LI Y+ V  ++Y +  + GEMA   P +  +F  ++S F+S   G A  +++   W 
Sbjct: 99  AGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWL 158

Query: 157 VTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAI 216
             F LEL     ++ YW  +V    ++ IF++ +  ++ F  + YGE EF     KV+ I
Sbjct: 159 TVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMI 218

Query: 217 VGFLIYCLCMVCGA-GVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLI 275
           VGF+I  + +  GA G TG +G RYWRNPG +      +G  + K K T   L      +
Sbjct: 219 VGFVIVGILINVGAIGDTGYIGDRYWRNPGSF-----VSGTPLDKLKGTAYVL------V 267

Query: 276 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX 335
            A F++ G EL  ++  E  NP+  +P A KK V+RILL Y+ ++  IG LVP D  +L 
Sbjct: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327

Query: 336 XXXXXXXX-XPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLA 394
                     P+++AIE  G K+LP I NA+ILI++IS GNS +Y   R+L +LA+ G A
Sbjct: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387

Query: 395 PKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILIS 454
           PK L    ++G P +S++  A+FG++A+   +   + +F WL  I  ++  + W  I +S
Sbjct: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447

Query: 455 HIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSD 510
           H RF Q +K +G S + L ++A      + YAVF  +++ I Q + A  P      DV  
Sbjct: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLS 507

Query: 511 FFAAYISVILFFLIWGAFQLWFKCRW--IWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           FF  Y++  L+ +++  + ++ +  W  +  L+ +D+D++RR  DVE +  E+ E K
Sbjct: 508 FFQNYMAFPLWLIMFLGYMVYSR-NWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  280 bits (717), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 165/512 (32%), Positives = 273/512 (53%), Gaps = 22/512 (4%)

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           E+K+ +K RH                   T L +SGP G +I Y  +G+  Y + Q+ GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 121 MAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           +A  +  +T  F  + S  + P+ G AV ++Y   W     LEL      + YWT  V  
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 180 AAWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVG 237
             ++ IF+ ++  +N+      Y E EF+  + K++ + GF I  + ++CG AG  G +G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            R W NPG +             +K   RF G  ++L+NAAF +  +E +G+TA E +NP
Sbjct: 288 TRLWHNPGSF-----------RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNP 336

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTK 356
           RK +P A KK+++RI+  Y+GS+  +G LVP+D D  L          P+++AI   G +
Sbjct: 337 RKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVR 396

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           ++P   NA+IL++++S GNS  Y  SR L SL++ G AP  L+   + G P  +   +A+
Sbjct: 397 VVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSAL 456

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
            GV+A+  T+     VF WL+ I+ ++  + W  I +SH+RF + ++ +G S  ++ FK+
Sbjct: 457 VGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKS 516

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTPTF----DVSDFFAAYISVILFFLIWGAFQLWF 532
            +    + Y+   MV+I+I Q +TA  P      DV  FF  Y+++ +F +++  F++W 
Sbjct: 517 QVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWK 576

Query: 533 KC-RWIWKLEDVDIDSNRR--DVEKIIWEDPE 561
           K  R   + ED+D+ S+R   D E +  ED E
Sbjct: 577 KDWRLFIRAEDIDLVSHREIFDEELLKQEDEE 608

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  279 bits (714), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 167/569 (29%), Positives = 289/569 (50%), Gaps = 38/569 (6%)

Query: 19  VQTFSTMSQDDDMKK-INIIQQTDASSTTEDEEMLNSG---------SVHDAEVKRELKQ 68
           + T S  SQ   ++  ++  ++ +    T  EE L +G         +    ++K+ +K 
Sbjct: 23  IDTESVHSQHGFVRNFMDSFKRAEPQGQTIREEKLENGLETVRTNDYNATQKKMKQTMKS 82

Query: 69  RHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPV 127
           RH                     L   GP G +I Y+   T+ Y V Q+  E+  ++  +
Sbjct: 83  RHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATL 142

Query: 128 TSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFW 187
             ++  + S  +      AV ++Y   WA+   LEL      + YW  ++    +++IF+
Sbjct: 143 PGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFY 202

Query: 188 VILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPW 247
             +  ++ F  + Y E EF   + KV+ +VGF+I  + + CGA  +G +G +YW  PG +
Sbjct: 203 CFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIGGKYWHTPGAF 262

Query: 248 GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKK 307
                         K    F G  +  + +AF Y G+E + +TA E  NPRK+VP+A K+
Sbjct: 263 -----------VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKR 311

Query: 308 VVFRILLFYIGSLFFIGLLVPFDDPKLXXX--XXXXXXXPFIIAIENSGTKILPDIFNAI 365
            ++R+L+ ++  +  +G LVP+D P L            PF+IA  + G K++P I NA+
Sbjct: 312 WLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIINAV 371

Query: 366 ILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMET 425
           ILI++IS GNS  Y   RIL SLA+ G+ PK+ +   +KG P V++L  A+FG+++++  
Sbjct: 372 ILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAA 431

Query: 426 TQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYY 485
           +   +TVF WL  I +++  + W  I +SHIRF   +K +G S  +L +KAN     ++Y
Sbjct: 432 SDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWY 491

Query: 486 AVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL 540
           A+   +I++  Q + A  P       DV++FF  Y++  +    +  ++LW++    WKL
Sbjct: 492 AIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRD---WKL 548

Query: 541 ----EDVDIDSNRR--DVEKIIWEDPEPK 563
               + VD++S+R+  D + I  ED E K
Sbjct: 549 FIPADKVDLESHRKIFDADLIKQEDFEHK 577

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  280 bits (715), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 162/562 (28%), Positives = 289/562 (51%), Gaps = 35/562 (6%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61
           + +  S   +    K  V +F  +  +++  +I   +  +  S   ++++ N       +
Sbjct: 27  NQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN-------Q 79

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           +++ ++ RH                     L ++GP G LI YI + +  Y + Q+ GEM
Sbjct: 80  LQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139

Query: 122 A-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
           A  ++ +   F  + S  +  +   AV ++Y   W     LEL      + YW   V   
Sbjct: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPD 199

Query: 181 AWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGF 238
            +++IF++++ A+N+F   + Y E EF+    K++ I GF I  + ++CG AG +G +G 
Sbjct: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGV 259

Query: 239 RYWRNPGPWGDGLTSNGVEISKNKNTG-RFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            YW NPG +            +    G RF G  ++L+ AAF++  TE + ITA E +NP
Sbjct: 260 SYWNNPGAF------------RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX-XXXXXXXXXPFIIAIENSGTK 356
           RK +P A KKV++R L  Y+GS+  +G LVP++ P+L           P++IA+ + G +
Sbjct: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIR 367

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           I P   NA+ILI+++S  NS+ Y  SR+L +LAK G APKI +   +KG P   ++A ++
Sbjct: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
              +A+  ++     VF WL+ I+ ++  + W  I +SHIRF + +K +G S ++L +K+
Sbjct: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWF 532
            +    + YA   M +I+I Q + A  P      ++++FF  Y+++ +  L +  ++ W 
Sbjct: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWK 547

Query: 533 KCRWIWKL----EDVDIDSNRR 550
           K    W L    +D+D+ S+R 
Sbjct: 548 K---DWNLFIRAKDIDLISHRH 566

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  278 bits (712), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 174/560 (31%), Positives = 279/560 (49%), Gaps = 30/560 (5%)

Query: 23  STMSQDDDMKKINIIQQ-----TDASSTTEDEEMLNSGS---VHDAEVKRELKQRHXXXX 74
           S  S D ++ K N++ +       A S   +E  L  G+   V    +K+ +K RH    
Sbjct: 6   SPRSDDVEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMM 65

Query: 75  XXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTV 133
                         +  L  SGP   +I Y+ V  +TY + Q+ GEMA   P +  SF  
Sbjct: 66  SIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNS 125

Query: 134 FASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTAL 193
           + S F+S   G A  ++++  W   F LEL      V YW   +    +I IF+  L  +
Sbjct: 126 YTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIIIFYAFLLFI 185

Query: 194 NMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLT 252
           + F VK YGE EF   + KV+ + GF+I  + + CG AG  G +G +YW +PG + DG  
Sbjct: 186 HFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFADG-- 243

Query: 253 SNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRI 312
                        RF G    L++A F+Y G EL  ++  E  NPRK+ P A K+ ++RI
Sbjct: 244 ---------PPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRI 294

Query: 313 LLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITII 371
           L+ Y+ ++  IG  VP + D  +          P+++A      K++P   NA+ILI++I
Sbjct: 295 LIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVI 354

Query: 372 SAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQT 431
           S  NS +Y   R++ SLA+ G APK L+   ++G P   ++  A+FGV+ ++  +   + 
Sbjct: 355 SVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEE 414

Query: 432 VFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMV 491
           VF WL  I  ++  + W  I++SHIRF Q +KF G S D++ FKA      +YY     +
Sbjct: 415 VFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNI 474

Query: 492 IIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK-LEDVDI 545
           ++ I Q + A +P       D   FF +Y++  ++ + +  + ++ +   I   LE +D+
Sbjct: 475 LVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDL 534

Query: 546 DSNRR--DVEKIIWEDPEPK 563
           D +RR  D + I  ED E K
Sbjct: 535 DFHRRIYDPDFIKQEDEENK 554

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  280 bits (716), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 179/533 (33%), Positives = 283/533 (53%), Gaps = 34/533 (6%)

Query: 46  TEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYI 105
           TE E +  + +   A ++  LK R                   ST L   GP G +I + 
Sbjct: 89  TEAERIAQATA--KAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWG 146

Query: 106 FVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSV 165
              T+ Y++  +LGE+A   PV   FT +A+RF+  S G A  + Y   W V   LE+  
Sbjct: 147 LTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVS 206

Query: 166 VGQIVDYWTFAVPIA---AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222
               V+YW    P      ++++FW+++  +NMF VK +GE EF  + +KV  ++GF+I 
Sbjct: 207 ASITVNYW--GTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIIL 264

Query: 223 CLCMVCGAGVTGPVGF-RYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFT 280
            + +VCG G  G     +YW +PG + G G            +  +F G  +  + AAF+
Sbjct: 265 GIVLVCGGGPKGGFVGAKYWHDPGAFVGHG------------SGAQFKGVCSVFVTAAFS 312

Query: 281 YQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX 340
           + G+EL+GITA EAANPRK++P A K+VV+RI+LFY+G+L  IGLLVP++D +L      
Sbjct: 313 FAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSV 372

Query: 341 -XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILS 399
                PF+IAI   G K LP + N +ILI ++S GNS I+  SR + +L+  G  PK+  
Sbjct: 373 DAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFG 432

Query: 400 RTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFM 459
              + G P V +  T+ FG+LA++  ++    VF+WL+ ++ ++  + W  I + HIRF 
Sbjct: 433 YIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFR 492

Query: 460 QVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTF---DVSDFFAAYI 516
             LK +G   ++L F +      +Y+ +F +V++ I Q + A  P     D   FF +Y+
Sbjct: 493 MALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYL 552

Query: 517 SVILFFLIWGAFQLWFKCRWIWK----LEDVDIDSNRR--DVEKIIWEDPEPK 563
           S  +    +   +++ +    WK    LED+DID+ RR  D+E +  E  E K
Sbjct: 553 SFPIVVATYFGHKIYKRN---WKLFIPLEDMDIDTGRRETDMELLKQEIMEEK 602

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  278 bits (712), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 170/535 (31%), Positives = 273/535 (51%), Gaps = 25/535 (4%)

Query: 26  SQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXX 85
           S  D   KI+     D+ S   +      G      + ++L  RH               
Sbjct: 46  SSKDSGYKISTGSAIDSDSLHGNNVAFEYGE----NLNKDLDIRHLLTLAIGGSIGTGLF 101

Query: 86  XXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGA 145
               T L   GP   +I ++ + +  + V  +LGE+A   P+   F V+ +RF+ PS   
Sbjct: 102 VNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAF 161

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
           AV   Y   W V+  LEL      + YW   +   AW++IF+V +  LNM  VKF+ E E
Sbjct: 162 AVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAE 221

Query: 206 FWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPW-GDGLTSNGVEISKNKN 263
           F ++ +K++AIVGF I  + + V G    G +G +YW +PG + GD   S          
Sbjct: 222 FVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAFHGDSAGS---------- 271

Query: 264 TGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFI 323
             RF G  +  + AAF+Y G E+  ++A E+ NPRKT+P+A K+  + I   YI  L  I
Sbjct: 272 --RFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLI 329

Query: 324 GLLVPFDDPKLXXXXXX--XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVG 381
           G+LVP++D +L            P +IAIEN+G K LP + NAIILI ++S  NS +YV 
Sbjct: 330 GILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVC 389

Query: 382 SRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITA 441
           SR++ S+A T   PK+ S+  K+G P  S+ AT   G+L+++  +   + VF WL  I  
Sbjct: 390 SRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICG 449

Query: 442 IAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTA 501
           ++  + W+ I ++HIRF   LKF+  S D+L + +      ++Y V  +V+++I   + +
Sbjct: 450 LSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVS 509

Query: 502 FTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRD 551
             P    + D   FF  Y+S  +    +   +++ K  +W+  LE++DID  +++
Sbjct: 510 LFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDIDLGKKN 564

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  279 bits (714), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 181/561 (32%), Positives = 297/561 (52%), Gaps = 31/561 (5%)

Query: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEV 62
           T+ S+  +V  ++ SG +        D  K++  ++     +  E    + +       +
Sbjct: 33  TIPSNGSAVSTEKGSGSKW---KDFRDSFKRVEPVEVDPNLTEAEKVAFITA----QTPL 85

Query: 63  KRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA 122
           K +LK RH                     L   GP   LI +  +GT+ YA+  +LGE+A
Sbjct: 86  KHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGELA 145

Query: 123 TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAA 181
              P++  FT +A+RF+  S G A  + Y   W VT  LE+      V+YW T       
Sbjct: 146 VVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRDG 205

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG-VTGPVGFRY 240
           ++++FW+++  +NMF VK YGE EF  + +KV+ I+GF+I  + + CG G   G +G +Y
Sbjct: 206 FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGKY 265

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           + +PG +           + +    +F G  +  + AAF++ G+ELVG+ A E+ +PRK+
Sbjct: 266 FHDPGAF-----------AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKS 314

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILP 359
           VP+A K+V +RI LFYI SL  IGLLVP++D +L           PF+IAI   G K LP
Sbjct: 315 VPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLP 374

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419
            + N +ILI ++S GNS I+  SR   +LA+ G  P+I +   +KG P V ++ T+  G+
Sbjct: 375 SVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGL 434

Query: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479
           +A++  +   + VF+WL+ ++ ++  + W  I I HIRF + L  +G S D+L FK+   
Sbjct: 435 IAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTG 494

Query: 480 PGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFFLIWGAFQLWFKCRW 536
              +Y+ +F +VI+ I Q + A  P   +     FF AY+S  L   ++   +++ +   
Sbjct: 495 VWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRN-- 552

Query: 537 IWKL----EDVDIDSNRRDVE 553
            WKL     ++DIDS RR+V+
Sbjct: 553 -WKLLIPAGEMDIDSGRREVD 572

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  279 bits (713), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/530 (31%), Positives = 274/530 (51%), Gaps = 23/530 (4%)

Query: 46  TEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYI 105
           + D   L   +    E K+ +K RH                     L  +GP   +IAY 
Sbjct: 77  SPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYG 136

Query: 106 FVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELS 164
            V  +TY + Q+ GEMA   P +  SF  + S F+S   G A  +++   W     LEL 
Sbjct: 137 LVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELI 196

Query: 165 VVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCL 224
                + YW  ++    ++ IF+V L  ++ F V+ YGE EF   A K++ I GF+I+ +
Sbjct: 197 TAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAI 256

Query: 225 CMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQG 283
            + CG AG  G +G +YW +PG +    +SNG          RF G   +L+NA F+Y G
Sbjct: 257 VVNCGGAGKDGYIGGKYWHDPGAFA---SSNGAS--------RFKGICYNLVNAYFSYGG 305

Query: 284 TELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX--XXX 341
            EL  ++  +  NPRK+ P A K  V+RI++ Y+ ++  IG +VP +  +L         
Sbjct: 306 NELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGL 365

Query: 342 XXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRT 401
              P+++A    G K++P I NA+ILI +IS  NS++Y G R+L SLA+ G AP+ LS  
Sbjct: 366 HASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYV 425

Query: 402 TKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQV 461
            ++G P  ++L +A+ GV+ +  T+   + VF WL  I+ ++  + W  I+ SHIRF + 
Sbjct: 426 DRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRA 485

Query: 462 LKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYI 516
           +K +  S D L +KAN     +Y+ V   +++   Q + A +P       D + FFA+Y+
Sbjct: 486 MKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYL 545

Query: 517 SVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           ++ ++ + +  +  W+K    +  L  VD+D++R+  D E +  ED E K
Sbjct: 546 AMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 158/538 (29%), Positives = 280/538 (52%), Gaps = 28/538 (5%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAE-VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSG 96
           +Q       E  + + + + H ++ +K+ ++ RH                   T L  +G
Sbjct: 91  RQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAG 150

Query: 97  PVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSW 155
           P G LI Y  +G++ Y + Q+ GEMA  +  +T  +  + S  +    G AV ++Y   W
Sbjct: 151 PAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQW 210

Query: 156 AVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVA 215
                LEL      + YWT +V    ++ IF+V++  +N+F  + Y E EF+    K++ 
Sbjct: 211 LCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILM 270

Query: 216 IVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSL 274
           + GF I  + + V GAG  G +G +YW +PG +      NG          RF G   +L
Sbjct: 271 MTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF------NG-----KHAIDRFKGVAATL 319

Query: 275 INAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPK 333
           + AAF + G+E + IT  E +NPRK +P A K++++RIL  ++ ++  +G LVP++ D  
Sbjct: 320 VTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQL 379

Query: 334 LXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGL 393
           L          P++IA+ + G +++P   NA+IL++++S  NS+ Y  +R+  +L++ G 
Sbjct: 380 LGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGY 439

Query: 394 APKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILI 453
           APK+ S   + G P +++  +A+F V+A+   +   + VF WL+ I+ ++  + W  I +
Sbjct: 440 APKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICL 499

Query: 454 SHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVS 509
           SH+RF + +K +G S  +L FK+      + YA   M++I+I Q + A  P      D  
Sbjct: 500 SHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQ 559

Query: 510 DFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPE 561
            FF  Y+++ +   ++  +++W K    WKL    + +D+DS+R+  D E I  ED E
Sbjct: 560 AFFENYLAMPILIALYVGYKVWHK---DWKLFIRADKIDLDSHRQIFDEELIKQEDEE 614

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  278 bits (711), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 166/556 (29%), Positives = 277/556 (49%), Gaps = 33/556 (5%)

Query: 37  IQQTDASSTTEDE----EMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPL 92
           I QT    T+ D     E +    +++  + ++L  RH                     L
Sbjct: 57  INQTTNDVTSSDHFRGSEGIEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAAL 116

Query: 93  EDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYW 152
              GP   +I ++ + T  + V  SLGE++   PV   F V++ RF+ PS   AV   Y 
Sbjct: 117 STGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYL 176

Query: 153 FSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVK 212
             W V   LEL      + YW   +   AW++IF+  +   NM  VK +GE EF ++ +K
Sbjct: 177 AQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIK 236

Query: 213 VVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWF 271
           +++I+GF I  + + CG G  G     +YW +PG +          +  +  T +F G  
Sbjct: 237 ILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF----------VGHSSGT-QFKGLC 285

Query: 272 NSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDD 331
           +  + AAF+Y G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP +D
Sbjct: 286 SVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSND 345

Query: 332 PKLX--XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLA 389
           P+L            P +IAIEN G K LP + NAIILI ++S  NS +Y  SR + ++A
Sbjct: 346 PRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMA 405

Query: 390 KTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWL 449
             G  PK L+R  K+G P  ++L T  FG+L+++  +     VF WL  ++ ++  + W+
Sbjct: 406 HIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWM 465

Query: 450 FILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT---- 505
            I +SHIRF Q +K +  S D+LPF +      ++Y    + +++I   +T+  P     
Sbjct: 466 AINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSG 525

Query: 506 FDVSDFFAAYISVILFFLIWGAFQLWFKCRW--IWKLEDVDIDSNRRDVE--------KI 555
            +   FF  Y+S  +  + +   +++ +  W  + KLED+D+D+ R+ V+        K+
Sbjct: 526 ANAESFFEGYLSFPILIVCYFGHKIYTR-NWTLMVKLEDIDLDTGRKQVDLALRREEMKV 584

Query: 556 IWEDPEPKTFWDKFWN 571
             E    ++F  +F +
Sbjct: 585 ERETLAKRSFMTRFLH 600

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  278 bits (710), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 184/549 (33%), Positives = 295/549 (53%), Gaps = 32/549 (5%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
            +  K++ +++     + TE E++  + +  ++ +KR LK RH                 
Sbjct: 47  KNSFKRMEVVELDP--NLTEAEKI--AIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVG 102

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
               L  +GP G LI +   GT+ Y +  ++GE+A   PV+  FT +A+RF+  S G A 
Sbjct: 103 SGKALRTAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYAN 162

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
            + Y   W V   LE+      V+YW T       ++++F+V++ ++NMF VK YGE EF
Sbjct: 163 NFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEF 222

Query: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY-WRNPGPWGDGLTSNGVEISKNKNTG 265
             + +KV+ ++GF+I  + +VCG G  G       W NPG +             N    
Sbjct: 223 VFSFIKVITVIGFIILGIILVCGGGPVGGYIGGANWHNPGAF-----------VGNTAGK 271

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           RF G  +  + AAF++ G+ELVG+ + E ANPRK++PRA K+V +RI LFYI SL  IGL
Sbjct: 272 RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGL 331

Query: 326 LVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           LVP++D +L           PF++AI+N G K LP + N +ILI ++S GNS ++  SR 
Sbjct: 332 LVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRT 391

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L +LA+ G  PKI     +KG P V +  T+ FG+L+++  +     VFDWL+ ++ ++ 
Sbjct: 392 LTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSS 451

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            + W+ I I H+RF + L  +G S D+L F +      + Y    +++I+  Q + A  P
Sbjct: 452 LFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFP 511

Query: 505 TF---DVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKL----EDVDIDSNRR--DVEK 554
                D  DFF +Y+S+ +  +++    +  KC +  WKL    E++DID+ RR  D+E 
Sbjct: 512 IGSPPDAKDFFESYLSLPVVLVMY----IGHKCYKRNWKLFIRAENIDIDTGRREVDIEA 567

Query: 555 IIWEDPEPK 563
           +  E  E K
Sbjct: 568 LKVELAEEK 576

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  278 bits (712), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 167/584 (28%), Positives = 297/584 (50%), Gaps = 38/584 (6%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEML-------- 52
           +D  + ++ +V R   S  +      Q+ ++ ++N +    + S+ +  E+         
Sbjct: 46  LDYEQHNTSAVRRFLDSFKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKI 105

Query: 53  --NSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTL 110
             ++G   D+ +K+ ++ RH                   T L  +GP G LI Y  +G++
Sbjct: 106 APHTGHKSDS-LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSI 164

Query: 111 TYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQI 169
            Y + Q+ GEMA  +  +T  +  + S  +    G AV ++Y   W     LEL      
Sbjct: 165 LYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMT 224

Query: 170 VDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VC 228
           + YWT +V    ++ IF+V++  +N+F  + Y E EF+    K++ + GF I  + + V 
Sbjct: 225 IKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVG 284

Query: 229 GAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVG 288
           GAG  G +G +YW  PG +      NGV         RF G   +L+ AAF + G+E + 
Sbjct: 285 GAGNDGYIGGKYWHEPGAF------NGVHA-----IDRFKGVVATLVTAAFAFGGSEFIA 333

Query: 289 ITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFI 347
           IT  E +NPRK +P A K++++RIL  ++ ++  +G LVP++ D  L          P++
Sbjct: 334 ITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYV 393

Query: 348 IAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVP 407
           IAI + G ++ P   NA+IL++++S  NS+ Y  +R+  +L++ G APKI S   + G P
Sbjct: 394 IAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRP 453

Query: 408 WVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGI 467
            +++  +A+F V+A+   +     VF WL+ I+ ++  + W  I +SHIRF + +K +G 
Sbjct: 454 LIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGR 513

Query: 468 SRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFL 523
           S  +L FK+      + Y+   M++I+I Q + A  P      D   FF  Y+++ +  +
Sbjct: 514 SLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIV 573

Query: 524 IWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPE 561
           ++  +++W K    WKL    + +D+ S+R+  D E I  ED E
Sbjct: 574 LYVGYKMWNK---DWKLFIRADKIDLTSHRQIFDEELIKQEDDE 614

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  277 bits (708), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 171/560 (30%), Positives = 280/560 (50%), Gaps = 33/560 (5%)

Query: 32  KKINIIQQTDASSTTEDEE----MLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
           K+   + + D +S + D E    + N     D  +K+ LK  H                 
Sbjct: 18  KQTGQVYELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVG 77

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-------VTSSFTVFASRFLS 140
            S+ L   GP G  I+Y  + T+ Y V  +L EM  F+P          S +   +R++ 
Sbjct: 78  TSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVD 137

Query: 141 PSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKF 200
            S+G AVG+ Y + + +  A E +    +V YWT AVP AAWI+IF  I+  LN   V+F
Sbjct: 138 SSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEF 197

Query: 201 YGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEIS 259
           YG  E    ++K+  I+G +I  + +  G G     +GFR+W++PG W   L   G    
Sbjct: 198 YGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGA--- 254

Query: 260 KNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIG 318
                GR       +I A F +  G ELV +T+ EA + R+ + +A ++ V+R++ FY  
Sbjct: 255 -----GRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCV 309

Query: 319 SLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAG 374
           S    G++V  +DP L              PF+I I+N+G K+LP I N  IL +  S+G
Sbjct: 310 SSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSG 369

Query: 375 NSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFD 434
           NS +Y  +R L SL++ G APKI +R  + GVP+  V     F  LAY+  +     VF+
Sbjct: 370 NSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFN 429

Query: 435 WLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIII 494
           W  NI+ I+GF  W+   ++++RF + + F  +  D LPFK    P   ++ +  + II 
Sbjct: 430 WFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIIC 488

Query: 495 IFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFK--CRWIWKLEDVDIDSNRRDV 552
           +  G+ +F   ++  DF AAYI++ LF ++W   + + +   +W+  + ++D+ +  R++
Sbjct: 489 LINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLREI 547

Query: 553 EKIIWE----DPEPKTFWDK 568
           E+   E       P+  W+K
Sbjct: 548 EEETKELNARRIPPRNLWEK 567

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  277 bits (709), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 163/531 (30%), Positives = 268/531 (50%), Gaps = 24/531 (4%)

Query: 32  KKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTP 91
           +  N I  +D     ED E  +   +++  + ++L  RH                     
Sbjct: 59  QTTNDITSSDRFRRNEDTEQED---INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAA 115

Query: 92  LEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMY 151
           L   GP   +I ++ + T  + V  SLGE++   PV   F V++ RF+ PS   AV   Y
Sbjct: 116 LSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNY 175

Query: 152 WFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAV 211
              W V   LEL      + YW   +   AW++IF+  +   NM  VK +GE EF ++ +
Sbjct: 176 LAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMI 235

Query: 212 KVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGW 270
           K+++I+GF I  + + CG G  G     +YW +PG +          +  +  T +F G 
Sbjct: 236 KILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF----------VGHSSGT-QFKGL 284

Query: 271 FNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD 330
            +  + AAF+Y G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP +
Sbjct: 285 CSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSN 344

Query: 331 DPKLX--XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSL 388
           DP+L            P +IAIEN G K LP + NAIILI ++S  NS +Y  SR + ++
Sbjct: 345 DPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAM 404

Query: 389 AKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAW 448
           A  G  PK L+R  K+G P  ++L T  FG+L+++  +     VF WL  ++ ++  + W
Sbjct: 405 AHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCW 464

Query: 449 LFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT--- 505
           + I +SHIRF Q +K +  S D+LPF +      ++Y    + +++I   +T+  P    
Sbjct: 465 MAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGS 524

Query: 506 -FDVSDFFAAYISVILFFLIWGAFQLWFKCRW--IWKLEDVDIDSNRRDVE 553
                 FF  Y+S  +  + +   +L+ +  W  + KLED+D+D+ R+ V+
Sbjct: 525 GASAESFFEGYLSFPILIVCYVGHKLYTR-NWTLMVKLEDMDLDTGRKQVD 574

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  277 bits (709), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 169/534 (31%), Positives = 274/534 (51%), Gaps = 30/534 (5%)

Query: 43  SSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLI 102
           +  T D E   +    D+++K+ +K RH                  +  L   GP   +I
Sbjct: 72  NENTSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVI 131

Query: 103 AYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFAL 161
            Y  V  +TY + Q+ GEMA   P + ++F  ++S F+S   G A  ++Y F W     L
Sbjct: 132 GYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPL 191

Query: 162 ELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLI 221
           EL      + +W   +    +I IF+V L  ++ F VK YGE EF     K++ I GF+I
Sbjct: 192 ELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFII 251

Query: 222 YCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFT 280
             + + CG AG  G +G +YWRNPG +           + + + GRF      L+ A F+
Sbjct: 252 LSVVINCGGAGNDGYIGGKYWRNPGAF-----------AGDTSAGRFKNVCYILVTAYFS 300

Query: 281 YQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-X 339
           + G EL  ++  E ANPRKT P A K+ ++RIL+ Y+ ++  IG  VP++D +L      
Sbjct: 301 FGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGS 360

Query: 340 XXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILS 399
                P+++A    G K++P I NA+ILI++IS  NS++Y G R++ SLA+ G  PK L 
Sbjct: 361 ATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLD 420

Query: 400 RTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFM 459
              ++G P ++++  +VFGV+ ++  +   + VF WL  I  ++  + W  I++SH+RF 
Sbjct: 421 YVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFR 480

Query: 460 QVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFD-----VSDFFAA 514
           Q +K +G S D+L +KA      + Y VF  +++ I Q + A  P  +        FF +
Sbjct: 481 QAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQS 540

Query: 515 YISVILFFLIWGAFQLWFKC-----RWIWKLEDVDIDSNRR--DVEKIIWEDPE 561
           Y++    F IW AF L +        ++  L+ +D+D +R   D E +  ED E
Sbjct: 541 YLA----FPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLE 590

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  276 bits (707), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 174/547 (31%), Positives = 283/547 (51%), Gaps = 29/547 (5%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K++    +   SS  ED E+    S H  ++K+ +K RH                  
Sbjct: 43  DSFKRVE--GEVRNSSDLEDGEVT---SAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVAN 97

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAV 147
           ++ L   GP G LI Y FV  ++Y + Q+ GEMA   P +  +F  ++S F+S   G A 
Sbjct: 98  ASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 157

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFW 207
            +++   W     LEL     +V YWT  +    ++ IF++ +  ++    + YGE EF 
Sbjct: 158 VWLFCIQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFI 217

Query: 208 VAAVKVVAIVGFLIYCLCMVCGA-GVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGR 266
             + KV+ + GF+I  + + CGA G  G +G +YW  PG +  G   +G++        R
Sbjct: 218 FNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG---SGID--------R 266

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G    L+ A F+Y G EL  ++  E  NPRK +P A  K V+RIL+ Y+ ++  IG L
Sbjct: 267 FKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFL 326

Query: 327 VPFDDPKLXXXXXXXXX-XPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRIL 385
           VP D  KL           P+++A+   G KI+P I NA+ILI++IS GNS +Y G R+L
Sbjct: 327 VPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLL 386

Query: 386 FSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
            SLA+ G APKIL    ++G P ++++  +VFG++A++  ++  + +F WL  I+ ++  
Sbjct: 387 CSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSEL 446

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP- 504
           + W  I +SH RF + +K +G S + L +++      + YAV   V ++I Q + A  P 
Sbjct: 447 FTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPM 506

Query: 505 ----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRW--IWKLEDVDIDSNRR--DVEKII 556
                F V   F + +++ L+  +   + +  K  W  +  L  + +DS+RR  DVE + 
Sbjct: 507 DNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTK-NWTILNPLSSISVDSHRRSYDVEVMK 565

Query: 557 WEDPEPK 563
            ED E K
Sbjct: 566 QEDLEYK 572

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  276 bits (707), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 179/551 (32%), Positives = 284/551 (51%), Gaps = 39/551 (7%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K+ +  Q  D + T  ++  + +    +A +KR LK RH                  
Sbjct: 47  DSFKRADT-QDLDPNLTDAEKMAILTA---NAPLKRTLKSRHLQMIAIGGAIGTGLFVGS 102

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
              L  +GP G LI +   GT+ Y +  ++GE+A   P+   FT +ASRF+  S G A  
Sbjct: 103 GKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFN 162

Query: 149 YMYWFSWAVTFALELSVVGQIVDYWTFAVPIA---AWISIFWVILTALNMFPVKFYGEIE 205
            +Y   W V   LE+      V+YW    P      ++++F+V++ A+N F VK YGE E
Sbjct: 163 TIYMLQWLVVLPLEIVAASITVNYW--GTPDKYRDGFVALFYVVIVAINFFGVKGYGEAE 220

Query: 206 FWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNT 264
           F  + +KV+ ++G++I  + +VCG G  G     R W NPG + +G              
Sbjct: 221 FIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANG-------------- 266

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
             F G  +  + AAF++ G+ELVG+ A E ANPRK++P A K+V +RI LFYI +L  +G
Sbjct: 267 --FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVG 324

Query: 325 LLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSR 383
           LLVP+   +L           PF+I+I+N+G K LP + N +ILI ++S GNS ++  SR
Sbjct: 325 LLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSR 384

Query: 384 ILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIA 443
            + +LA  G  PKI     + G P V ++ T VFG+L+++  +     VFDWL+ ++ ++
Sbjct: 385 SMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLS 444

Query: 444 GFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT 503
             + W  I++ HIR  + L  +  +  +L F A      + Y    +++I++ Q + A  
Sbjct: 445 SLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALF 504

Query: 504 PTFD---VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEK 554
           P  D    S FF AY+S  +    +   ++W K    WKL    +++DID+ RR  D+E 
Sbjct: 505 PIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKN---WKLFIRAKNIDIDTGRRETDIEA 561

Query: 555 IIWEDPEPKTF 565
           +  E  E K F
Sbjct: 562 LKQEIAEEKAF 572

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  278 bits (712), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/577 (28%), Positives = 292/577 (50%), Gaps = 41/577 (7%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61
           D+  S+  +    + S  Q  + +++      ++ I+Q+      + E +          
Sbjct: 96  DSSNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENL---------- 145

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
            K+ +K RH                  S  L ++GP G +I Y  +G+  Y + Q+ GE+
Sbjct: 146 -KKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGEL 204

Query: 122 AT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
           A  +  +   F  +    + P++G +V +++   W     LEL      + YWT +V   
Sbjct: 205 AVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPD 264

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFR 239
            ++ IF+V++  +N+F  K Y E +F+    K++ IVGF I  + + CG AG  G +G +
Sbjct: 265 VFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSK 324

Query: 240 YWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           YWR+PG + GD                RF G   + + AAF +  +E + +TA E +NPR
Sbjct: 325 YWRDPGAFRGDTPIQ------------RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPR 372

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPF-DDPKLXXXXXXXXXXPFIIAIENSGTKI 357
           K +P A KK+++RIL  ++ SL  +G LVP+  D  L          P++IA+ + G ++
Sbjct: 373 KAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRV 432

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           +P   NA+IL++++S  N   Y  SRIL SLAK G APK      ++G P  ++L +A+F
Sbjct: 433 VPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALF 492

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           GV+A+  +++  + VF WL+ I+ ++  + W+ I +SHIRF + +K +G S  ++ +K+ 
Sbjct: 493 GVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 552

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
           +    + YAV  MV+ +I Q + A  P           FF  Y+++ ++  ++  +++W 
Sbjct: 553 VGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWK 612

Query: 533 KCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPK 563
           K    W L    + VD+ S+R   D E +  ED E K
Sbjct: 613 K---DWSLFIPADKVDLVSHRNIFDEELLKQEDEEYK 646

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  278 bits (711), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/517 (30%), Positives = 270/517 (52%), Gaps = 28/517 (5%)

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            +K+ +K RH                  S  L ++GP G +I Y  +G+  Y + Q+ GE
Sbjct: 144 NLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGE 203

Query: 121 MAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           +A  +  +   F  +    + P++G +V +++   W     LEL      + YWT  V  
Sbjct: 204 LAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDP 263

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGF 238
             ++ IF+V++  +N+F  K Y E +F+    K++ I+GF I  + + CG AG  G +G 
Sbjct: 264 DVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGS 323

Query: 239 RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           +YWR+PG +             +    RF G   + + AAF +  +E + +TA E +NPR
Sbjct: 324 KYWRDPGAF-----------RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPR 372

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPF-DDPKLXXXXXXXXXXPFIIAIENSGTKI 357
           K +P A KK+++RIL  ++ SL  +G LVP+  D  L          P++IA+ + G ++
Sbjct: 373 KAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRV 432

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           +P   NA+IL++++S  NS  Y  SRIL SLAK G APK      ++G P V++L +A+F
Sbjct: 433 VPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALF 492

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           GV+A+  +++  + VF WL+ I+ ++  + W+ I +SHIRF + +K +G S  ++ +K+ 
Sbjct: 493 GVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 552

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
           +    + YAV  M++ +I Q + A  P           FF  Y+++ +   ++  F++W 
Sbjct: 553 VGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVW- 611

Query: 533 KCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPK 563
             +  W L      VD+ S+R   D E +  ED E K
Sbjct: 612 --KNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYK 646

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/535 (30%), Positives = 277/535 (51%), Gaps = 25/535 (4%)

Query: 43  SSTTEDEEMLNSGSVH---DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVG 99
           S   ED+  L  G+     +  +K+ +K RH                  +  L+ +GP  
Sbjct: 64  SQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGS 123

Query: 100 SLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158
            +I Y+ V  +TY + Q+ GEM    P +  +F  + S F+S S G A  +++   W   
Sbjct: 124 LVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTV 183

Query: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218
             LEL      + YW   +    +I+IF+V L  ++ F VK YGE EF   + K++ I G
Sbjct: 184 LPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAG 243

Query: 219 FLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277
           F+I  + + CG AGV G +G  YWRNPG + DG ++            RF G    L+ A
Sbjct: 244 FIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSAT-----------RFKGICFILVTA 292

Query: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
            F++ G EL  ++  E ANPRK+ P A K+ ++RIL+ Y+ ++  IG  VP D+ +L   
Sbjct: 293 YFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGS 352

Query: 338 -XXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPK 396
                   P+++A    G K++P I NA+ILI++IS  NS +Y   R++ SLA+ G APK
Sbjct: 353 GSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPK 412

Query: 397 ILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHI 456
            L+   ++G P  +++  +  G++ ++  +   +  F WL  I  ++  + W  I++SHI
Sbjct: 413 FLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHI 472

Query: 457 RFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDF 511
           RF + +K +G S D++ +K+N     +YY V   +++ + Q + A +P       DV  F
Sbjct: 473 RFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESF 532

Query: 512 FAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           F +Y++  L+  ++  + ++ K    +  L+ +D+D +RR  D E +  ED E K
Sbjct: 533 FQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  276 bits (705), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 172/585 (29%), Positives = 282/585 (48%), Gaps = 48/585 (8%)

Query: 4   LESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVK 63
           L +   S   Q  + + +      DDD      +QQ D               +++  + 
Sbjct: 49  LSAKGSSGVNQTTNDITSSGRFHSDDD------VQQED---------------INNTNLS 87

Query: 64  RELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMAT 123
           +EL  RH                     L   GP   +I ++ + T  + V  SLGE++ 
Sbjct: 88  KELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSA 147

Query: 124 FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWI 183
             PV   F V++ RF+ PS   AV   Y   W V   LEL      + YW   +   AW+
Sbjct: 148 AFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWV 207

Query: 184 SIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWR 242
           +IF+  +   NM  VK +GE EF ++ +K++AI+GF I  + + CG G  G     +YW 
Sbjct: 208 AIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWN 267

Query: 243 NPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVP 302
           +PG +          +  +  T +F G  +  + AAF+Y G E+  ++A E+ NPR+T+P
Sbjct: 268 DPGAF----------VGHDSGT-KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIP 316

Query: 303 RAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIENSGTKILPD 360
           +A K+  + I + Y+  L  IG LVP +DP+L            P +IAIEN   K LP 
Sbjct: 317 KAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPS 376

Query: 361 IFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVL 420
           + NAIILI ++S  NS +Y  SR + ++A  G  PK L R  K+G P  +++ T  FG+L
Sbjct: 377 LMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLL 436

Query: 421 AYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMP 480
           +++  +     VF WL  ++ ++  + W+ I +SHIRF Q +KF+  S D+LPF +    
Sbjct: 437 SFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGV 496

Query: 481 GLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWFKC-R 535
             + Y    + +++I   +T+  P      +   FF  Y+S  +  + +   +++ +  R
Sbjct: 497 WGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDWR 556

Query: 536 WIWKLEDVDIDSNRRDVE--------KIIWEDPEPKTFWDKFWNV 572
            + KLED+D+D+ R+ V+        KI  E    ++F  +F  V
Sbjct: 557 LLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRFLRV 601

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  276 bits (706), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 161/537 (29%), Positives = 281/537 (52%), Gaps = 28/537 (5%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
           +Q    + + D     +G+  D+ +K+ ++ RH                   T L  +GP
Sbjct: 93  RQELEKNESSDNIGARTGNKSDS-LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGP 151

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWA 156
            G LI Y  +G++ Y + Q+ GEMA  +  +T  +  + S  +    G AV ++Y   W 
Sbjct: 152 AGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWL 211

Query: 157 VTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAI 216
               LEL      + YWT +V    ++ IF+V++  +N+F  + Y E EF+    K++ +
Sbjct: 212 CVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMM 271

Query: 217 VGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLI 275
            GF I  + + V GAG  G +G +YW +PG +      NG       +  RF G   +L+
Sbjct: 272 TGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF------NG-----KHSIDRFKGVVATLV 320

Query: 276 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX 335
            AAF + G+E + IT  E ANPRK VP A K++++RIL  ++ ++  +G LVP++  +L 
Sbjct: 321 TAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLL 380

Query: 336 XXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLA 394
                     P++IA+ + G +++P   NA+IL++++S  NS+ Y  +RIL +L++ G A
Sbjct: 381 GSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYA 440

Query: 395 PKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILIS 454
           P++ +   K G P +++  +A+FGV+A+   +     VF WL+ I+ ++  + W  I +S
Sbjct: 441 PRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLS 500

Query: 455 HIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSD 510
           HIRF + +K +G S  +L F++      + YA   M++I+I Q + A  P      D   
Sbjct: 501 HIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQA 560

Query: 511 FFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPE 561
           FF  Y+++ +   ++  +++W K    WKL    + +D+ S+R+  D E I  ED E
Sbjct: 561 FFENYLAMPILIALYVGYKIWKK---DWKLFIRADKIDLISHRQIFDEELIKQEDEE 614

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  275 bits (704), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 165/542 (30%), Positives = 278/542 (51%), Gaps = 23/542 (4%)

Query: 34  INIIQQTDASSTTEDEEMLNSGS---VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXST 90
           ++  ++ D      D+  L SG+   + ++ +K+ +K RH                  ++
Sbjct: 70  MDSFKRADGQRAGFDDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANAS 129

Query: 91  PLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGY 149
            L  SGP   ++AY  V  +TY + Q+ GEMA   P +  +F  + S F+S   G A  +
Sbjct: 130 GLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVW 189

Query: 150 MYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVA 209
           ++   W     LEL      + YW   +    ++ IF+V L  ++ F V+ YGE EF   
Sbjct: 190 LFLLQWLTVLPLELITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFN 249

Query: 210 AVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFL 268
           + K++ I GF+I+ + + CG AG  G +G +YW +PG +           + + N GRF 
Sbjct: 250 SCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAF-----------TSHTNIGRFK 298

Query: 269 GWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVP 328
           G    L+ A F+Y GTEL  ++  E  NPRK+ P+A K+ ++RI++ Y+ ++  IG  VP
Sbjct: 299 GICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVP 358

Query: 329 FDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFS 387
            D+ +L           P+++A    G +I+P   NA+ILI++IS  NS++Y   R+L S
Sbjct: 359 HDNDQLMGSHGSATHASPYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCS 418

Query: 388 LAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWA 447
           LA+ G APK L+   ++G P  ++   ++FGV+ +   +   + VF WL  I  ++  + 
Sbjct: 419 LAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFT 478

Query: 448 WLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFD 507
           W  I++SH+RF Q +K +G   ++L +KA      + Y VF  +++   Q + A  P   
Sbjct: 479 WSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGS 538

Query: 508 ---VSDFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPE 561
                 FF +Y++  +FF  +  + LW K   ++  LE +D+D +RR  D E I  E  E
Sbjct: 539 KPTALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQEREE 598

Query: 562 PK 563
            K
Sbjct: 599 KK 600

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  274 bits (701), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 181/550 (32%), Positives = 287/550 (52%), Gaps = 35/550 (6%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
            D  ++   +    + +  E   +L +    +A +KR LK RH                 
Sbjct: 46  KDSFREAETVDLDPSLTPAEKMAILTA----NAPLKRTLKSRHLQMIGIGGAIGTGLFVG 101

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
               L  +GP G LI +   GT+ Y +  ++GE+A   PV   +T +ASRF+  S G A 
Sbjct: 102 SGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAF 161

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
             +Y   W +T  LE+      V+YW T A    A++++F+V++  +N+F VK YGE EF
Sbjct: 162 NTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEF 221

Query: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTG 265
             + +KV+A++GF+I  + +VCG G  G     R W NPG + +G               
Sbjct: 222 IFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG--------------- 266

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
            F G  +  + AAF++ G+ELVG+ A E ANPRK++P A K+V +RI LFYI +L  +GL
Sbjct: 267 -FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGL 325

Query: 326 LVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           LVP+   +L           PF+I+I+N+G K LP + N +ILI ++S GN  ++  SR 
Sbjct: 326 LVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRS 385

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           + +LA  G  PKI     + G P V ++ T VFG+L+++  +     VFDWL+ ++ ++ 
Sbjct: 386 MAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSS 445

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            + W  IL+ HIR  + L  +  +  +L F A      + Y++  +++I+I Q + A  P
Sbjct: 446 LFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFP 505

Query: 505 TF---DVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKI 555
                  + FF AY+S  ++ + +   ++W K    WKL     D+DIDS RR  D+E +
Sbjct: 506 IGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKN---WKLFIKASDIDIDSGRRETDIEAL 562

Query: 556 IWEDPEPKTF 565
             E  E K F
Sbjct: 563 KQEIAEEKAF 572

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  275 bits (704), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 156/520 (30%), Positives = 271/520 (52%), Gaps = 32/520 (6%)

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
           A +KR++K RH                     L   GP G  I Y  +G+  Y++ Q+ G
Sbjct: 100 ASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAG 159

Query: 120 EMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVP 178
           E+A   P +T +F  + S  + P++  A   +Y   W   F LE+      + YW  ++ 
Sbjct: 160 ELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSIN 219

Query: 179 IAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVG 237
              W  IF+V++  +NM     Y E +F+    K++   GF I  + + CG AG +  +G
Sbjct: 220 PNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIG 279

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTG--RFLGWFNSLINAAFTYQGTELVGITAGEAA 295
            +YW +PG +             N +TG  RF    ++L+ AAF +  +E V +TA E A
Sbjct: 280 GKYWNDPGAF-------------NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQA 326

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXX-PFIIAIENSG 354
           NPRK +P A K+V++RI+  Y+ S+  +G LVP++ P+L           P++IA+ + G
Sbjct: 327 NPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHG 386

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            K++P   NA+ILI+++S GN + Y  SRIL  L++ G APK      ++G P  +++  
Sbjct: 387 VKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVG 446

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           A+ G + ++  +   ++VF WL+ ++ ++  + W  I ISH+RF + ++ +  S  +L F
Sbjct: 447 ALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGF 506

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTPT-----FDVSDFFAAYISVILFFLIWGAFQ 529
           ++ +    +YY +F M+++ I Q + A  P       D  +FFA Y+++ +F  ++  F+
Sbjct: 507 RSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFK 566

Query: 530 LWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPK 563
           +W K    W+L     ++D+ S+R+  D E +  ED E K
Sbjct: 567 IWKK---DWRLYIPASEIDLISHRKIFDEEILKQEDEEYK 603

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  274 bits (701), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 159/536 (29%), Positives = 274/536 (51%), Gaps = 22/536 (4%)

Query: 39  QTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPV 98
           Q D +   E ++  N  +     +K  +K RH                     L   GP 
Sbjct: 45  QVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPA 104

Query: 99  GSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAV 157
           G +I Y+   T+ Y V Q+  E+   +  +  ++  + +  +    G AV  +Y   WA 
Sbjct: 105 GLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWAT 164

Query: 158 TFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIV 217
              LEL      V YWT +V    +++IF+V L  ++ F  + Y E EF   ++KV+ + 
Sbjct: 165 VLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMA 224

Query: 218 GFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277
           GF+I  + +  GA   G +G +YW +PG +G            ++   RF G  +  + A
Sbjct: 225 GFIIMAISLTAGASEQGYIGGQYWHDPGAFGG-----------DRAIDRFKGICSVWVQA 273

Query: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
           AF Y G+E + +TA E ANPR++VP+A K+ ++R+++ ++  +  IG LVP +  +L   
Sbjct: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSA 333

Query: 338 X--XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAP 395
                    PF+IA    G +++P I N IIL ++IS GNS +Y   RIL SLA+ G+ P
Sbjct: 334 EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP 393

Query: 396 KILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISH 455
           KI +   ++G P V+++  ++FG++A++  +   + VF WL  I  ++  + W  I +SH
Sbjct: 394 KIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSH 453

Query: 456 IRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSD 510
           +RF + ++ +G S  +L ++AN     +YYA+F  VI++I Q + A  P       DV  
Sbjct: 454 VRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEF 513

Query: 511 FFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           FF  Y++  +  + +  ++LW +  R +    +VD+ S+R+  D E ++ E+ E K
Sbjct: 514 FFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  274 bits (701), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 173/584 (29%), Positives = 289/584 (49%), Gaps = 32/584 (5%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQD------------DDMKKINIIQQTDASSTTED 48
           + T  S+ +SV +  +  V+++++ ++             D  K     + ++  S  E 
Sbjct: 18  LRTDASNKKSVDQINEKSVESYASNAEVGATNPTMFRRFVDSFKPAEDNKHSEVDSDVER 77

Query: 49  EEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVG 108
                     D  +K+ +K RH                  +  L   GP   +I Y  V 
Sbjct: 78  NGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVS 137

Query: 109 TLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVG 167
            +TY + Q+ GEMA   P +  +F  +AS F+S   G A  +++   W     LEL    
Sbjct: 138 MVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITAS 197

Query: 168 QIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMV 227
            I+ YWT  V    ++ IF+V L  ++   VK YGE EF     K++ I GF+I+ + + 
Sbjct: 198 LIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVN 257

Query: 228 CG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTEL 286
           CG AG  G +G +YW +PG +     +N  E        RF G    L++  F+Y GTEL
Sbjct: 258 CGGAGHDGYIGGKYWHSPGAFAG---TNAAE--------RFKGVCYVLVSGYFSYGGTEL 306

Query: 287 VGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXP 345
             ++  E  NPRK+ P A K+ ++RIL+ Y+ ++  IG  VPF+D +L           P
Sbjct: 307 YVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASP 366

Query: 346 FIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKG 405
           +++A    G +++P I NA+ILI +IS  NS++Y   R+L SLA+ G APK ++   ++G
Sbjct: 367 YVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREG 426

Query: 406 VPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFR 465
            P  ++LA AVFGV+A+   +   + VF WL  I  ++  + W  I++SH+RF Q +K +
Sbjct: 427 RPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQ 486

Query: 466 GISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFF 522
           G   +++ + AN     + Y V   +++ I Q + A  P         FF +Y++  ++ 
Sbjct: 487 GRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIWI 546

Query: 523 LIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
             +  + +W K   ++  L+ +D+D +RR  D E +  ED E K
Sbjct: 547 AFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENK 590

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/583 (28%), Positives = 296/583 (50%), Gaps = 30/583 (5%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQ-----DDDMKKINIIQQTDASSTTEDEEMLN------ 53
           ES+ +  P   K+    F+ +SQ       +  ++N+    +  + T D+ +L       
Sbjct: 47  ESTQRDHPGLHKTRTTCFTIVSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPK 106

Query: 54  --SGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLT 111
             S S+ +   +R+L  R                    T +   GP   LIA+     + 
Sbjct: 107 SQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVF 166

Query: 112 YAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVD 171
             +++ +  M T++PVT SF  F  RF+  S G AVG+ Y+   A     E++ V  +V+
Sbjct: 167 IGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVE 226

Query: 172 YWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG 231
           YWT  +P AA IS+  ++  +LN++ V F+GE EF+++  KVV  +G +I+ + ++ G  
Sbjct: 227 YWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGN 286

Query: 232 VTGPV-GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGIT 290
               V GF+ W NPG + + ++   V        GRF G+ + L+ A + + G + +G  
Sbjct: 287 PQHTVLGFKNWSNPGAFAEYISDGSV--------GRFHGFMSCLVFALYVFWGVDYLGNA 338

Query: 291 AGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX----XXXXXXXPF 346
           A EA NPRK +P + +KV  R+++FYIG    +G+L+P++DP +              P+
Sbjct: 339 ASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPY 398

Query: 347 IIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGV 406
           + A++  G ++LP I N +IL +IISAGNS++Y  SR+L  LA    AP+I   TTKKGV
Sbjct: 399 VSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGV 458

Query: 407 PWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRG 466
           P    +A  V   LAY+  +     V  W +N+   A    ++FI +S+++F +    + 
Sbjct: 459 PVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQN 518

Query: 467 ISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIW 525
           +    LP+ ++ +P LA++++F +V++++  G+T F   ++D   F  +Y  +  F +  
Sbjct: 519 VDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFL 578

Query: 526 GAFQLWFKCRWIWKLEDVDIDSNRRDV--EKIIWEDPEPKTFW 566
              +L+   + +  LE +D+ +   ++  E   W +  P   W
Sbjct: 579 FGHKLYKGTKSVRPLE-MDLFTGIEELADEDRYWAENPPTLNW 620

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 175/560 (31%), Positives = 287/560 (51%), Gaps = 34/560 (6%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHD--AEVKRELKQRHXXXXXXXXXX 80
           ST SQ+    KI      +       EE +  G +H+   ++K+ LK+RH          
Sbjct: 8   STNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKMLTLVGVF 67

Query: 81  XXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLS 140
                      L+ +GPVG LIAY+FVG +      ++ E+A+F+P T +    A +F+ 
Sbjct: 68  GTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFID 127

Query: 141 PSIGAAVGYMYWFSWAVTFAL----ELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMF 196
            S+G      + F W  T++     ELS    I+ YWT   P A +I++F ++    N++
Sbjct: 128 ESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIY 180

Query: 197 PVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDGLTSN 254
            ++FYGE+E+    +K+V I   +I  L +  G G  G   +GF YWR PGP+ + L   
Sbjct: 181 TIRFYGELEYIFGWLKLVLIFILIISGLVIDLG-GTKGQERLGFHYWREPGPFANYLVGG 239

Query: 255 GVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILL 314
            +        G+F+G++ ++ +  ++Y G + + I AGE  N R  +    K V  RI++
Sbjct: 240 HI--------GKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIV 291

Query: 315 FYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAG 374
            Y+ ++F + L+VP++D  +          PF+IA+  +G K+LP I NA+IL +  SAG
Sbjct: 292 LYLVTVFILTLIVPYNDKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAG 351

Query: 375 NSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFD 434
           N  I  GSR LF LA    APKI  RT+K+G+P+V V+  + F  LAYM  ++   TVF 
Sbjct: 352 NLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFG 411

Query: 435 WLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIII 494
           W   + +      W+ I  +HI   + LK +G SR DLP+   + P  A+++     I +
Sbjct: 412 WFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFL 471

Query: 495 IFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVE 553
           +  GF  F    FD+  FF  Y  + L   ++  ++L+ K +++ +  +VD++S   D++
Sbjct: 472 LTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYL-RPHEVDLESIFDDIK 530

Query: 554 KIIWEDPEP----KTFWDKF 569
               E+PE     K  W +F
Sbjct: 531 ----ENPEHIVKTKNAWARF 546

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 172/570 (30%), Positives = 293/570 (51%), Gaps = 33/570 (5%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKR 64
           +++  S     ++ + T  + +   D KK       D+ S  E E     G   +  +K+
Sbjct: 78  QTNHNSAAEDLENELTTCVSPATLSDYKK-----SGDSGSVDELE-----GKTKEEHLKK 127

Query: 65  ELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-T 123
            +K RH                  +  L D+GP G  I Y  +G+  Y + Q+ GEMA T
Sbjct: 128 SIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVT 187

Query: 124 FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWI 183
           +  +   F  + S  +SP +G AV ++YW  WA    LEL      + YWT  V    ++
Sbjct: 188 YSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFV 247

Query: 184 SIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWR 242
            IF+ ++  +N+F  + Y E EF+    KV+ I GF I  + + CG AG  G +G +YW 
Sbjct: 248 VIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWH 307

Query: 243 NPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVP 302
           +PG +             +K   RF G   +L+ AAF + G+E + +TA E +NPRK +P
Sbjct: 308 DPGAF-----------RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIP 356

Query: 303 RAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX-XXXXXXXXXPFIIAIENSGTKILPDI 361
            A KK+++RI++ ++GS+  +G LVP++  +L           P++IAI + G +++P  
Sbjct: 357 AAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHF 416

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
            NA+IL++++S GNS  Y  SRIL SL++ G APK  +   ++G P  +++  A+F V+A
Sbjct: 417 VNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIA 476

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           +   +   + VF WL+ I+ ++  + W  I +SHIRF + +  +G S  ++ FK+ L   
Sbjct: 477 FCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVW 536

Query: 482 LAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537
            +YYA   M +++I Q +    P      D   FF +Y+++++    +  +  W K  W 
Sbjct: 537 GSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFW-KKDWT 595

Query: 538 W--KLEDVDIDSNRR--DVEKIIWEDPEPK 563
              + +D+D+D +R+  D + +  ED E K
Sbjct: 596 LFIRAKDIDLDHHRQIFDEDVLRQEDEETK 625

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 276/535 (51%), Gaps = 38/535 (7%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
           ++ D      DEE   S     +++K+ +K RH                   T L  +GP
Sbjct: 45  KKQDDDVVGYDEETGTS-----SKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGP 99

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWA 156
            G +I Y     + Y + Q+ GE+   +  +T ++T ++S  + P++G +V ++Y   W 
Sbjct: 100 GGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWM 159

Query: 157 VTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAI 216
             F L+L      + YWT   P   +++I + ++  +N+F  K Y E EF     KV+ +
Sbjct: 160 TVFPLQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMM 218

Query: 217 VGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLI 275
           VGF+I  + + CG AG  G +G RYW  PG +  G                F G      
Sbjct: 219 VGFVILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------------FKGVCYVFC 262

Query: 276 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX 335
            AAF Y G E++ +TA E  NPRK++P A KKV++RILL Y+ +   +  LVP+D P+L 
Sbjct: 263 YAAFAYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELT 322

Query: 336 XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAP 395
                    PF+IAI + G  ++P I NA+IL+ ++S GNS++Y   R+L SL++ G AP
Sbjct: 323 STGSASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAP 382

Query: 396 KILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISH 455
           K+ +   ++G P +  L     G+LA++  +   + VF WL+ I+ ++  + W+ I +SH
Sbjct: 383 KVFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSH 442

Query: 456 IRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSD 510
           +RF   +K +G S  ++ +K+      +++A+   + +++ Q + A  P          D
Sbjct: 443 VRFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKD 502

Query: 511 FFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWED 559
           FF +Y++  +   I+  +++++K    W+L     +VD++S+R+  D +++  ED
Sbjct: 503 FFQSYLAAPVLIFIYFGYKIYYK---DWRLCIPATEVDLNSHRKIFDEDELKQED 554

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  275 bits (702), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/590 (28%), Positives = 299/590 (50%), Gaps = 48/590 (8%)

Query: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQ-TDASSTTEDEEMLNSGSVHDA 60
           D ++++     +  ++G+ T S      +++K+N ++  TDA+               + 
Sbjct: 84  DYIDAAELDYEQALENGITT-SVSPSAPNLRKLNQLRTPTDAND--------------NK 128

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            +K+ ++ RH                   T L+++GP G +I Y  +G++ Y + Q+ GE
Sbjct: 129 ALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGE 188

Query: 121 MA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           MA  +  +   + V+ S  +    G A+ ++Y   W     LEL      + YWT +V  
Sbjct: 189 MAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTSVNS 248

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGF 238
             +++IF+ ++  +N+F  K Y E EF+    KV+ ++GF I  + +  G AG  G +G 
Sbjct: 249 DIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGG 308

Query: 239 RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
            YW  PG +             + +   F G   +L+ AAF Y GTE + +TA E +NPR
Sbjct: 309 LYWHTPGAF-----------RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPR 357

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGTKI 357
             +P A KKV++RI+  Y+ S+  IG LVPFD  +L           P+++A    G ++
Sbjct: 358 AAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRV 417

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           +P   NA+ILI+++S GNS  Y  SR+L SLA+ G APK      ++G P  ++L +A+F
Sbjct: 418 VPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALF 477

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
           GV+A+   +     VF WL+ I+ ++  + W  I +SHIRF   +K +G S  ++ + A 
Sbjct: 478 GVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQ 537

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFK 533
                ++YA+F M +I I Q + A  P         +FF  Y+++ +  +++  +++++K
Sbjct: 538 TGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYK 597

Query: 534 CRW--IWKLEDVDIDSNRR--DVEKIIWEDPEPKT------FWDK---FW 570
             W  + K ED+D+ S+R+  D + +  ED E +       FW +   FW
Sbjct: 598 -DWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFW 646

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  274 bits (701), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/498 (30%), Positives = 262/498 (52%), Gaps = 20/498 (4%)

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           E+K  +K RH                   T L +SGP G +I Y  +G+  Y + Q+ GE
Sbjct: 122 ELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 181

Query: 121 MAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           MA  +  +   F  + S  + P++G +V ++Y   W     LEL      + YWT  V  
Sbjct: 182 MAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 241

Query: 180 AAWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVG 237
             ++ IF+V++  +N+      Y E EF+  + K++ ++GF I  + ++CG AG  G +G
Sbjct: 242 DVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIG 301

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            RYW +PG +                  RF G  ++L+NAAF +  +E++G+TA E +NP
Sbjct: 302 GRYWHDPGAF-----------RGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNP 350

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTK 356
           RK +P A KK+++RI+  Y+GS+  +G LVP++ D  L          P+++A+   G +
Sbjct: 351 RKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVR 410

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           ++P   NA+IL++++S  NS  Y  SR+L  LA+ G APKI     ++G P + +   A+
Sbjct: 411 VVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAAL 470

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
             V+++  T+     VF WL+ I+ ++  + W  I +SHIRF + +  +G S  ++ FK+
Sbjct: 471 VNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKS 530

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
                 ++YA   M++I+I Q + A  P      DV  FF  Y++  +   ++  ++++ 
Sbjct: 531 QCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYT 590

Query: 533 KC-RWIWKLEDVDIDSNR 549
           K  R   + +D+D+D NR
Sbjct: 591 KDWRLFIRAKDIDLDINR 608

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  271 bits (692), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 176/564 (31%), Positives = 293/564 (51%), Gaps = 35/564 (6%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE-----VKRELKQRHXXXXXXXXXXXXX 83
           D MK     ++T  S  +  +E ++ GSV D E     + R LK RH             
Sbjct: 19  DRMK-----EKTQFSIHSTGDE-VSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTG 72

Query: 84  XXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFA--SRFLSP 141
                   L   GP   LIAY  +    ++V   + EM T IP+    T+++    +++ 
Sbjct: 73  LFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNK 132

Query: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFY 201
            +    G+  +++ A+    E++    +V YWT A P A +ISIF V+  A+ M PVK +
Sbjct: 133 PLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVF 191

Query: 202 GEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDGLTSNGVEIS 259
           GE EFWV+++K++ IVG +I  + +  G G      +GF YW+ PG +   L   G    
Sbjct: 192 GESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYLVEGG---- 247

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGT-ELVGITAGEAANPRKTVPRAIKKVVFRILLFYIG 318
               TG+FL ++ ++I + F++    E+V   A EA  PR+ +PRA K+ ++R+ LFY+ 
Sbjct: 248 ----TGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVF 303

Query: 319 SLFFIGLLVPFDDPKLX----XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAG 374
            +  +G++V +D+ +L              PF+I I+ +G ++LP I NA IL +  S G
Sbjct: 304 GILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCG 363

Query: 375 NSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFD 434
              +Y  SR L S+A  G AP+IL+   K GVP+     T++F +LAY+  +     VF+
Sbjct: 364 TGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFN 423

Query: 435 WLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIII 494
           WL NI  I+GF +W+ + I++IRF  V+    ++ D +PF+      LAY A+    I+ 
Sbjct: 424 WLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILT 482

Query: 495 IFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFK---CRWIWKLE-DVDIDSNR 549
           +  GF  F    +D S+FFAAYI++    +++    +++K   CR I ++E D+      
Sbjct: 483 LTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYKEWRCRDIAEIEQDILPKITL 542

Query: 550 RDVEKIIWEDPEPKTFWDKFWNVV 573
            + E+  ++ P P+ + +K W V+
Sbjct: 543 AEAEEYEYDIPVPRNWLEKIWMVI 566

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  272 bits (696), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 167/585 (28%), Positives = 293/585 (50%), Gaps = 42/585 (7%)

Query: 13  RQRKSGVQTFSTMSQDDDM--------KKINIIQQTDASSTTEDEEMLNSGSVHDAEVKR 64
           ++   G Q  S   Q +D+        +    +++ D++          SGS+     K+
Sbjct: 64  KRADQGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSL-----KK 118

Query: 65  ELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-T 123
            ++ RH                   T L  +GP G LI Y  +G++ Y + Q+ GE+A  
Sbjct: 119 TIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALV 178

Query: 124 FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWI 183
           +  +T  +  + S  +    G AV ++Y   W     LEL      + YWT +V    ++
Sbjct: 179 YSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFV 238

Query: 184 SIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWR 242
            IF+V++  +N+F  + Y E EF+    K++ + GF I  + + V GAG  G +G +YW 
Sbjct: 239 IIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWH 298

Query: 243 NPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVP 302
           +PG +      NG       +  RF G   +L+ AAF + G+E + IT  E +NPRK +P
Sbjct: 299 DPGAF------NG-----KHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIP 347

Query: 303 RAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTKILPDI 361
            A K++++RIL  ++ ++  +G LVP++ D  L          P++IAI + G +++P  
Sbjct: 348 GAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHF 407

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
            NA+IL++++S  NS+ Y  +R+  +L++ G APK  S   + G P +++  +A+F V+A
Sbjct: 408 VNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIA 467

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           +   +   + VF WL+ I+ ++  + W  I  SHIRF + +K +G S  +L FK+     
Sbjct: 468 FCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVW 527

Query: 482 LAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537
            + YA   M++I+I Q + A  P      D   FF  Y+++ +   ++  +++W K    
Sbjct: 528 GSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTK---D 584

Query: 538 WKL----EDVDIDSNRR--DVEKIIWEDPEPKTFWDK--FWNVVA 574
           WKL    + +D++S+R+  D E I  ED E +       +W  VA
Sbjct: 585 WKLFIRADKIDLESHRQIFDEELIKQEDEEYRERLRNGPYWKRVA 629

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 181/539 (33%), Positives = 293/539 (54%), Gaps = 35/539 (6%)

Query: 32  KKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTP 91
           KK  ++ + D S TTE++    +    D  ++R LK RH                  +  
Sbjct: 26  KKNEVVVELDPSLTTEEDYDPEANIRED--LQRALKPRHINMISIAGVIGTGLYLSTAKS 83

Query: 92  LEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMY 151
           L   GP    + Y  +G + Y     LGEM+T++P++ SF  +A +F S S   A+ + Y
Sbjct: 84  LYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNY 143

Query: 152 WFSWAVTFALELSVVGQIVDYW---TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWV 208
           WF+ AV+ A +++ +  ++DYW       P  A   +FW ++  LN+  V+FYGE E+W+
Sbjct: 144 WFNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWL 203

Query: 209 AAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRN-PGPWGDGLTSNGVEISKNKNTGR 266
           A +KV+AI+ F I  + +  G       +GF+ W +   P+ DG                
Sbjct: 204 AMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNHGEAPFVDG---------------- 247

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G+ +  ++A+F Y GTE + +T GEAANP +  P+ +K V +RIL+FY+GS FFI + 
Sbjct: 248 FKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMN 307

Query: 327 VPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILF 386
           +P+D P L          PF +  + +GTK      NA+I+ ++ISA N  ++ GSR+++
Sbjct: 308 IPYDYPGL--DTKSVVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMY 365

Query: 387 SLAKTGLAP-KILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
           ++   G  P KI+SRT +  VP+VSVL T+  G+L +  +  G  TV+ WL NI  ++  
Sbjct: 366 NMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQ 425

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT 505
            AWL I I+ IRF + L+ +G +  +L +K    P   Y+ V  +  II+ QG++AF P 
Sbjct: 426 IAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP- 483

Query: 506 FDVSDFFAAYISVILF---FLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPE 561
           +DV++FF+ Y+ + +F   F+IW    L+ + R++ KLED+D  ++R    K I E  E
Sbjct: 484 WDVTNFFSYYLDLFVFPFCFIIW---WLYKRDRFV-KLEDMDFVTDRYIPTKEIIELNE 538

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/534 (30%), Positives = 276/534 (51%), Gaps = 23/534 (4%)

Query: 42  ASSTTEDEEMLNSGSVHDA-EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGS 100
           A  +TE++    +  + DA  +K+ +K RH                  ++ L   GP   
Sbjct: 54  AQDSTENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSL 113

Query: 101 LIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTF 159
           +I Y+ V  +TY + Q+ GEMA   P +  +F  + S F+S   G A  ++++  W   F
Sbjct: 114 VIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVF 173

Query: 160 ALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGF 219
            LEL      + YW   +    +I IF+V L  ++ F VK YGE EF   + KV+ I GF
Sbjct: 174 PLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGF 233

Query: 220 LIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAA 278
           +I  + + CG AG  G +G +YWR+PG + +G   + VE        +F G    L+ A 
Sbjct: 234 IILSIVINCGGAGKDGYIGAKYWRDPGSFAEG---DSVE--------KFKGICYILVTAY 282

Query: 279 FTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX 338
           F+Y G EL  ++  E  NPRK+ P+A K+ ++RIL+ Y+ ++  IG  VP ++ +L    
Sbjct: 283 FSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSG 342

Query: 339 -XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKI 397
                  P+++A    G K++P   NA+ILI++IS  NS +Y   R++ SLA+ G APK 
Sbjct: 343 GSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKF 402

Query: 398 LSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIR 457
           L    ++G P  +++  AVFGV+ ++  +   + VF WL  I  ++  + W  I++SH+R
Sbjct: 403 LDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVR 462

Query: 458 FMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFF 512
           F Q +K  G S +++ F+A      + Y +   +++ I Q + A  P       D   FF
Sbjct: 463 FRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFF 522

Query: 513 AAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
            +Y++  ++   +  + L+ +   ++  L+ +D++ +RR  D E I  ED E K
Sbjct: 523 QSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENK 576

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/521 (31%), Positives = 271/521 (52%), Gaps = 29/521 (5%)

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
           D  ++R ++ RH                     L   GP G +I Y  V  + Y + Q+ 
Sbjct: 76  DGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAA 135

Query: 119 GEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           GEMA   P +  +F  ++S F+S   G A  ++Y   W   F LEL      + YWT +V
Sbjct: 136 GEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTDSV 195

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPV 236
               +I+IF+V +  ++ F  + YGE EF     KV+ I GF+I  + + CG AG +G +
Sbjct: 196 NADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYI 255

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           G RYW +PG +  G  ++           +F G+   L+   F+Y GTEL  +T  E ++
Sbjct: 256 GARYWHDPGAFAVGDPAS-----------KFKGFCYVLVTGYFSYGGTELYAMTVNEQSS 304

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX--XXXXXXXPFIIAIENSG 354
           PR+ +  A K+ ++RIL+ Y+ ++  IG LVP    +L            P+++A+   G
Sbjct: 305 PRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHG 364

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            K++P I NA+ILI ++S GNS +Y G R+L +LA+ G APK L+   + G P ++++A 
Sbjct: 365 VKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIAC 424

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
           +V G+LA++  +   + VF WL  I  ++  + W  IL+SHIRF Q +K+ G S   L +
Sbjct: 425 SVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGY 484

Query: 475 KANLMPGL--AYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGA 527
           K+  + GL  + Y V   +++ + Q + A  P       DV  FF +Y++  L+F+ +  
Sbjct: 485 KS--ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLG 542

Query: 528 FQLWFKCRW--IWKLEDVDIDSNR--RDVEKIIWEDPEPKT 564
           + + +   W  +  L+D+DI+  R   D E+I  E  E KT
Sbjct: 543 YMV-YSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKT 582

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/512 (31%), Positives = 277/512 (54%), Gaps = 23/512 (4%)

Query: 60  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119
           A + R LK RH                     L  +GP G LI +    T+   +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 120 EMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVP 178
           E+A   PV+  +  +A+RF+  S G A  + Y     V   LE+      V YW T    
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 179 IAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-G 237
             A++++FWV++ ++N+F V+ +GE E   + +KV+ I+GF+I  + ++ G G    V G
Sbjct: 201 KLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIG 260

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            +YW +PGP+             N  + +F G  +  + AAF++ G+EL+G+ A E   P
Sbjct: 261 GKYWNDPGPF-----------VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREP 309

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXX-XXXXXXXXPFIIAIENSGTK 356
           RK++P+A K+V +RI LFYI SL  +GLLVP ++  L           PF+IA++    +
Sbjct: 310 RKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIR 369

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           +LP I N +IL  +IS GNS++Y  SR + +LA+ G  PKI     +KG P  ++  T++
Sbjct: 370 VLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSL 429

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
           FG+L ++   +    +FDWL+ I+ ++ F+ WL I ++H+RF   LK +G + ++L F +
Sbjct: 430 FGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTS 489

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTA-FTPTFDVSD-------FFAAYISVILFFLIWGAF 528
                 + YAV  + ++++ Q + A + P+ D +        FF  Y+S  +  +++ A 
Sbjct: 490 PTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAH 549

Query: 529 QLWFKC-RWIWKLEDVDIDSNRRDVEKIIWED 559
           ++W +  ++  K +++DID+ RR+++  ++++
Sbjct: 550 KIWSRNWKFFIKAKEMDIDTGRRELDLELFKE 581

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/569 (29%), Positives = 290/569 (50%), Gaps = 32/569 (5%)

Query: 6   SSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQ-TDASSTTEDEEMLNSGSVHD---AE 61
           +SS S  ++ +S V+         D ++  I++   D+     D +++      D   A+
Sbjct: 5   TSSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGTTAK 64

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           +K+ +K RH                   + L  +GP G ++ Y+    + Y + ++ GE+
Sbjct: 65  MKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGEL 124

Query: 122 A-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180
              +  +T ++T ++S  + P++G +V ++Y   W   F L+L     I+ YWT   P  
Sbjct: 125 GICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP-D 183

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFR 239
            +++I + ++  +N+F  K Y E EF+    KV+ I+GF+I  + + CG AG +G +G +
Sbjct: 184 IFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDK 243

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           YW  P P+ +G                F G       AAF Y G E++ ++A E  NPRK
Sbjct: 244 YWHEPRPFMNG----------------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRK 287

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILP 359
           ++  A KKV++RI+L Y+ +   +  LVP D P L          P +IA+   G KI+P
Sbjct: 288 SISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSRAS--PLVIAVSFHGVKIVP 345

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419
            I NA+ILI ++S GNS++Y   R+L SLA+ G APKI +   ++G P  +     VFG+
Sbjct: 346 HIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGL 405

Query: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479
           LA++  +     VF WL+ I+ ++  + W+ I ISHIRF   +K +G S  ++ +KA   
Sbjct: 406 LAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTG 465

Query: 480 PGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWFKC- 534
              ++ AV    +I+I Q + A +P      D   FF +Y++  +  L +  ++++ K  
Sbjct: 466 YWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDW 525

Query: 535 RWIWKLEDVDIDSNRR--DVEKIIWEDPE 561
           R      +VD+ S+R+  D +++  ED E
Sbjct: 526 RICIPASEVDLISHRQVFDEDELKQEDLE 554

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 181/533 (33%), Positives = 294/533 (55%), Gaps = 24/533 (4%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K+I + ++ D + T  ++  + +     + ++ +LK RH                  
Sbjct: 59  DSFKRIEV-EEVDPNLTDIEKIAIKTAR---SPLQHKLKSRHLQMIAIGGAIGTGLFVGS 114

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148
              L  +GP G LI +   GT+ + +  +LGE+A   PV+  F  +A+RF+  S G A  
Sbjct: 115 GKALRTAGPAGILIGWGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANN 174

Query: 149 YMYWFSWAVTFALELSVVGQIVDYWTFAVPIA-AWISIFWVILTALNMFPVKFYGEIEFW 207
           + Y F W V   LE+      VDYW   V     ++++FW+++  +NMF V+ YGE EF 
Sbjct: 175 FNYMFQWLVALPLEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFV 234

Query: 208 VAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGR 266
            + +KV+A++GF+I  + +VCG G  G     RYW +PG +           + +    R
Sbjct: 235 FSLIKVIAVIGFIILGIILVCGGGPVGGYVGGRYWHDPGAF-----------AGHSPGRR 283

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G+ +  + AAF++ G+ELVGI + E+ NPRK+VP+A K+V +RILLFYI  L  +GLL
Sbjct: 284 FKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLL 343

Query: 327 VPFDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRIL 385
           VP+ DP+L           PF+IAI   G   LP + N +ILI+++S GNS+IY  SR L
Sbjct: 344 VPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTL 403

Query: 386 FSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
            +L++ G  PK ++   +KG P V +   + FG++A++  +   + +F+WL+ I+ I+ F
Sbjct: 404 VALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSF 463

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP- 504
             W  I   HIRF   LK  G S D+LPFK+ +    +Y+ +   V++++ Q + A  P 
Sbjct: 464 LTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPI 523

Query: 505 --TFDVSDFFAAYISVILFFLIWGAFQLWFKCRW--IWKLEDVDIDSNRRDVE 553
             + +  DFF+AY++  +    + A +LW K  W  +  L+D+DID+ RR+ +
Sbjct: 524 GSSPNAYDFFSAYLAAPIVLAFYIAHKLW-KRNWKLLIPLKDIDIDTGRRETD 575

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  271 bits (693), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 158/550 (28%), Positives = 281/550 (51%), Gaps = 38/550 (6%)

Query: 44  STTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIA 103
           S T+D +        D  +++ +K RH                   + L  +GP G +I 
Sbjct: 113 SATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIG 172

Query: 104 YIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALE 162
           Y  +G+  Y + Q+ GEMA  +  +  +F  + S  +  + G +V ++Y   W     LE
Sbjct: 173 YAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLE 232

Query: 163 LSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222
           L      + YWT  V    ++ IF+V++  +N+F  K Y E EF+  + KV+ + GF I 
Sbjct: 233 LVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFIL 292

Query: 223 CLCM-VCGAGVTGPVGFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFT 280
            + +   GAG  G +G +YW NPG + GD            K+  RF    ++   AAF 
Sbjct: 293 AIVINTGGAGNDGYIGAKYWHNPGAFRGD------------KSIDRFKDVMSTFTTAAFA 340

Query: 281 YQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX-XX 339
           +  +E + I A E +NPR+ +P A K +++RIL  ++ S+  +G LVP++  +L      
Sbjct: 341 FGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSA 400

Query: 340 XXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILS 399
                P++IA+ + G +++P   NA+IL++++S  NS  Y   RIL+SL++ G AP   +
Sbjct: 401 ATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFN 460

Query: 400 RTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFM 459
              ++G P  +++ +A+F V+A+   +   + VF WL+ I+ ++  + W+ I +SHIRF 
Sbjct: 461 YIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFR 520

Query: 460 QVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAY 515
           + +K +G S D++ FK+ +    + YA   M + +I + + +  P      D  +FF  Y
Sbjct: 521 RAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENY 580

Query: 516 ISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPKT----- 564
           +++ +  +++  +++   C+  WKL    +D+D+ S+R+  D E I  E+ E K      
Sbjct: 581 LAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNG 637

Query: 565 -FWDK---FW 570
            FW K   FW
Sbjct: 638 PFWKKVVAFW 647

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  271 bits (692), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 162/570 (28%), Positives = 299/570 (52%), Gaps = 29/570 (5%)

Query: 5   ESSSQSVPRQRKSGVQTFSTM---SQDDDMKKINIIQQTDASSTTED-EEMLNSGSVHDA 60
           + S+ +V  Q K+  +T       S+    K ++  ++ D   TT D E  L      ++
Sbjct: 56  DESNNAVLIQEKTQEETIHNSDGSSRSPFGKFVDSFKRVDEKQTTSDLESGLGEVPGENS 115

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           ++K+ +K+RH                  +  L D+GP G +I Y  +G+  Y + Q+ GE
Sbjct: 116 DLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGE 175

Query: 121 MA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           +A  +  + S+F ++ +  +  + G AV ++Y   W     LEL      + YWT +V  
Sbjct: 176 LAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNP 235

Query: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGF 238
             ++SIF+V++  +N F  + Y E EF+  + KV+ + GF I  + + CG AG +G +G 
Sbjct: 236 DIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGA 295

Query: 239 RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298
           +YW +PG +      NG     N+    F G   +   AAF +  +E + +TA E +NPR
Sbjct: 296 KYWHSPGAF------NG-----NRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPR 344

Query: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX-XXXXXXXPFIIAIENSGTKI 357
           K +P+A K +++RIL  ++ S+  IG LVP++ P L           P+++A+ + G ++
Sbjct: 345 KAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRV 404

Query: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417
           +P   NA+IL++++S GNS  Y  SR+L SLA+ G APK+ +   K+G P V+++ + +F
Sbjct: 405 VPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLF 464

Query: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477
             +A+   +   + VF WL+ I+ ++  + W+ I ISH+RF + LK +G S  ++ FK+ 
Sbjct: 465 MTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQ 524

Query: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWFK 533
           +    + YA   +++ +I Q + A  P      D  +FF  Y+++ +  +++  +++   
Sbjct: 525 VGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIR-- 582

Query: 534 CRWIWKL----EDVDIDSNRRDVEKIIWED 559
            +  WK       +D+ S+R+  ++ I + 
Sbjct: 583 -KRDWKFWIPAHRIDLVSHRKVFDEDILKQ 611

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  270 bits (689), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 276/538 (51%), Gaps = 22/538 (4%)

Query: 35  NIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLED 94
           +I +    +  T D E        D+++K+ +K RH                  +  L  
Sbjct: 64  SITKTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHY 123

Query: 95  SGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWF 153
            GP   +I Y+ V  +TY + Q+ GEMA   P + ++F  ++S F+S   G A  ++Y F
Sbjct: 124 GGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCF 183

Query: 154 SWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV 213
            W     LEL      + YW   +    +I IF++ L  +++F VK YGE EF     K+
Sbjct: 184 QWLTVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKI 243

Query: 214 VAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFN 272
           + I GF+I  + + CG AG  G +G  YW NPG +  G TS    I++ KN    L    
Sbjct: 244 LMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAFA-GDTS----IARFKNVCYIL---- 294

Query: 273 SLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP 332
             +   F++ G EL  ++  E +NPRK+ P A K+ ++RI++ Y+ ++  IG  VP++D 
Sbjct: 295 --VTGYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDD 352

Query: 333 KLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKT 391
           +L           P+++A    G KI+P I NA+ILI+++S  NS++Y G R++ SL++ 
Sbjct: 353 QLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQ 412

Query: 392 GLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFI 451
           G APK L    ++G P  +++   +FGV+A++  +   + VF WL  I  ++  + W  I
Sbjct: 413 GYAPKFLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSI 472

Query: 452 LISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TF 506
           ++SH+RF Q +K +G S D+L +KA      + Y  F  +++ I Q + A  P       
Sbjct: 473 MLSHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRC 532

Query: 507 DVSDFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPE 561
            V  FF +Y++  ++   +  + ++ +    +  L+ +D+D +RR  D E I  ED E
Sbjct: 533 SVESFFESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQE 590

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  268 bits (685), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/535 (30%), Positives = 276/535 (51%), Gaps = 25/535 (4%)

Query: 43  SSTTEDEEMLNSGS---VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVG 99
           S   ED+  L  G+     +  +K+ +K RH                  +  L+ +GP  
Sbjct: 64  SQHLEDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGS 123

Query: 100 SLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158
            +I Y+ V  +TY + Q+ GEM    P +  +F  + S F+S S G A  +++   W   
Sbjct: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTV 183

Query: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218
             LEL      + YW   +    +I IF+V L  ++ F VK YGE EF  ++ K++ I G
Sbjct: 184 LPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAG 243

Query: 219 FLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277
           F+I  + + CG AGV G +G +YWR+PG + +G   NG          RF G    L+ A
Sbjct: 244 FIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG---NGAT--------RFKGICFILVTA 292

Query: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
            F++ G EL  ++  E +NPRK+ P A K+ V+RIL+ Y+ ++  IG  VP ++ +L   
Sbjct: 293 YFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGS 352

Query: 338 -XXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPK 396
                   P+++A      +++P I NA+ILI++IS  NS +Y   R++ SLA+ G APK
Sbjct: 353 GSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPK 412

Query: 397 ILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHI 456
            L    ++G P  ++    + GV+ ++  +   +  F WL  I  ++  + W  I++SHI
Sbjct: 413 FLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHI 472

Query: 457 RFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDF 511
           RF + +K +G S D++ +KAN     +YY VF  +++ + Q + A +P       +   F
Sbjct: 473 RFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAF 532

Query: 512 FAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           F +Y++  L+  ++  + L+ +   ++  L+ +D+D +RR  D E I  E+ E K
Sbjct: 533 FESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEENK 587

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  268 bits (686), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 162/543 (29%), Positives = 282/543 (51%), Gaps = 27/543 (4%)

Query: 34  INIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLE 93
           +N  +  DA S++  E      +    ++K+ +K RH                     L 
Sbjct: 92  LNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLS 151

Query: 94  DSGPVGSLIAYIFVGTLTYAVTQSLGEMAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYW 152
            +GP   +I Y  +GT  Y + Q+ GE+A  +  +   F  + S  + P++G +V ++Y 
Sbjct: 152 KAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYC 211

Query: 153 FSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVK 212
             W     LEL      + YWT  V    ++ IF+V++ A+N F  + Y E EF+    K
Sbjct: 212 LQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCK 271

Query: 213 VVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWF 271
           V+ + GF I  + +  G AG  G +G +YW +PG +      NG     +K+  RF G  
Sbjct: 272 VLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF------NG-----DKSIDRFKGVM 320

Query: 272 NSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD- 330
           ++ + AAF +  TE + +TA E +NPRK +P A KKV++RI+  ++ S+  IG LVP++ 
Sbjct: 321 DTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNS 380

Query: 331 DPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAK 390
           D  L          P++IA+ + G +++P   NA+IL++++S GNS  Y  SR+L SLA+
Sbjct: 381 DQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQ 440

Query: 391 TGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLF 450
            G APK      ++G P+ ++L +A+FGV+A+  T+     VF WL+ I+ ++  + W+ 
Sbjct: 441 QGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWIT 500

Query: 451 ILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP----TF 506
           I +SHIRF + ++ +G S  ++ + +      + YA   + + +I Q + A  P      
Sbjct: 501 ICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKL 560

Query: 507 DVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDP 560
           D  +FF  Y+++ +    +  +++W   +  WKL    +D+D+D++R+  D   +  ED 
Sbjct: 561 DAENFFQNYLAMPILIAFYFGYRVW---KRDWKLFIRAKDIDLDTHRQIFDENILRQEDE 617

Query: 561 EPK 563
           E K
Sbjct: 618 EYK 620

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  266 bits (680), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 175/551 (31%), Positives = 288/551 (52%), Gaps = 42/551 (7%)

Query: 17  SGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA------------EVKR 64
           S  Q+F   S+D  + K N+++   ++   ++ E+    S+ DA             + R
Sbjct: 3   SSKQSFD--SRDTGLLK-NVVKDPKSAPVVQNYEVTPLDSISDAVTDLEDHDKIRESLNR 59

Query: 65  ELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATF 124
            L  RH                  +  L   GP    I Y  +G + Y     LGEM+TF
Sbjct: 60  SLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTF 119

Query: 125 IPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA---VPIAA 181
           +P++ SF  +A +F   S   A+   YWF+ AV+ A +L+ +  ++DYW  +    P  A
Sbjct: 120 MPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFPYWA 179

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRY 240
              +FWV L  LN+  V+ YGE E+W+A +KV+AIV F I  + +  G       +GF+Y
Sbjct: 180 ASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKY 239

Query: 241 WR-NPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           W     P+ +G                F G+    +++AF+Y GTE + +TAGEA NP +
Sbjct: 240 WSYKEAPFVNG----------------FKGFVTIFVSSAFSYGGTESITLTAGEARNPIR 283

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILP 359
             PR +K V +RIL+FY+ ++FFI + +P+D P L          PF I  + +GTK   
Sbjct: 284 NTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNL--STKSVMTSPFTIIFQMAGTKAAG 341

Query: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLA-PKILSRTTKKGVPWVSVLATAVFG 418
              NA+IL +I+SAGN  ++ GSR+L+++   G   PK++++T +   P+V+V+ T   G
Sbjct: 342 SFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVG 401

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
            L +  +  G  T++ WL NI  ++   AWL I ++ IRF + L  +G ++ +L FK   
Sbjct: 402 GLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWT 460

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIW 538
            P   Y+ V  + +II+ QG++AF P +  SDFF+ Y+ + +F   W  + ++ + R++ 
Sbjct: 461 YPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV- 518

Query: 539 KLEDVDIDSNR 549
           K ED+D  ++R
Sbjct: 519 KPEDMDFITDR 529

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  268 bits (685), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 162/568 (28%), Positives = 287/568 (50%), Gaps = 32/568 (5%)

Query: 12  PRQRKSGVQTFSTMSQDDDMKKI--NIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQR 69
           P  RK  V +F     D++  +   N +  T + S ++      +G   DA +++ ++ R
Sbjct: 69  PHVRKF-VDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGD-DDAHLQKSIRPR 126

Query: 70  HXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVT 128
           H                   + L  +GP   +I Y  +G+  Y + Q+ GEMA  +  + 
Sbjct: 127 HVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLP 186

Query: 129 SSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWV 188
            +F  + S  +   +   V ++Y   W     LEL      +DYWT  V    ++ IF+V
Sbjct: 187 GNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFV 246

Query: 189 ILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPW 247
           ++T +N F  K Y E EF+  + KV+ + GF I  + +   GAG  G +G +YW NPG +
Sbjct: 247 LITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 306

Query: 248 GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKK 307
                        +K+  RF    ++   AAF +  +E + I A E +NPR+ +P A K 
Sbjct: 307 -----------RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKT 355

Query: 308 VVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXX--PFIIAIENSGTKILPDIFNAI 365
           +++RIL  ++ S+  +G LVP+D  +L            P++IA+ + G +++P   NA+
Sbjct: 356 MIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAV 415

Query: 366 ILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMET 425
           IL++++S  NS  Y   RIL+SLA+ G APK      ++G P  ++L T +FGV+A+   
Sbjct: 416 ILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSC 475

Query: 426 TQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYY 485
           +   + VF WL++I  ++  + W  I +SHIRF + +K +G S D++ FK+ +    + Y
Sbjct: 476 SDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGY 535

Query: 486 AVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL- 540
           A   M++ +I + + +  P      D  +FF  Y+++ +  +++  ++++ K    WKL 
Sbjct: 536 AAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKK---DWKLF 592

Query: 541 ---EDVDIDSNRR--DVEKIIWEDPEPK 563
              +D+D+ S+R   D E +  E+ E K
Sbjct: 593 IRAKDIDLISHRTIFDGELVRQEEEEYK 620

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  267 bits (683), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 162/535 (30%), Positives = 273/535 (51%), Gaps = 25/535 (4%)

Query: 43  SSTTEDEEMLNSGS---VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVG 99
           S   E+   L  G+     +  +K+ +K RH                  +  L+ +GP  
Sbjct: 64  SQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGS 123

Query: 100 SLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158
            +I Y+ V  +TY + Q+ GEM   +  +  +F  + S F+S S G A  +++   W   
Sbjct: 124 LVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183

Query: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218
             LEL      + YW  ++    +I IF+V L  ++ F VK YGE EF   + K++ + G
Sbjct: 184 LPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAG 243

Query: 219 FLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277
           F+I  + + CG AGV G +G +YWR+PG + DG            N  RF G    L+ A
Sbjct: 244 FIILSVVINCGGAGVDGYIGGKYWRDPGSFADG-----------SNATRFKGICFILVTA 292

Query: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
            F++ G EL  ++  E +N RK+ P A K+ V+RIL+ Y+ ++  IG  VP ++ +L   
Sbjct: 293 YFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGS 352

Query: 338 -XXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPK 396
                   P+++A      +++P I NA+ILI++IS  NS +Y   R++ SLA+ G AP+
Sbjct: 353 GSAATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPR 412

Query: 397 ILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHI 456
            L+   ++G P  ++   A+ GV+ ++  +   +  F WL  I  ++  + W  I++SHI
Sbjct: 413 FLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHI 472

Query: 457 RFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDF 511
           RF + +K +G S  +L +KAN     +YY VF  +++ + Q + A +P       DV  F
Sbjct: 473 RFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAF 532

Query: 512 FAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           F  Y++  L+  ++  + L+ K    +  L+ +D+D +RR  D E +  ED E K
Sbjct: 533 FEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  267 bits (683), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 175/555 (31%), Positives = 285/555 (51%), Gaps = 34/555 (6%)

Query: 39  QTDASSTTEDEEMLNSGSVHD-----AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLE 93
           + D+ S T DE    SG + +      ++ ++L  RH                     L 
Sbjct: 70  KGDSHSLTRDEA--GSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALS 127

Query: 94  DSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWF 153
             GP   +I ++ + T  + V  SLGE+A   PV   F V+ +RF+ PS G AV   Y  
Sbjct: 128 SGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLA 187

Query: 154 SWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV 213
            W V   LEL      + YW   +   AW++IF+  +   NM  VK +GE EF ++ +K+
Sbjct: 188 QWLVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKI 247

Query: 214 VAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFN 272
           +AIVGF I  + + CG G  G     +YW +PG +          + +   T +F G  +
Sbjct: 248 LAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAF----------VGETSGT-KFKGLCS 296

Query: 273 SLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP 332
             + AAF+Y G EL  ++A E+ NPR+T+P+A K+  + I L Y+  L  IG LVP+++P
Sbjct: 297 VFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNP 356

Query: 333 KLX--XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAK 390
           KL            P +IAIEN G + LP + NAIILI I+S  NS +Y  SR + S+A+
Sbjct: 357 KLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAR 416

Query: 391 TGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLF 450
               P+ L R  +KG P  + L T  FG+L+++  +   + VF WL  ++ ++  +AW+ 
Sbjct: 417 IRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMA 476

Query: 451 ILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----F 506
           I +SHIRF Q +  +GIS D+LP+ +      ++Y V  + ++++   +T+  P      
Sbjct: 477 INLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGA 536

Query: 507 DVSDFFAAYISVILFFLIWGAFQLWF-KCRWIWKLEDVDIDSNRR--DVE------KIIW 557
           D + FF  Y+S  +  + +   +L+  K R +  + D+D+ S+R+  DVE      +I  
Sbjct: 537 DATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEK 596

Query: 558 EDPEPKTFWDKFWNV 572
           E    ++F+ +F ++
Sbjct: 597 EQLAKRSFFARFLHL 611

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  267 bits (682), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 166/580 (28%), Positives = 292/580 (50%), Gaps = 50/580 (8%)

Query: 18  GVQTFSTMSQDDDMKKINI----IQQTDASSTTEDEEMLNS---------GSVHDAE--- 61
           G+Q   + +  + ++K+++     Q  D    +  + + NS         G   DAE   
Sbjct: 12  GLQDLKSNTGSESIEKVSLPASDYQYHDGQVLSRFQRLTNSFKRAGEHGRGGDVDAEGQP 71

Query: 62  -------VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
                  +K+ +  RH                     L + GP G  I Y  +G+  Y +
Sbjct: 72  VAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCI 131

Query: 115 TQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173
            Q+ GEMA ++  ++ +F  + S  + P++G +V ++Y   W     LEL      + YW
Sbjct: 132 IQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYW 191

Query: 174 TFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGV 232
           T AV    ++ IF+V+   +N+F  + Y E EF+    KV+ I GF I  + + CG AG 
Sbjct: 192 TTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGN 251

Query: 233 TGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAG 292
            G +G +YW +PG            +   K    F G   +++ AAF +  TE + +TA 
Sbjct: 252 DGYLGGKYWHDPG-----------ALYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAA 300

Query: 293 EAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIE 351
           E ANPR+ +P A KK+V+R+LL ++  +  +G LVP++ D  +          P++IAI 
Sbjct: 301 EQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIA 360

Query: 352 NSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSV 411
           + G K++P   NA+IL++++S GNS  Y  SR+L SL++   AP  L+   ++G P  ++
Sbjct: 361 SHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAM 420

Query: 412 LATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDD 471
           L + +FG++A++  +   +TVF WL+ I+ ++  + W+ I +SHIRF + L  +G S  +
Sbjct: 421 LVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGE 480

Query: 472 LPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGA 527
           L +K+      +YYA   M  ++  Q + A  P      D ++FF  Y+++ +   ++  
Sbjct: 481 LGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFG 540

Query: 528 FQLWFKCRWIWK----LEDVDIDSNRR--DVEKIIWEDPE 561
           +++W   +  WK    LE +D+ S+R+  D + +  ED E
Sbjct: 541 YRVW---KRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAE 577

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  265 bits (678), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 255/476 (53%), Gaps = 17/476 (3%)

Query: 62  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121
           +K  LK RH                   T L   GP   LI +   GT+ YA+  +LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIA 180
           A   P++  FT +A+RF+  S G A  + Y   W V   LE+      V++W T      
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-R 239
            ++++FWV++  +NMF VK YGE EF  + +KV+ +VGF+I  + + CG G  G     +
Sbjct: 206 GFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGK 265

Query: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299
           YW +PG +           + +    +F G  +  + +AF++ G+ELVG+ A E+  PRK
Sbjct: 266 YWHDPGAF-----------AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRK 314

Query: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKIL 358
           +VP+A K+V +RI LFYI SL  IGLLVP++D  L           PF+IAI+  G K L
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGL 374

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           P + N +ILI ++S GNS IY  SR + +LA+    P+I +   +KG P V +  T+ FG
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFG 434

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
           ++A++  ++    VF+WL+ ++ ++  + W  I I HIRF + L  +G   D+L FK+  
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTP---TFDVSDFFAAYISVILFFLIWGAFQLW 531
               +Y+ +F +VI+ I Q + A  P   +     FF AY+S  L   ++   +++
Sbjct: 495 GVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIY 550

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  268 bits (686), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/539 (30%), Positives = 274/539 (50%), Gaps = 42/539 (7%)

Query: 27  QDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXX 86
           +++++  +N   +   +S    E+M   G          +K RH                
Sbjct: 128 KNENIYALNDDLEDGTTSIAASEDMPKKGG---------MKARHVIMMTLATGIGTGLLV 178

Query: 87  XXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGA 145
             +  L  SGP G ++ Y  V  +TY V Q+ GEMA   P +   F  + S F+S   G 
Sbjct: 179 ANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGF 238

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
           A  +++  +W     LEL      V YWT ++    ++ IF++ L  ++   ++ Y E E
Sbjct: 239 ATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAE 298

Query: 206 FWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNT 264
           F+  + K++ I GF+I+ + + CG AG  G +G +YW +PGP+    + NG         
Sbjct: 299 FFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPFA---SDNG--------A 347

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
            RF      LINA F+Y GTEL  ++  E  NPRK VP A K  V+R+ + Y+ ++  IG
Sbjct: 348 ARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIG 407

Query: 325 LLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
             VP++ P L          P+++A +  G KI+P   NA+IL+++IS  NS ++ G R+
Sbjct: 408 FNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRL 467

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L +LA+ G APK L+   + G P +++   ++FGV+A+  T++    VF WL  I  ++ 
Sbjct: 468 LATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSE 527

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGL--AYYAVFCMVIIIIFQGFTAF 502
            +AW  IL+SHIRF   +K+ G S D++ +KA  + G+  +YY +F  ++++I Q + A 
Sbjct: 528 LFAWSGILLSHIRFRWAMKYHGKSMDEVGYKA--ITGIWGSYYGLFFNLLVLIAQFWVAL 585

Query: 503 TPTFDVSDFFAAYISVILFFLIWGAFQLW---FKCRWIWK--------LEDVDIDSNRR 550
           +            ++ I FF  + AF +W   + C  I+         L+D+D+D  RR
Sbjct: 586 SAPGS-----GGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRR 639

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  265 bits (678), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 176/552 (31%), Positives = 288/552 (52%), Gaps = 37/552 (6%)

Query: 23  STMSQDDDMKKINI----IQQTDASSTTEDEEMLNSGSVHD--AEVKRELKQRHXXXXXX 76
           S  SQD +  K       ++  D  ST   +E L  G +H+   ++K+ LK+RH      
Sbjct: 2   SISSQDKEKVKATAYEADVEDCDIRST---DETLKQGVLHNDRTKLKQGLKERHIKMLTL 58

Query: 77  XXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFAS 136
                          L+ +GPVG LIAY+FVG +      ++ E+A+F+P T +    A 
Sbjct: 59  VGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAE 118

Query: 137 RFLSPSIGAAVGYMYWFSWAVTFAL----ELSVVGQIVDYWTFAVPIAAWISIFWVILTA 192
           +F+  S+G      + F W  T++     ELS    I+ YWT   P A +I+IF V+   
Sbjct: 119 QFIDESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVV 171

Query: 193 LNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDG 250
            N++ ++FYGE+E+    +K++ I   +I  L +  G GV G   +GF YWR+PGP+ + 
Sbjct: 172 TNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLG-GVKGQERLGFHYWRDPGPFAEY 230

Query: 251 LTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVF 310
           +    +        G+F+G++++L +  ++Y G + + I AGE  N R  +    K V  
Sbjct: 231 IVGGSI--------GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFL 282

Query: 311 RILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITI 370
           RI++ Y+ ++F + L+VP++D  +          PF+IA+  +G K+LP I NA++L + 
Sbjct: 283 RIIVLYLVTVFVLTLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSA 342

Query: 371 ISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQ 430
            SAGN  I  GSR LF LA    APKI  +T+K+G+P+V V+  + F  LAYM  ++   
Sbjct: 343 WSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSS 402

Query: 431 TVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCM 490
           TVF W   + +      W+ I  +HI   + LK +G SR DLP+   + P  A+++    
Sbjct: 403 TVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMS 462

Query: 491 VIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNR 549
            I ++  GF  F    FD+  FF  Y  + L   ++  ++L+ K R++ + E+VD+ S  
Sbjct: 463 FIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYL-RPEEVDLASIF 521

Query: 550 RDVEKIIWEDPE 561
            D+     E+PE
Sbjct: 522 DDIR----ENPE 529

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  267 bits (682), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 166/530 (31%), Positives = 265/530 (50%), Gaps = 29/530 (5%)

Query: 57  VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQ 116
           +H + + ++L  RH                     L   GP   +I +  V T  + V  
Sbjct: 81  IHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVIN 140

Query: 117 SLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA 176
           SLGE+A   PV   F V+ +RF+ PS   +V   Y   W V   LEL      + YW   
Sbjct: 141 SLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDT 200

Query: 177 VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVC-GAGVTGP 235
           +   AW++IF+ ++   N+  VK +GE EF ++ VK++AI+GF I  + + C G    G 
Sbjct: 201 INSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGY 260

Query: 236 VGFRYWRNPGPW-GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEA 294
           +G +YW +PG + GD   S G +         F G  +  + AAF+Y G E++ ++A E+
Sbjct: 261 IGGKYWHDPGAFVGD---SAGTQ---------FKGLCSVFVTAAFSYAGIEMIAVSAAES 308

Query: 295 ANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXXXPFIIAIEN 352
            NPRKT+P A K+  + I   YI  L  +G LV ++D +L            P +IAIEN
Sbjct: 309 QNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIEN 368

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
            G K LP + NAIILI I+S  NS +Y  SR + S+A  G  PK LS   K+G P  ++ 
Sbjct: 369 GGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIF 428

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
            T  FG+L+++  +   + VF WL  ++ ++  + W+ I I+HIRF Q +  +  S D++
Sbjct: 429 TTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEM 488

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAF 528
           P+ +      +YY    + +++I   +T+  P      D   FF  Y+S  +    +   
Sbjct: 489 PYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGH 548

Query: 529 QLWFKC-RWIWKLEDVDIDSNRRDVE--------KIIWEDPEPKTFWDKF 569
           +L+FK  R +  LE++D+ + R++V+        KI  E     +F  +F
Sbjct: 549 KLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQSSFMKRF 598

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 153/532 (28%), Positives = 266/532 (50%), Gaps = 22/532 (4%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
            D  K+ ++++  D       EE     +    ++K  +K RH                 
Sbjct: 39  KDSFKRADVVE--DVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVA 96

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAA 146
               L   GP G LI Y+   T+ Y V Q+  E+   +  +  ++  + +  +    G A
Sbjct: 97  SGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFA 156

Query: 147 VGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
           V  +Y   WA+   LEL      + YWT +V    +++IF++ +  ++ F  + Y E EF
Sbjct: 157 VALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEF 216

Query: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGR 266
               +KV+ + GF+I  + + CGA   G +G +YW NPG +         E S N   G 
Sbjct: 217 IFNTLKVLLMAGFIIMGISLNCGASKLGYIGAKYWSNPGTFAG-------ERSINHLKGI 269

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
              W    + +AF Y G+E + +TA E ANPR++VP A K+ ++R+++ ++  +  I  L
Sbjct: 270 CSVW----VQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFL 325

Query: 327 VPFDDPKLXXXXXXXXXX--PFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
           VP+   +L            PF+IA    G KI+P I NAIIL ++IS GNS +Y   RI
Sbjct: 326 VPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRI 385

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L SLA+ GL PKI +   + G P  ++L   VFG+L+++  ++  ++VF WL  I  ++ 
Sbjct: 386 LLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQ 445

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            + W  I +SHIRF   +K +G S  +L + +      +YYAVF  +++++ Q + A  P
Sbjct: 446 LFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAP 505

Query: 505 -----TFDVSDFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR 550
                  D   FF  Y++  +  L +  +++W++  + +  ++ +D++++R+
Sbjct: 506 IDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQ 557

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 160/535 (29%), Positives = 276/535 (51%), Gaps = 25/535 (4%)

Query: 43  SSTTEDEEMLNSGSVH---DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVG 99
           S   E++  L  G+     +  +K+ +K RH                  +  L  +GP  
Sbjct: 64  SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGS 123

Query: 100 SLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158
            +I Y+ V  +TY + Q+ GEM    P +  +F  + S F+S S G A  +++   W   
Sbjct: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183

Query: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218
             LEL      V YW   +    +I IF+V L  ++ F VK YGE EF   + K++ + G
Sbjct: 184 LPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAG 243

Query: 219 FLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277
           F+I  + + CG AGV G +G +YWR+PG + +G               RF G    L++A
Sbjct: 244 FIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----------SGATRFKGICYILVSA 292

Query: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
            F++ G EL  ++  E +NPRK+ P A K+ V+RIL+ Y+ ++  IG  VP ++ +L   
Sbjct: 293 YFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGS 352

Query: 338 X-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPK 396
                   P+++A      +++P I NA+ILI++IS  NS +Y   R++ SLA+ G APK
Sbjct: 353 GGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPK 412

Query: 397 ILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHI 456
            L+   ++G P  +++  ++ GV+ ++  +   +  F WL  I  ++  + W  I++SHI
Sbjct: 413 FLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHI 472

Query: 457 RFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDF 511
           RF + +K +G S D++ +KAN     +YY VF  +++ + Q + A +P       D   F
Sbjct: 473 RFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAF 532

Query: 512 FAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           F +Y++  L+  ++  + ++ +   ++  L+ +D+D +RR  D E +  ED E K
Sbjct: 533 FESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 171/534 (32%), Positives = 276/534 (51%), Gaps = 24/534 (4%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
            D  K ++    TD  S   D E +   + H A +K  LK RH                 
Sbjct: 51  KDSFKPLDEAVVTDDMS---DIEKIAHRTAH-APLKHHLKNRHLQMIAIGGAIGTGLFVG 106

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
             T L  +GP G LI +   GT+ Y +  ++GE++   P++  FT +A+RF+  S G A 
Sbjct: 107 SGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFAN 166

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206
            + Y   W     LE+      V+YW T       ++++FWV++  +N+F VK YGE EF
Sbjct: 167 NFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEF 226

Query: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGF-RYWRNPGPW-GDGLTSNGVEISKNKNT 264
             + +KV+ ++GF+I  + + CG G  G     +Y+ +PG + GD               
Sbjct: 227 VFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGD------------TAG 274

Query: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324
            RF G  +  + AAF++ G+EL+GI A E+A PRK+VP+A K+V +RI LFY+ SL  +G
Sbjct: 275 ARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVG 334

Query: 325 LLVPFDDPKLXXXXXX-XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSR 383
           LLVP+ D +L           PF+IAI + G + LP + N +ILI ++S GNS +Y  SR
Sbjct: 335 LLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSR 394

Query: 384 ILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIA 443
            L +LA+    PKI     + G P   +  T+ FG++A++  ++    VF WL+ ++ ++
Sbjct: 395 TLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLS 454

Query: 444 GFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT 503
             + W  I   HIRF   L  +G S D+LPFKA      + + +F +V++ + Q + A  
Sbjct: 455 SLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALF 514

Query: 504 PTF---DVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVE 553
           P         FF +Y+S  +    +   +L+ +  + +  L  +DID+ RR+++
Sbjct: 515 PPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMD 568

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  265 bits (676), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 181/548 (33%), Positives = 283/548 (51%), Gaps = 29/548 (5%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVK----RELKQRHXXXXXXXX 78
           S++S  + +K  +  Q+    S++ D + L S    +  ++    R L  RH        
Sbjct: 3   SSISDREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAG 62

Query: 79  XXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRF 138
                     +  L + GP    + Y  +G + Y     LGEM+TF+P++ SF  +A +F
Sbjct: 63  IIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKF 122

Query: 139 LSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA---VPIAAWISIFWVILTALNM 195
            S S   A+ + YWF+ AV+ A +L+ +  ++DYW  A    P      IFW  +  LN+
Sbjct: 123 GSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNV 182

Query: 196 FPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSN 254
             V+ YGE E+W+A +KV+AIV F I  + +  G       +GF+ W +    G+    N
Sbjct: 183 IHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTH----GEAPFVN 238

Query: 255 GVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILL 314
           G           F G+ +  ++A F Y GTE + +T GEA+NP +  P+ +K V +RIL+
Sbjct: 239 G-----------FKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILI 287

Query: 315 FYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAG 374
           FY+ S FFIG+ +P+D P L          PF +  + +GT+      NA+IL ++ISA 
Sbjct: 288 FYVLSTFFIGMNIPYDYPGL--STKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISAC 345

Query: 375 NSNIYVGSRILFSLAKTGLAP-KILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVF 433
           N  ++ GSRI++++A  G  P KI+ RT +   P+V+VL T   G L    +  G  T++
Sbjct: 346 NHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLW 405

Query: 434 DWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVII 493
            WL NI  ++   AWL I I+ IRF + L+ +G   D L FK    P   Y+ V   V I
Sbjct: 406 TWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFI 464

Query: 494 IIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVE 553
           I+ QG+ AF P + V+DFF+ Y+ + +F  ++  + LW K  W  K ED+D  ++R    
Sbjct: 465 ILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYIIWWLW-KRDWFVKYEDMDFVTDRYIPT 522

Query: 554 KIIWEDPE 561
           K I E  E
Sbjct: 523 KEIVELNE 530

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  265 bits (678), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 169/545 (31%), Positives = 272/545 (49%), Gaps = 40/545 (7%)

Query: 20  QTFSTMSQDDDMKKINIIQQ-TDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXX 78
            T ST+      K+ NIIQ+  D+     D      GS H   +K+ LK RH        
Sbjct: 37  STPSTVVNHRGTKR-NIIQRMVDSFKPPLD------GSFHSDNLKKSLKARHLIMIAIGG 89

Query: 79  XXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRF 138
                        L   GP+  +I +   GT        LGE+    PV  +F  + +RF
Sbjct: 90  SIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRF 149

Query: 139 LSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPV 198
           L PSI   V  +Y   W     LE+      V+YW  +VP  AW++IF+  +  +N+  V
Sbjct: 150 LEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGV 209

Query: 199 KFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVE 257
           + +GE EF  + +KV+ I+GF+I C+ ++CG G     VG +YW +PGP  +G       
Sbjct: 210 RGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPLANG------- 262

Query: 258 ISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYI 317
                    F G     + A+++  GTE+  + +GE  +P K +P AIK+V +RI+ F++
Sbjct: 263 ---------FKGVAAVFVIASYSLGGTEMACLASGET-DP-KELPSAIKQVFWRIVFFFL 311

Query: 318 GSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSN 377
            SL  +G LVP+ +  L          PF+IAI   G K LP + NA+IL++++S GNS 
Sbjct: 312 VSLTLVGFLVPYTNENLMGGSSVDNS-PFVIAIRLHGIKALPSVVNAVILVSLLSVGNSC 370

Query: 378 IYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLV 437
           I+  SR L S+A  GL P+I     + G P V +L    FG+LA++  +     VF WL+
Sbjct: 371 IFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLM 430

Query: 438 NITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQ 497
            I  +A    WL I +SHIRF   +K +G+S D+L F + +    + Y+    V+I++ Q
Sbjct: 431 AIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQ 490

Query: 498 GFTAF-------TPTFDVSDFFAAYISVILFFLIWGAFQLWFKCR----WIWK-LEDVDI 545
            + +        +P+    +FF  Y+  ++  L++   +++++      W +K L D+D+
Sbjct: 491 FYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYYRISTGKWWGFKALRDIDL 550

Query: 546 DSNRR 550
            ++ R
Sbjct: 551 LTDMR 555

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  265 bits (678), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 167/562 (29%), Positives = 282/562 (50%), Gaps = 30/562 (5%)

Query: 15  RKSGVQT--FSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXX 72
            K+ VQ   F     D+   +  +     A     D+E L   + H+ ++K+ ++ RH  
Sbjct: 41  EKASVQKSDFEYFEGDETKFRRFVNSFKKAPGRENDQESLQDNNKHE-KLKQTIRPRHVV 99

Query: 73  XXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSS-F 131
                              L + GP G  + +  +GT  Y V Q+ GEMA   P  S  F
Sbjct: 100 MISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGF 159

Query: 132 TVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILT 191
             + S  + P  G A  ++Y   W   F LEL      + YWT A+    ++++F++++ 
Sbjct: 160 NAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTAINPDIFVAVFYLLII 219

Query: 192 ALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGA-GVTGPVGFRYWRNPGPWGDG 250
            +N F  + Y E EF+    KV+ I+GF I  + +  GA G  G +G +YWR PG +G  
Sbjct: 220 VINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGG- 278

Query: 251 LTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVF 310
                     +     F G  ++L+NAAF+   +E V +TA E ANPRK+VP A KK+++
Sbjct: 279 ----------HTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVPSAAKKMLY 328

Query: 311 RILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILIT 369
           ++ + ++GS+  IG LVP +  +L           P++IA+ + G +++P   NA+IL++
Sbjct: 329 KVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPHFINAVILLS 388

Query: 370 IISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGG 429
           ++S GNS  Y  SR+L SLA+ G AP +     ++G P ++++ +   G L ++  +   
Sbjct: 389 VLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCLCFVAASPKE 448

Query: 430 QTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFC 489
           +TVF WL+ I+ ++  + W  I ISHIRF + L  +G   D L FKA      +YY+   
Sbjct: 449 ETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSYYSAVI 508

Query: 490 MVIIIIFQGFTAFTPTF----DVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKL----E 541
           M++  I Q +T   P      +   FF  Y++  +F  ++  ++++ K    W+L    E
Sbjct: 509 MILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKN---WQLFIPAE 565

Query: 542 DVDIDSNRR--DVEKIIWEDPE 561
            +D+D +R+  D + +  ED E
Sbjct: 566 KIDLDLHRKIFDADVLKQEDAE 587

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  265 bits (676), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 173/575 (30%), Positives = 285/575 (49%), Gaps = 53/575 (9%)

Query: 38  QQTDASSTTED--------------EEMLNSGSVHD-------AEVKRELKQRHXXXXXX 76
           + TDAS T+ D              E+ +  GS+ D        EV R LK RH      
Sbjct: 19  EMTDASLTSRDHSTNQKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIAL 78

Query: 77  XXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVT--SSFTVF 134
                        T L   GP   LI+Y  +    +A+   + EM   IP++  SS    
Sbjct: 79  GGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASL 138

Query: 135 ASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALN 194
           A  +L+       G+  +++ ++    E++    +++YWT A   A +++IF ++ T L+
Sbjct: 139 AGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTDA-NAAIFVTIFMILATLLS 197

Query: 195 MFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDGLT 252
           + PVK +GE EF V+ +K++ I+G ++  + +  G G      +GF YW  PG +   L 
Sbjct: 198 LLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLV 257

Query: 253 SNGVEISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFR 311
                     +TG FL  + ++I + F +    E+    + EAA PRK +PRA ++ V+R
Sbjct: 258 KG--------STGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYR 309

Query: 312 ILLFYIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIIL 367
           + +FY+     IG++V +D+  L              PF+I I+ +G +ILP I NA IL
Sbjct: 310 LAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACIL 369

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
            +  S   S +Y  SR+L SLA  G APK  S+  K GVP+ SV AT++FGVLAY+  ++
Sbjct: 370 TSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSK 429

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
               VF+WL NI  I+GF  W+F+ I+++RF ++  +  I+ D +P++      LAY + 
Sbjct: 430 SSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYASA 488

Query: 488 FCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDID 546
               ++ I  GF  F    ++VSDFF  Y+++    +++    +++K    W   D+D+ 
Sbjct: 489 IFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYK---EWTFRDMDV- 544

Query: 547 SNRRDVEKIIWED--------PEPKTFWDKFWNVV 573
             R  + KI   D        P PK + ++ W +V
Sbjct: 545 VGREIMPKIDQADQEEKEEYLPPPKNWVERVWRIV 579

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  264 bits (674), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 158/516 (30%), Positives = 272/516 (52%), Gaps = 18/516 (3%)

Query: 56  SVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVT 115
           S+ +   +R+L  R                    T +   GP   LIA+     +   ++
Sbjct: 39  SLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLS 98

Query: 116 QSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF 175
           Q +  M T++PVT SF  F  RF+  S G +VG+ Y+   A     E++ V  +V++WT 
Sbjct: 99  QCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTD 158

Query: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235
            +P AA ISI   +  +LN+F V  +GE EF+++  KV+  +G + + + ++ G      
Sbjct: 159 KIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHK 218

Query: 236 V-GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEA 294
           V GF+ W NPG + +        ISK  + G+F G+ + LI A + + G + +G  A EA
Sbjct: 219 VLGFKNWSNPGAFAE-------YISKG-SAGKFHGFMSCLIFALYVFWGVDYLGNAASEA 270

Query: 295 ANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAI 350
            NPRK +P + +KV  R+++FYIG    +G+LVPF+D  +              P++ A+
Sbjct: 271 MNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAM 330

Query: 351 ENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVS 410
           +  G  +LP I N +IL +IISAGNS++Y  SR+L  LA  G APK+  + TK+GVP   
Sbjct: 331 KTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYC 389

Query: 411 VLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRD 470
            +A  +   LAY+  +     V  W +N+   A    ++FI IS+++F +  K + I   
Sbjct: 390 CVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLK 449

Query: 471 DLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-TFDVSDFFAAYISVILFFLIWGAFQ 529
            LP+ ++ +P L ++++F +V+++   G+  F   ++D+  F  +Y  +  F +++   +
Sbjct: 450 TLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHK 509

Query: 530 LWFKCRWIWKLEDVDIDSNRRDV--EKIIWEDPEPK 563
           L+ K R++  +E +D+ S   ++  E   WE+  PK
Sbjct: 510 LYKKTRFVKPVE-MDLFSGIAELAEEDAYWEENPPK 544

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  265 bits (676), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 166/551 (30%), Positives = 276/551 (50%), Gaps = 41/551 (7%)

Query: 33  KINIIQQT-DASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTP 91
           K NI Q+  D+  +  D      GS   + +KR LK RH                     
Sbjct: 54  KRNIFQRCVDSFKSPLD------GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKA 107

Query: 92  LEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMY 151
           + + GP+G +I +   G+        LGE+    PV  +F  + +RFL PSI   V  +Y
Sbjct: 108 IAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIY 167

Query: 152 WFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAV 211
              W     LE+      V YW  ++    W++IF+ ++ ++N+F V+ +GE EF  + +
Sbjct: 168 VLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTI 227

Query: 212 KVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGW 270
           K + + GF+I C+ ++CG G     +G +YW +PG   +G                F G 
Sbjct: 228 KAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANG----------------FPGV 271

Query: 271 FNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD 330
            + L+ A+++  G E+  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVP+ 
Sbjct: 272 LSVLVVASYSLGGIEMTCLASGE-TDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYT 329

Query: 331 DPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAK 390
           +  L          PF+IAI+    K LP I NA+ILI+++S GNS I+  SR L S+A 
Sbjct: 330 NQNL-LGGSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAH 388

Query: 391 TGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLF 450
            GL P       + G P V ++A ++FG+LA++  +     VF+WL+ I  +A    WL 
Sbjct: 389 QGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLS 448

Query: 451 ILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP------ 504
           I +SHIRF   +K +G S D+L F + +    + Y+     +I+I Q + +  P      
Sbjct: 449 INLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTS 508

Query: 505 -TFDVSDFFAAYISVILFFLIWGAFQLWFKC---RW--IWKLEDVDIDSNRR--DVEKII 556
                  FF  Y+  ++   I+   ++++KC   +W  +  L+D+D++++R+  D+E + 
Sbjct: 509 GKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVK 568

Query: 557 WEDPEPKTFWD 567
            E  E K + D
Sbjct: 569 QEIAEKKMYLD 579

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  265 bits (678), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 175/569 (30%), Positives = 289/569 (50%), Gaps = 27/569 (4%)

Query: 6   SSSQSVPRQRKSGVQTF-STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKR 64
           SS    P ++KS ++ F  +  + + M  I    + +  +T E E  +   SV D  +K+
Sbjct: 58  SSINESPAKKKSNLRRFVDSFKRAEHM--IPADDKINEMTTAEPEAEM--ASVED-NLKQ 112

Query: 65  ELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMAT- 123
            +K RH                   + L  +GP G +  Y  +GT  Y + QS GEMA  
Sbjct: 113 TIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVV 172

Query: 124 FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWI 183
           +  +   F  + +  + P           F+     +  +        YWT  V    ++
Sbjct: 173 YSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPDVFV 232

Query: 184 SIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWR 242
            IF+V++  +N+F  + Y E EF+    KV+ + GF I  + + V GAG  G +G  YWR
Sbjct: 233 VIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWR 292

Query: 243 NPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVP 302
           NPG +             +K    F G   +L+ AAF + GTE + +TA E +NPRK +P
Sbjct: 293 NPGAF-----------RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIP 341

Query: 303 RAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX-XXXXXXXPFIIAIENSGTKILPDI 361
            A KKV++RI+L Y+ S+  IG LVPF  P+L           P++IA+ + G +++P  
Sbjct: 342 SAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHF 401

Query: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421
            NA+IL++++S GNS  Y  SR+L SL+K G APK      ++G P  +++ +A+FGV+A
Sbjct: 402 INAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIA 461

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           +  T+     VF WL+ I+ ++  + W+ I +SHIRF   +K +G S  ++ FKA     
Sbjct: 462 FCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIW 521

Query: 482 LAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537
            +YY++F M++ +I Q + A  P         +FF  Y+++ +    +  +++W K   +
Sbjct: 522 GSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTL 581

Query: 538 W-KLEDVDIDSNRR--DVEKIIWEDPEPK 563
           + K ED+D+ S+R+  D E +  ED E K
Sbjct: 582 YIKAEDIDLISHRQIFDEELLKQEDYELK 610

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  266 bits (681), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 169/582 (29%), Positives = 290/582 (49%), Gaps = 44/582 (7%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQ----DDDMKKINIIQQTDASSTTEDEEMLNSGS 56
           MD+ + + Q       +G  + S +      ++D     +    DA         +N  S
Sbjct: 102 MDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQ--------INDNS 153

Query: 57  VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQ 116
             D E+K+ +K RH                   + L  +GP G +I +  +G+  Y + Q
Sbjct: 154 KSD-ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQ 212

Query: 117 SLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF 175
           ++GE+A  +  +   F  + S  +  +   AV ++Y   W     LEL      + YWT 
Sbjct: 213 AVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTT 272

Query: 176 AVPIAAWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVT 233
            V    ++ IF++++  +N+      Y E EF   + K++ ++GF I  + ++CG AG  
Sbjct: 273 KVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTD 332

Query: 234 GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
           G +G +YW +PG            +  + +  RF G   +L+NAAF +  +E +G+TA E
Sbjct: 333 GYIGAKYWHDPGA-----------LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASE 381

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIEN 352
            +NPRK +P A KK+++RIL  ++ S+  +G LVP++ D  L          P+++AI  
Sbjct: 382 QSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAIST 441

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
            G +++P   NA+ILI+++S  NS  Y  SR+L SLA+ G APKI S   ++G P V + 
Sbjct: 442 HGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMA 501

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
             A+FGV+A+  T+     VF WL+ I+ ++  + W+ I ISHIRF + +  +G S  +L
Sbjct: 502 TAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGEL 561

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-------TFDVSDFFAAYISVILFFLIW 525
            F++ +    + YA   M +I+I Q + A  P         D  +FF  Y+++ +    +
Sbjct: 562 GFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFY 621

Query: 526 GAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPE 561
             +++W K    WKL    +++D+ S+R   D E I  E+ E
Sbjct: 622 FGYKIWKK---DWKLFIRAKNIDLISHRNIFDEELIKQEEDE 660

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  265 bits (676), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 166/549 (30%), Positives = 272/549 (49%), Gaps = 34/549 (6%)

Query: 34  INIIQQTDASSTTEDEEMLNSGSVHD----AEVKRELKQRHXXXXXXXXXXXXXXXXXXS 89
           +N  ++ +  ST  + + L   + H     + +KR +K RH                   
Sbjct: 52  VNSFKRAEKHSTPSNGD-LEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANG 110

Query: 90  TPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVG 148
             L   GP G +I Y  V  + Y + Q+ GEMA   P +  +F  ++S+ +S   G A  
Sbjct: 111 KSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATV 170

Query: 149 YMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWV 208
           ++Y   W     LEL      + YW  ++    +I+IF+V +  ++ F  + YGE EF  
Sbjct: 171 WLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIF 230

Query: 209 AAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRF 267
              KV+ I+GF+I  + + CG AG    +G +YW +PG +  G               +F
Sbjct: 231 GICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----------SGATKF 279

Query: 268 LGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLV 327
            G    L+   F+Y GTEL  +T  E +NPR+ +    K+ ++RILL Y+ ++  IG LV
Sbjct: 280 KGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLV 339

Query: 328 PFDDPKLXXXX--XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRIL 385
           P    +L            P+++A+   G KI+P I NA+ILI +IS GNS +Y G RIL
Sbjct: 340 PHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRIL 399

Query: 386 FSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGF 445
            +LA+ G AP+ L+   + G P V+++A +VFG+LA++  +   + VF WL  I  ++  
Sbjct: 400 NTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSEL 459

Query: 446 WAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP- 504
           + W  I++SH+RF Q +++      +L +KAN     +   +   +++ I Q + +  P 
Sbjct: 460 FTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPF 519

Query: 505 ----TFDVSDFFAAYIS----VILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRR--DVEK 554
                 DV  FF +Y++    V+LFF     F+ W     I  L+D+D+D  R   D ++
Sbjct: 520 GKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNW---EIIKPLKDIDLDHYRSIYDQDR 576

Query: 555 IIWEDPEPK 563
           +  ED E K
Sbjct: 577 LYQEDLEHK 585

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  263 bits (672), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 179/543 (32%), Positives = 292/543 (53%), Gaps = 35/543 (6%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXX 87
           D   K+ +++ + D S TT DE      ++ + ++ R LK R                  
Sbjct: 18  DLSPKENHVVCELDPSFTT-DENYDPEANIRE-DLTRALKPRVVNMISIAGIIGTGLYLS 75

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAV 147
            S  L   GP    + Y  +G + Y    +LGEM+T++P++ SF V+A +F S S   A+
Sbjct: 76  TSKSLHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACAL 135

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWT---FAVPIAAWISIFWVILTALNMFPVKFYGEI 204
            + YWF+ AV+ A +L+ +  ++DYW       P  A   IFW ++  LN+  V+FYGE 
Sbjct: 136 MWNYWFNDAVSVASDLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEA 195

Query: 205 EFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYW-RNPGPWGDGLTSNGVEISKNK 262
           E+W+A +K++AI+ F I  + +  G       +GF+ W R   P+ DG+           
Sbjct: 196 EYWLAMLKIIAIIIFFILSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGIK---------- 245

Query: 263 NTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFF 322
                 G+ +  ++A+F Y GTE + +T GEA NP +  P+ +K V +RIL+FY+GS FF
Sbjct: 246 ------GFASLFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFF 299

Query: 323 IGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382
           I + +P+D P L          PF +  + +GTK      NA+I+ ++ISA N  ++ GS
Sbjct: 300 IAMNIPYDYPGL--DSKSIVTSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGS 357

Query: 383 RILFSLAKTGLAP-KILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITA 441
           RI++++   G  P +I+SRT +  VP+VSVL TA  G L +  +  G  T++ WL NI  
Sbjct: 358 RIMYNMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVG 417

Query: 442 IAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTA 501
           ++   AWL I I+ IRF + L+ +G +  +L +K    P   Y+ +  +  II+ QG++A
Sbjct: 418 VSNQIAWLCIGITSIRFRKGLEKQGKTH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSA 476

Query: 502 FTPTFDVSDFFAAYISVILF---FLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWE 558
           F P ++VS+FF+ Y+ + +F   F+IW   +   + R++ K ED+D  ++R    K I E
Sbjct: 477 FAP-WNVSNFFSYYLELFVFPVCFIIWWLVK---RDRFV-KYEDMDFTTDRYIPTKEIIE 531

Query: 559 DPE 561
             E
Sbjct: 532 LNE 534

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  265 bits (677), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 161/555 (29%), Positives = 281/555 (50%), Gaps = 24/555 (4%)

Query: 16  KSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXX 75
           K G  T      ++D+      Q ++   +   +E++    +   E+KR++ QRH     
Sbjct: 75  KRGETTARIADLENDLTTAVSPQLSNYHGSIPSDEVV----IKKEELKRDINQRHMVFMA 130

Query: 76  XXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVF 134
                        ++ L  +GP G LI Y  +GT  Y V Q+ GE+  T+  +   F  +
Sbjct: 131 IGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAY 190

Query: 135 ASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALN 194
            +  ++PS   +VG++Y   W     LEL      + YWT  V    ++ IF++++  +N
Sbjct: 191 PAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVFVVIFYLLILLIN 250

Query: 195 MFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTS 253
            F  K Y E +F+   +K+  I GF I  + + CG AG  G +G +YW NPG +      
Sbjct: 251 FFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAF------ 304

Query: 254 NGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRIL 313
                   K    F G  +  + +AF + G+E V ++A E ANPRK++P A K +++RI+
Sbjct: 305 -----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRII 359

Query: 314 LFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISA 373
             Y+ S+  +G LVP+D P+L          P+++AI   G K++P + NA+IL+ ++S 
Sbjct: 360 WVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSV 419

Query: 374 GNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVF 433
            NS  +  SR+L SL++ G APK      +KG P  ++L +A+FGV+ +  T++    VF
Sbjct: 420 SNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVF 479

Query: 434 DWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVII 493
            WL+ I+ ++  + +  I +SHIR    +K +G S  +L F++ +    ++YA   +V+ 
Sbjct: 480 SWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVLS 539

Query: 494 IIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSN 548
           ++ + + A  P      D   FF  Y++  +  + +  + +W K  R   + +D+D+D  
Sbjct: 540 LMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFK 599

Query: 549 RR--DVEKIIWEDPE 561
           R+  D + I  ED E
Sbjct: 600 RQVFDEDLIKQEDEE 614

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  265 bits (676), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/542 (29%), Positives = 274/542 (50%), Gaps = 32/542 (5%)

Query: 47  EDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           +DEE L +      ++ ++L  RH                   + L   GP   +I ++ 
Sbjct: 131 KDEETLLA-----TDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVI 185

Query: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166
           V T  + V  SLGE+A   PV   F+V+  +F+ PS   AV   Y   W V   LEL   
Sbjct: 186 VSTALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAA 245

Query: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226
              + YW  ++   AW+SIF+V +   NM  VK +GE EF ++ VK++AI+GF I  + +
Sbjct: 246 SITIRYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVL 305

Query: 227 VCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTE 285
            CG G +   +G +YW +PG +  G TS            +F G  +  + AAF++ G E
Sbjct: 306 DCGGGPSHEYIGGKYWHDPGAFV-GTTSG----------SKFKGLCSVFVTAAFSFSGIE 354

Query: 286 LVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX--XXXXXXXX 343
           +  ++A E+ NPR+T+P+A K+  + I   Y+  L  +G LVP++DP+L           
Sbjct: 355 MTAVSAAESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAAS 414

Query: 344 XPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTK 403
            P +IAIEN     LP + NAIILI I+S  NS++Y  SR + S++K    PK+ ++  +
Sbjct: 415 SPLVIAIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDR 474

Query: 404 KGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLK 463
           +G P  ++     FG+L+++  +     VF WL  ++ ++  + W+ I + HIRF Q + 
Sbjct: 475 RGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMH 534

Query: 464 FRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVI 519
            + IS D+LPF +      + Y +  + ++++   +T+  P      + + FF  Y+S  
Sbjct: 535 VQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFP 594

Query: 520 LFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVE--------KIIWEDPEPKTFWDKFW 570
           +    + A +++FK  RW      +D+ S R+ V+        ++  E    ++F+ +F 
Sbjct: 595 ILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQRSFFYRFL 654

Query: 571 NV 572
           +V
Sbjct: 655 HV 656

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 170/568 (29%), Positives = 287/568 (50%), Gaps = 27/568 (4%)

Query: 7   SSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKREL 66
           S Q   R R     T S    +    KI  I +    +T++ E+ + S +  D+++K+ +
Sbjct: 41  SEQKPKRNRLIHRFTDSFKRAEGSTTKIKPINE----NTSDLEDGIQSFT-SDSKLKKSM 95

Query: 67  KQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP 126
           K RH                  +  L   GP   +I Y+ V  +TY + Q+ GEMA   P
Sbjct: 96  KSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYP 155

Query: 127 -VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISI 185
            + ++F  ++S F+S   G A  ++Y F W     LEL      + +W   +    +I I
Sbjct: 156 TLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILI 215

Query: 186 FWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNP 244
           F+V L  ++ F VK YGE EF     K++ I GF++  + + CG AG  G +G  YW  P
Sbjct: 216 FYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKP 275

Query: 245 GPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRA 304
           G +  G TS    I++ KN    L      + A F++ G EL  ++  E  NPRK+ P A
Sbjct: 276 GAFA-GDTS----IARFKNVCYIL------VTAYFSFGGMELFVLSVQEQTNPRKSTPVA 324

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPF-DDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFN 363
            K+ ++RI++ Y+ ++  IG  VP+ DD  L          P+++A    G +I+P I N
Sbjct: 325 AKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIIN 384

Query: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423
           A+ILI+++S  NS++Y G R++ SLA+ G APK L    ++G P  +++   V GV+A++
Sbjct: 385 AVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFV 444

Query: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483
             +   + VF WL  I  ++  + W  I++SH+RF Q +K +G S ++L +KA      +
Sbjct: 445 AASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGS 504

Query: 484 YYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAFQLWFK-CRWI 537
            Y  F  +++ I Q + A  P       +   FF +Y++  ++ + +  + ++ +    +
Sbjct: 505 IYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLL 564

Query: 538 WKLEDVDIDSNRR--DVEKIIWEDPEPK 563
             L+ +D+D +RR  D E +  ED E K
Sbjct: 565 NPLDKIDLDFHRRVYDPELMRQEDEENK 592

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 169/565 (29%), Positives = 281/565 (49%), Gaps = 42/565 (7%)

Query: 23  STMSQDDDMKKINIIQQT-DASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXX 81
           S ++   + +K N++Q+  D+     D      GS   + +KR LK RH           
Sbjct: 44  SLLNGSTEERKRNVVQRVIDSFKPPVD------GSFDPSNMKRALKSRHLIMIAIGSSIG 97

Query: 82  XXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSP 141
                     L   GP+  +I +   GT        LGE+   +PV  +F  +++RFL P
Sbjct: 98  TGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTVRLPVVGAFADYSTRFLDP 157

Query: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFY 201
           S+   +  +Y   W     LE+      + +WT +V    W+++F+ ++ ++N+  V+ +
Sbjct: 158 SVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVSINLLGVRGF 217

Query: 202 GEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISK 260
           GE EF  ++VKV+ I GF+I C+ ++ G G T   VG RYW +PGP  +G          
Sbjct: 218 GEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLANG---------- 267

Query: 261 NKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSL 320
                 F G    ++ A+++  G+E+  + +GE  +P K +P AIK++ +RIL F++ SL
Sbjct: 268 ------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KELPHAIKQIFWRILFFFLVSL 319

Query: 321 FFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYV 380
             +G LVP+ +  L          PF++A+     K++P I N +IL++I+S GNS I+ 
Sbjct: 320 TLVGFLVPYTNENLLGGSSAENS-PFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFA 378

Query: 381 GSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNIT 440
            SR L S+A  GL P I     + G P V +LA ++FG+LA++        VF WL+ I 
Sbjct: 379 SSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIA 438

Query: 441 AIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFT 500
            +A    WL I +SH+RF   +K +  S D+L F +++    + YA     + ++ Q + 
Sbjct: 439 GLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYI 498

Query: 501 AFTPTFDVSD-------FFAAYISVILFFLIWGAFQLWFKC---RW--IWKLEDVDIDSN 548
           A  P     D       FF  Y+  ++   ++ A + +F+    +W  I KL +VD+D+ 
Sbjct: 499 ALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSEVDLDTG 558

Query: 549 RR--DVEKIIWEDPEPKTFW-DKFW 570
           R   D+E I  E  E K F  +K W
Sbjct: 559 RVNIDIEIIKEEVAERKKFLRNKAW 583

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  263 bits (672), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 172/578 (29%), Positives = 290/578 (50%), Gaps = 27/578 (4%)

Query: 2   DTLESSSQSVPRQRKSGVQTF-----STMSQDDDMKKINIIQQTDASSTTED-EEMLNSG 55
           D++E   ++ PR   S    F     S    +++    + I  T    + ED E +    
Sbjct: 21  DSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDD 80

Query: 56  SVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVT 115
           S     +K+ +K RH                     L + GP   LI Y  V T+ Y V 
Sbjct: 81  SSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140

Query: 116 QSLGEMAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
           QS  E+A  +  ++  F  + +  +  +   +V ++Y   W     LEL      + YW 
Sbjct: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWN 200

Query: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVT 233
            ++   A++ IF+V+L  +N      Y E EF+    KV+ ++GF I  + + CG AG  
Sbjct: 201 DSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGND 260

Query: 234 GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
           G +G  YW +PG +             N    RF G    L+NAAF Y G E   +TA E
Sbjct: 261 GYLGSVYWHDPGAF-----------RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX-XXXXXXXPFIIAIEN 352
             NP+K++  A KK+V+RI+  Y+ +   +G LVP++ P+L           PF+IAI +
Sbjct: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIAS 369

Query: 353 SGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVL 412
            G K++P I NA+IL++++S  NS +Y  SRIL SL++ G APK+ +   ++G P   +L
Sbjct: 370 HGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLL 429

Query: 413 ATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDL 472
            + VFG+L ++  +   +TVF WL+ I+ ++  + W  I +SH+RF + +  +G S D+L
Sbjct: 430 VSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDEL 489

Query: 473 PFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAF 528
            +++      AYYA+  +++I+I Q + A +P      D ++FF  Y+++ +   ++  +
Sbjct: 490 GYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGY 549

Query: 529 QLWFKC-RWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
           +LW++  R I    +VD+ S+R+  D E +  E  E K
Sbjct: 550 KLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  263 bits (672), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/562 (28%), Positives = 277/562 (49%), Gaps = 39/562 (6%)

Query: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKI--NIIQQ--TDASSTTEDEEMLNSGSVH 58
           T+       P Q+ S  +T       ++ +K   +  +Q  +D +S  E +E  N     
Sbjct: 35  TITEKQNEEPEQQGSPQKTDRKPKLRNEFRKFFDSFKRQLPSDQNSELESQEKNN----- 89

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
              +++ +K RH                     L  +GP G ++ Y     + Y + Q+ 
Sbjct: 90  ---LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAA 146

Query: 119 GEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           GE+   +  +T ++T ++S  + PS+G AV  +Y   W     L+L      V YWT  V
Sbjct: 147 GELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-NV 205

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPV 236
               ++++ ++ +  +N+F  + Y E EF     K++ + GF+I  + + CG AG    +
Sbjct: 206 NADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYI 265

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           G  YW NPGP+  G                F G       AAF+Y G E++ ++A E  N
Sbjct: 266 GTEYWHNPGPFAHG----------------FKGVCTVFCYAAFSYGGIEVLLLSAAEQEN 309

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXX--XXXPFIIAIENSG 354
           P +++P A KKVV+RILL Y+ +   IG LVP++  +L            PF+IA+ + G
Sbjct: 310 PTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHG 369

Query: 355 TKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLAT 414
            K++P   NA+ILI++IS  NS++Y G R+L SLA+ G+ PK L+   + G P +  L +
Sbjct: 370 VKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVS 429

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
             FG + ++ T+   + VF WL+ I++++  + W+ + +SHIRF   +  +G S D++ +
Sbjct: 430 LAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGY 489

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTPT-----FDVSDFFAAYISVILFFLIWGAFQ 529
           KA      ++ AV   V  ++ Q + A  P       DV  FF  Y+++ +  L +   +
Sbjct: 490 KAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHK 549

Query: 530 LWFKCRWIW-KLEDVDIDSNRR 550
           ++FK    W   E +D+DS+R 
Sbjct: 550 MYFKSWRFWIPAEKIDLDSHRN 571

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  262 bits (669), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 159/562 (28%), Positives = 284/562 (50%), Gaps = 40/562 (7%)

Query: 6   SSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRE 65
           S+ Q V ++R S ++    + +    K+  + +  D+     D      GS     +KR 
Sbjct: 18  SAVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVD------GSFDPDNLKRT 71

Query: 66  LKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFI 125
           LK RH                     L   GP+  LI +   GT        LGE+    
Sbjct: 72  LKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRF 131

Query: 126 PVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISI 185
           PV  +F  +++RFL PS+   V  +Y   W     LE+      +++WT +V    W+++
Sbjct: 132 PVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAV 191

Query: 186 FWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNP 244
           F+ ++ ++N+F V+++G+ +F  + +K+V I GF+I CL ++ G G T   +G RYW +P
Sbjct: 192 FYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDP 251

Query: 245 GPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRA 304
           G   +G                F G    ++ A+++  G+E+  + +GE  +P K +P A
Sbjct: 252 GALANG----------------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEIPHA 293

Query: 305 IKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNA 364
           IK++ +RI+ F++ SL  +G LVP+ + +L          PF+IAI+    ++LP I N 
Sbjct: 294 IKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNS-PFVIAIKMHNIRVLPHIING 352

Query: 365 IILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYME 424
           +IL++I+S GNS I+  SR L S+A  GL P+I     + G P   +L  ++FG+LA++ 
Sbjct: 353 VILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLV 412

Query: 425 TTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAY 484
            +    TVF WL+ +  +A    WL I +SHIRF   +K +G S D+L F + +    + 
Sbjct: 413 KSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSV 472

Query: 485 YAVFCMVIIIIFQGFTAFTPTFDVSD-------FFAAYISVILFFLIWGAFQLWFKC--- 534
           Y+    V++++ Q + +  P     D       FF  Y+  ++   ++ A +++++    
Sbjct: 473 YSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTG 532

Query: 535 RWIWK---LEDVDIDSNRRDVE 553
           +W WK   L ++D++S R++++
Sbjct: 533 QW-WKILPLAEIDLESGRKNID 553

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  261 bits (668), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 162/528 (30%), Positives = 270/528 (51%), Gaps = 34/528 (6%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           GS   + +KR LK RH                     + + GP+G ++ +   G+     
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 130

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
              LGE+    PV  +F  + +RFL PSI   V  +Y   W     LE+      V YW 
Sbjct: 131 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTG 234
            ++    W++IF+VI+ ++N+F V+ +GE EF  + +K + + GF+I C+ ++ G G   
Sbjct: 191 SSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDH 250

Query: 235 P-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
             VG +YW +PG   +G                F G  + L+ A+++  G E+  + +GE
Sbjct: 251 EYVGAKYWYDPGCLANG----------------FPGILSVLVVASYSLGGIEMTCLASGE 294

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENS 353
             +P K +P AIK+V +RIL F++ SL  +G LVP+ +  L          PF+IAI+  
Sbjct: 295 -TDP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNL-LGGSSVDNSPFVIAIKLH 351

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
             K+LP I N +ILI+++S GNS I+  SR L S+A  GL P       + G P V ++A
Sbjct: 352 HIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 411

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
            ++FG+LA++  +     VF+WL+ I  +A    WL I +SHIRF   +K +G   D+L 
Sbjct: 412 NSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELE 471

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT---FDVSD----FFAAYISVILFFLIWG 526
           F + +    + Y+     +I++ Q + +  P     + SD    FF  Y+  ++   I+ 
Sbjct: 472 FVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFI 531

Query: 527 AFQLWFKC---RW--IWKLEDVDIDSNRR--DVEKIIWEDPEPKTFWD 567
           A ++++KC   +W  I  L+D+D++++R+  D+E +  E  E K + D
Sbjct: 532 AHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLD 579

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  261 bits (667), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 159/529 (30%), Positives = 266/529 (50%), Gaps = 34/529 (6%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           GS   + +KR LK RH                     L   GP+  +I +   G+     
Sbjct: 56  GSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGT 115

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
              LGE+    PV  +F  +++RFL PSI   V  +Y   W     LE+      + YW 
Sbjct: 116 IHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWN 175

Query: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTG 234
            ++    W++IF+ ++ ++N+F  + +GE EF  + +K + I GF+I C+ ++CG G   
Sbjct: 176 SSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDH 235

Query: 235 P-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
             +G +YW +PG    G                F G  + L+ A+++  GTE+  + +GE
Sbjct: 236 EFIGAKYWHDPGALAHG----------------FPGVLSVLVVASYSLGGTEMTCLASGE 279

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENS 353
             +P K +P AIK+V +RIL F++ SL  +G LVP+ +  L          PF+IAI+  
Sbjct: 280 T-DP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDNS-PFVIAIKLH 336

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
             K LP I NA+ILI+I+S GNS I+  SR L S+A  GL P+      + G P   ++ 
Sbjct: 337 HIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVT 396

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
            ++FG+LA++  +     VFDWL+ I  +A    WL I +SHIRF   +K +  + D+L 
Sbjct: 397 NSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELE 456

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSD-------FFAAYISVILFFLIWG 526
           F + +    + Y+    V+I+I Q + +  P    +D       FF +Y+  ++  LI+ 
Sbjct: 457 FVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFC 516

Query: 527 AFQLWFKC---RW--IWKLEDVDIDSNRR--DVEKIIWEDPEPKTFWDK 568
             +++++    +W  +  L+D+D+++ R+  D++ I  E  E K +  K
Sbjct: 517 IHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  261 bits (666), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 156/528 (29%), Positives = 267/528 (50%), Gaps = 34/528 (6%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           GS   + +KR LK RH                     + + GP+G ++ +   G+     
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 130

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
              LGE+    PV  +F  + +RFL PSI   V  +Y   W     LE+      V YW 
Sbjct: 131 VHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTG 234
            ++    W++IF+ ++ ++N+F  + +GE EF  + VK + + GF+I C+ ++CG G   
Sbjct: 191 SSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDH 250

Query: 235 P-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
             +G +YW +PG    G                F G  + L+ A+++  G E+  + +GE
Sbjct: 251 EFIGAKYWHDPGCLAHG----------------FPGVLSVLVVASYSLGGIEMTCLASGE 294

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENS 353
             +P K +P AIK+V +RI+ F++ SL  +G LVP+ +  L          PF+IAI+  
Sbjct: 295 T-DP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS-PFVIAIKLH 351

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
             K+LP I NA+ILI+++S GNS I+  SR L S+A  GL P       + G P V ++A
Sbjct: 352 HIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 411

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
            ++FG+LA++  +     VF+WL+ I  +A    WL I +SH+RF   +K +G S D+L 
Sbjct: 412 NSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELE 471

Query: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-------TFDVSDFFAAYISVILFFLIWG 526
           F + +    + Y+     +I+I Q + +  P             FF  Y+  ++   I+ 
Sbjct: 472 FVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFV 531

Query: 527 AFQLWFKC---RW--IWKLEDVDIDSNRR--DVEKIIWEDPEPKTFWD 567
             +++++C   +W  + +L+D+D++++R+  D+E +  E  E K + D
Sbjct: 532 IHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLD 579

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  260 bits (665), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 172/570 (30%), Positives = 287/570 (50%), Gaps = 42/570 (7%)

Query: 1   MDTLES-SSQSVPRQRKSGVQTFST---MSQDDDMKKINIIQQTDASSTTEDEEMLNSGS 56
           MD L S SS  +  +   G+ +  T   + + +D  K  + +  D+     D      GS
Sbjct: 11  MDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPLD------GS 64

Query: 57  VHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQ 116
            H   +KR+LK RH                     L   GP+  +I +   G+       
Sbjct: 65  YHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIH 124

Query: 117 SLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA 176
            LGE+    PV  +F  +++R L PSI   V  +Y   W     +EL      V +WT  
Sbjct: 125 GLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTK 184

Query: 177 VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP- 235
           V    W++IF+VI+ ++N+F VK +GE EF  + VKV+ I+GF+I  + ++CG G     
Sbjct: 185 VDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRF 244

Query: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295
           +G  YW +PG   +G                F G  +  + A+++  G+E+V + + E  
Sbjct: 245 IGTEYWHHPGALANG----------------FKGVASVFVTASYSLGGSEMVCLCSAET- 287

Query: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGT 355
           +P K +P AIK+V +RI+ F++ SL  +G LVP+ +  L          PF+IAI+ SG 
Sbjct: 288 DP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS-PFVIAIKLSGI 345

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
           ++LP I NA+ILI+I+S GNS I+  SR L S+A  GL P++     + G P V ++  +
Sbjct: 346 RVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNS 405

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
           +FG+LA++  +     VFDWL+ I  +A    WL I ISHIRF   +K +  S D+L FK
Sbjct: 406 LFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFK 465

Query: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTPT-------FDVSDFFAAYISVILFFLIWGAF 528
           +++    + Y+    ++I+I Q + +  P             FF  Y+  ++   ++   
Sbjct: 466 SSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTH 525

Query: 529 QLWFKC---RW--IWKLEDVDIDSNRRDVE 553
           +++FKC   +W     L ++D++++R++++
Sbjct: 526 KIYFKCSTGKWFDFKPLAEIDLETDRKNID 555

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  260 bits (665), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/551 (30%), Positives = 273/551 (49%), Gaps = 35/551 (6%)

Query: 39  QTDASSTTEDEEM-LNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
           Q D     ED  M L  G  H  +V R+LK RH                     L   GP
Sbjct: 45  QVDQIIDVEDASMELIEGQEH--QVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGP 102

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFA--SRFLSPSIGAAVGYMYWFSW 155
              LI+Y+ +    + +   L EM   +P++   ++FA    +L+  +    G   +++ 
Sbjct: 103 APLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAM 162

Query: 156 AVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVA 215
           ++    E++    ++ YWT A   A +ISIF V+  +L M PV F+GE EFWV+ +K+  
Sbjct: 163 SMIAPSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFC 221

Query: 216 IVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNS 273
           I G +I  + +  G        +GF YW++PG +   L           NTG+FL  + +
Sbjct: 222 ITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPG--------NTGKFLACWTA 273

Query: 274 LINAAFTYQGT-ELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP 332
           +I + F+Y    E+V   A EA +PR+ +PR  ++ V+R+ LFY+     IG++V +D+ 
Sbjct: 274 IIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNS 333

Query: 333 KLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSL 388
           +L              PF+I I+  G ++LP I NA IL +  S G S +Y  SR+L S+
Sbjct: 334 RLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSM 393

Query: 389 AKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAW 448
           A  G  PKI + T + G P+ S  A +VF +LAY+  +     VF WL NI  I+GF  W
Sbjct: 394 AVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDW 453

Query: 449 LFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-TFD 507
           + + + ++RF +V++   ++ D +PF+   M  LAY +     I+ +  G+  F    ++
Sbjct: 454 MLVCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWN 512

Query: 508 VSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPE------ 561
           VSDFFA Y ++ L  +++    +++K     KL D+D +     + KI   D E      
Sbjct: 513 VSDFFACYTTLGLAAVLYIGAAIYYK---TIKLRDLD-EVAAEIIPKIAMADEEEKGEVP 568

Query: 562 --PKTFWDKFW 570
             PK + +K W
Sbjct: 569 IVPKNWLEKVW 579

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  260 bits (664), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/583 (27%), Positives = 283/583 (48%), Gaps = 47/583 (8%)

Query: 6   SSSQSVPRQRKSGVQTFSTMSQDDDMKK------------INIIQQTDASSTTEDEEMLN 53
           SS  S    +K    T++ +       K            IN  ++   S   ++ +  N
Sbjct: 2   SSDMSTANSKKEEESTYAIIQTSSPCSKKYSYISGQVNRFINSFRRKGESEDVKELKGEN 61

Query: 54  SGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYA 113
                  ++K+ +K RH                     L  +GP G +I Y     + Y 
Sbjct: 62  EECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYC 121

Query: 114 VTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDY 172
           + Q+ GE+   +  +  ++T ++S  + P++G +V ++Y   W     L+L      V Y
Sbjct: 122 IIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRY 181

Query: 173 WTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AG 231
           WT A P   ++++F+V++  +NMF  K Y E EF     KV+ I GF+I  + + CG AG
Sbjct: 182 WTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAG 240

Query: 232 VTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITA 291
            +G +G +YW +PG +  G                F G       AAF+Y G E++ +TA
Sbjct: 241 TSGYIGAKYWHSPGSFAAG----------------FKGVCYVFCYAAFSYGGIEVMVLTA 284

Query: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX--XXXXXXPFIIA 349
            E  NPRK++P A KKV++RIL+ Y+ +   +  LVP++  +L            P +IA
Sbjct: 285 SEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIA 344

Query: 350 IENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWV 409
           + + G KI+P I NA+ILI++IS GNS++Y   R+L SL++ G APK L+   ++G P +
Sbjct: 345 VASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLI 404

Query: 410 SVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISR 469
               T +  ++A++  +   + +F WL+ I+ ++  + W  I +SH+RF   +  +G+S 
Sbjct: 405 CFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSL 464

Query: 470 DDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLI 524
             + +K+      +++A+   V+++I Q + A  P       +   FF  Y++  +    
Sbjct: 465 GQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGA 524

Query: 525 WGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPE 561
           +  ++++ K    W+L     +VD+ S+R   D E +  ED E
Sbjct: 525 YFGYKVYHK---DWRLCIPASEVDLSSHRNISDEEILRQEDYE 564

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  259 bits (663), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/560 (30%), Positives = 275/560 (49%), Gaps = 44/560 (7%)

Query: 27  QDDD---MKKINIIQQT-DASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXX 82
           QDDD       NI Q+  D+     D      GS   + +KR LK RH            
Sbjct: 46  QDDDDGEHSNRNIFQRCVDSFKPPLD------GSFDTSNLKRTLKPRHLIMIAIGGSIGT 99

Query: 83  XXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPS 142
                    + + GP+G ++ +   G+        LGE+    PV  +F  + +RFL PS
Sbjct: 100 GLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPS 159

Query: 143 IGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYG 202
           I   V  +Y   W     LE+      V YW  ++    W++IF+ ++  +N+F  + +G
Sbjct: 160 ISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFG 219

Query: 203 EIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKN 261
           E EF  + VK + + GF+I  + ++CG G     +G +YW +PG   +G           
Sbjct: 220 EAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLANG----------- 268

Query: 262 KNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLF 321
                F G    L+ A+++  G E+  + +GE  +P K +P AIK+V +RIL F++ SL 
Sbjct: 269 -----FPGVLAVLVVASYSLGGIEMTCLASGET-DP-KGLPGAIKQVFWRILFFFLASLT 321

Query: 322 FIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVG 381
            +G LVP+ +  L          PF+IA++    K+LP I NA+ILI+++S GNS I+  
Sbjct: 322 LVGFLVPYTNQNLLGGSSVDNS-PFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFAS 380

Query: 382 SRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITA 441
           SR L S+A  GL P       + G P V ++A ++FG+LA++  +     VF+WL+ I  
Sbjct: 381 SRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAG 440

Query: 442 IAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTA 501
           +A    WL I +SHIRF   +K +G S D+L F + +    + Y+     +I+I Q + +
Sbjct: 441 LATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCS 500

Query: 502 FTPTFDVSD-------FFAAYISVILFFLIWGAFQLWFKC---RW--IWKLEDVDIDSNR 549
             P    S        FF  Y+  ++   I+   ++++KC   +W  +  L+D+D++++R
Sbjct: 501 LWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDR 560

Query: 550 R--DVEKIIWEDPEPKTFWD 567
           +  D+E I  E  E K   D
Sbjct: 561 KDIDIEIIKQEIMERKMHLD 580

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  259 bits (663), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/537 (29%), Positives = 268/537 (49%), Gaps = 22/537 (4%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGP 97
           +  D  + ++ E+   S +  D  +K+ +K RH                     L  +GP
Sbjct: 54  RAEDKHADSDLEDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGP 113

Query: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWA 156
              ++ Y  V  +TY + Q+ GEMA   P + +SF  +AS F+S   G A  +++   W 
Sbjct: 114 APLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWL 173

Query: 157 VTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAI 216
               LEL      + YW   +    +I IF+V L  ++ F VK YGE EF   + K++ I
Sbjct: 174 TVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMI 233

Query: 217 VGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLI 275
            GF+I  + + CG AG  G +G +YW NPG +           +      RF G    L+
Sbjct: 234 AGFIILSIVINCGGAGRDGYIGNKYWINPGAF-----------ASESPAARFKGVAYILV 282

Query: 276 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLX 335
              F+Y GTEL  ++  E  NPRK+ P A K+ ++RIL+ Y+ ++  IG  VP D  +L 
Sbjct: 283 TGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLM 342

Query: 336 XXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLA 394
                     P+++A    G K++P   NA+ILI+++S  NS +Y   R++ SLA+ G A
Sbjct: 343 GAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYA 402

Query: 395 PKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILIS 454
           PK  +   ++G P  ++    +FGV+ ++  +   +  F WL  I  ++  + W  I IS
Sbjct: 403 PKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFIS 462

Query: 455 HIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVS 509
           HIRF   +K +G S ++L ++A      + Y+VF  +++ I Q + A +P      +D  
Sbjct: 463 HIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAE 522

Query: 510 DFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
            FF +Y++  L+ + +  + ++ +   ++  L+ +D+D +RR  D E +  ED E K
Sbjct: 523 GFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETK 579

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  258 bits (660), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 172/557 (30%), Positives = 272/557 (48%), Gaps = 45/557 (8%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  K+ +  Q  +A S  ED E   +    D + K+ L  RH                  
Sbjct: 46  DSYKRADPSQLHNARS--EDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVAN 103

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAV 147
           +  L   GP   +I Y+ V  +TY + Q+ GEMA   P +  +F  + S F+S S G A 
Sbjct: 104 AKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFAT 163

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFP-VKFYGEIEF 206
            +++   W     LEL      + YW   +    ++ IF+V L A+++   ++ YGE EF
Sbjct: 164 VWLFCIQWLTVLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEF 223

Query: 207 WVAAVKVVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTG 265
              + K++ ++GF+I  + +   GAG  G +G +YW  PG + +G             T 
Sbjct: 224 LFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEG-----------DATS 272

Query: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325
           RF G    L++  F+Y GTEL  ++  E A PRK  P A KK ++RIL+ Y+ ++  IG 
Sbjct: 273 RFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGF 332

Query: 326 LVPFDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384
            VP ++ +L           P+++A    G KI+P   NA+ILI++IS  NS+++ G R+
Sbjct: 333 NVPHNNDQLMGAGGSATHASPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRL 392

Query: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444
           L SLA  G APKILS   ++G P V++  + + G++A++  T   + VF WL  I  ++ 
Sbjct: 393 LSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSE 452

Query: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504
            + W  I+ SH+RF   +K +G   ++L +KAN     + Y  F  V+++I Q + A  P
Sbjct: 453 IFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAP 512

Query: 505 -----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRW-----------IWKLEDVDIDSN 548
                  D   FF +Y+          AF +W  C +           +  L+ +D+DS 
Sbjct: 513 IGNGGKCDAEAFFESYL----------AFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSY 562

Query: 549 RR--DVEKIIWEDPEPK 563
           RR  D E I  ED E K
Sbjct: 563 RRIYDPELIKQEDEENK 579

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  258 bits (658), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 174/563 (30%), Positives = 281/563 (49%), Gaps = 43/563 (7%)

Query: 35  NIIQQTDASSTTEDEEMLNSGSVHDAE-------VKRELKQRHXXXXXXXXXXXXXXXXX 87
           N I++   SS  +     + GS  D E       + R LK RH                 
Sbjct: 21  NRIKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIG 80

Query: 88  XSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV--TSSFTVFASRFLSPSIGA 145
               L   GP   LIAYI +    +++   + EM   IP+   +S    A  +L+  I  
Sbjct: 81  SGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISF 140

Query: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205
             G+  +++ A+    E++    +V YWT A   A +ISIF V+   L M PVK +GE E
Sbjct: 141 MCGWNLFYAMAMIVPAEITACALLVQYWTDANS-AIFISIFIVVSILLTMLPVKVFGESE 199

Query: 206 FWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDGLTSNGVEISKNKN 263
           FWV+++K++ IVG +I  + +  G G      +GF YW+NPG +   L           N
Sbjct: 200 FWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEG--------N 251

Query: 264 TGRFLGWFNSLINAAFTYQGT-ELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFF 322
           TGRFL  + ++I + F++    E V   + E   PR+ +P+A ++ ++R+ +FYI     
Sbjct: 252 TGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLV 311

Query: 323 IGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNI 378
           +G++V F++ +L              PF+I I+ +G KILP I NA IL +  S G   +
Sbjct: 312 VGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLL 371

Query: 379 YVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVN 438
           Y  SR L+S+A  G APKI ++  + G P+ S    ++F  LAY+  ++    VF+WL N
Sbjct: 372 YGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSN 431

Query: 439 ITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQG 498
           I  I+GF +W+F+ +++IRF +V+    ++ D +PF+      LAY       I+ +  G
Sbjct: 432 IATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNG 490

Query: 499 FTAFTP-TFDVSDFFAAYISV--ILFFLIWGAF--QLW----FKCRWIWKLEDVDI--DS 547
           +  F    ++VSDFFA+Y+++  ++F  + G+F  + W    FK   +  L  +DI  + 
Sbjct: 491 YAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEE 550

Query: 548 NRRDVEKIIWEDPEPKTFWDKFW 570
            R DV       P P+ F +K W
Sbjct: 551 ERNDV------IPVPRNFMEKVW 567

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  256 bits (654), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/551 (30%), Positives = 269/551 (48%), Gaps = 39/551 (7%)

Query: 23  STMSQDDDMKKIN-IIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXX 81
           +++ Q +D+ K+   I + +      D   LN    H   VKR LK RH           
Sbjct: 5   NSIQQREDLDKLEPKIAEVELQRLETDS--LNEFDPHSG-VKRALKNRHISLLALGGIIG 61

Query: 82  XXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSP 141
                     L   GP+  L+ +  +G + +++ +S+GE+ T  P    F   A RF S 
Sbjct: 62  PGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSE 121

Query: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFY 201
            + A  GY Y   +    A E + +  I+ +W   VPI  +  IFW       +  V  +
Sbjct: 122 GLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAF 181

Query: 202 GEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTG--PVGFRYWRNPGPWGDGLTSNGVEIS 259
           GE E+W+A  K++ +V F I+ +  + G G+ G  P+GF+YW+NPG    G         
Sbjct: 182 GECEYWLAWFKILGLVAFYIFSIVYMSG-GIPGKPPIGFQYWKNPGALSHG--------- 231

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
                  F G     +  +  Y GTE V + A E+ NPRK VP A+++  +RIL+ Y+G 
Sbjct: 232 -------FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGI 284

Query: 320 LFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379
            FF G+ VP++DP L          P  IA+  +G      + NA IL+T ISA NS++Y
Sbjct: 285 SFFYGVTVPYNDPTLGAQTKSLKS-PISIALSRAGWAGGVHLVNAFILMTCISAINSSLY 343

Query: 380 VGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNI 439
           +GSR L  LA  GLAP+IL+ T K+GVP  +++     G+++ M  + G    ++++VN+
Sbjct: 344 IGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNL 403

Query: 440 TAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGF 499
           + +  F  W  I I+H+RF +    +G S  +LP++A   P    +++   + + + QG+
Sbjct: 404 SGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGW 463

Query: 500 TAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDI------DSNRRDVE 553
           T+  P F   DF  AYI +    L++     W K R     + V+I      +  RRD++
Sbjct: 464 TSLVP-FVAKDFVDAYILLPAAGLLYVGINFW-KNR---NFKTVNIHGINLEEGQRRDLD 518

Query: 554 KIIWEDPEPKT 564
               ED + +T
Sbjct: 519 ----EDSDDET 525

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  256 bits (653), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 263/514 (51%), Gaps = 31/514 (6%)

Query: 28  DDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVK----RELKQRHXXXXXXXXXXXXX 83
            D +     I   D + +++ E+    G   D  V+    R L  RH             
Sbjct: 9   KDKVTPEQYISIADENYSSDLEQPSLEGLTTDNNVREHLNRSLSPRHVNMIAIAGVIGTG 68

Query: 84  XXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSI 143
                   L   GP   LI Y  +G + YA   SLGEM+T++P++ SF  FA +F S S 
Sbjct: 69  LYLGTGRALHLGGPASLLINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFGSESF 128

Query: 144 GAAVGYMYWFSWAVTFALELSVVGQIVDYW-TFAVPIAAWIS--IFWVILTALNMFPVKF 200
             A+   YWF+ AV+ A +L+ +  ++DYW T       WI+  IFWV L  LN+  VK 
Sbjct: 129 AFALMCNYWFNDAVSVASDLTALQLVLDYWKTSESGFPYWIASLIFWVFLLFLNVIHVKI 188

Query: 201 YGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEIS 259
           YGE E+W+A +KV+AI+ F I  +    G       +GFR W      GD    NG    
Sbjct: 189 YGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEYIGFRNWTR----GDAPFVNG---- 240

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
                  F G+    ++A+F Y GTE + +T+GE  NP +  P+ IK V +RIL+FYI +
Sbjct: 241 -------FRGFATLFVSASFAYGGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFT 293

Query: 320 LFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379
           +FFIG+ VP+D P L          PF I  +  G+K      NA+IL +++SA N  ++
Sbjct: 294 VFFIGMNVPYDYPNL--SEKSVMTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALF 351

Query: 380 VGSRILFSLAKTG-LAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVN 438
            GSRILF+L   G   PK+++RT    VP+V+VL T   G L +  +  G  T++ WL N
Sbjct: 352 AGSRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQN 411

Query: 439 ITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQG 498
           +  ++   AWL I +  IRF + L  +G +  +L F     P   Y+ +  +  II+ QG
Sbjct: 412 LVGVSNQIAWLSIGVISIRFRRGLSRQGKTH-ELKFVNWTYPYGPYFVIISVSFIILVQG 470

Query: 499 FTAFTPTFDVSDFFAAYISVILFF---LIWGAFQ 529
           +++ +P  DV+ FF+ Y+ + +F    L+W AF+
Sbjct: 471 WSSSSP-MDVTSFFSYYVELFIFLACWLVWWAFK 503

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  254 bits (648), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 164/506 (32%), Positives = 256/506 (50%), Gaps = 40/506 (7%)

Query: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE---------VKRELKQRHXXX 73
           S +SQ+    KI          T  DE+ L  GS    +         +K+ LK+RH   
Sbjct: 8   SGLSQEKVKSKI--------CETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERHIKM 59

Query: 74  XXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTV 133
                             L+  GPVG LIAY+FVG +      ++ E+A+F+P T +   
Sbjct: 60  LTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIR 119

Query: 134 FASRFLSPSIGAAVGYMYWFSWAVTFAL----ELSVVGQIVDYWTFAVPIAAWISIFWVI 189
            A +F+  S+G      + F W  T++     ELS    I+ YWT   P A +I++F V+
Sbjct: 120 HAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMKYWTDVSP-AVFITVFGVL 172

Query: 190 LTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPW 247
             A N++ ++FYGEIE+    +K+V I   +I  L +  G GV G   +GF YWR+PGP+
Sbjct: 173 FVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLG-GVKGQERLGFHYWRDPGPF 231

Query: 248 GDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKK 307
            + L +  +        G+F+G++ ++ +  ++Y G + + I AGE  N R  +    K 
Sbjct: 232 ANYLVAGHI--------GKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKN 283

Query: 308 VVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIIL 367
           V  RI++ Y+ ++F + L+VP++D  +          PF+IA+  +G K+LP I NA+IL
Sbjct: 284 VFLRIIVLYLVTVFVLTLIVPYNDKLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALIL 343

Query: 368 ITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQ 427
            +  SAGN  I  GSR LF LA    AP+I  +T+K+G+P+V V+  + F  LAYM  ++
Sbjct: 344 TSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSE 403

Query: 428 GGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV 487
              TVF W   + +      W+ I  +HI   + LK +G SR DLP    + P  A+++ 
Sbjct: 404 SSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSG 463

Query: 488 FCMVIIIIFQGFTAFTP-TFDVSDFF 512
              VI +   GF  F    FD+  F 
Sbjct: 464 IMSVIFLFTGGFYNFMHGHFDIESFL 489

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  257 bits (656), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 157/513 (30%), Positives = 262/513 (51%), Gaps = 34/513 (6%)

Query: 55  GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAV 114
           GS     +KR LK RH                     +   GP+  +I +   G+     
Sbjct: 78  GSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGT 137

Query: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174
              LGE+    PV  +F  +++RFL PS+   +  +Y   W     LE+      V YW 
Sbjct: 138 IHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWN 197

Query: 175 FAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTG 234
            ++    W++IF+  + ++N+F  + +GE EF  ++VKV+ I GF+I C+ ++CG G   
Sbjct: 198 QSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDH 257

Query: 235 P-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGE 293
             VG +YW +PG    G                F G  + L+ A+++  GTE+V + +GE
Sbjct: 258 DFVGAKYWHDPGCLAHG----------------FPGVLSVLVVASYSLGGTEMVCLASGE 301

Query: 294 AANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENS 353
             +P K +P AIK+  +RIL F++ SL  IG LVP+ +  L          PF+IAI+  
Sbjct: 302 T-DP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS-PFVIAIKLH 358

Query: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413
             K+LP I NA+ILI+I+S GNS I+  SR L S+A  GL P+      + G P   ++ 
Sbjct: 359 QIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIIT 418

Query: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473
            ++FG+LA++  +     VFDWL+ I  +A    WL I ISHIRF   +K +G S D+L 
Sbjct: 419 NSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELE 478

Query: 474 FKANL-MPGLAYYAVFCMVIIIIFQGFTAFTP-------TFDVSDFFAAYISVILFFLIW 525
           F + + + G AY AV    +I++ Q + A  P       +     FF +Y+  ++  +++
Sbjct: 479 FVSAVGIWGSAYSAVI-NSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLF 537

Query: 526 GAFQLWFK---CRW--IWKLEDVDIDSNRRDVE 553
              +++++    +W  +  L  +D++++R++++
Sbjct: 538 VGHKIFYRYKTGKWWSMLPLNKIDLETDRKNID 570

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  255 bits (652), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 151/500 (30%), Positives = 245/500 (49%), Gaps = 21/500 (4%)

Query: 20  QTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE--VKRELKQRHXXXXXXX 77
           +  S     D   ++  ++    ++   +E+ LN     D +  VKR+LK RH       
Sbjct: 12  EVVSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALG 71

Query: 78  XXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASR 137
                         L   GP+  L+ +  +G L + + +S+GEM T  P    FT    R
Sbjct: 72  GIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRR 131

Query: 138 FLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFP 197
           F S ++ A  GY Y   +    A E + +  I+ +W   VP+  +I IFW       +  
Sbjct: 132 FHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLG 191

Query: 198 VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGDGLTSNGV 256
           V  +GE E+W+A  K++ ++ + I+ +  + G     P  GF+YW +PG   +G      
Sbjct: 192 VGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG------ 245

Query: 257 EISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFY 316
                     F G  N  +  +  Y GTE V + A E+ NPR+ VP AI++  +RIL+ Y
Sbjct: 246 ----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVY 295

Query: 317 IGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNS 376
           +G   F G+ VP++D  L          P  IAI  +G      + NA ILIT ISA N 
Sbjct: 296 LGISIFYGVTVPYNDENLNFATKVLKS-PIAIAISRAGWPAGVHLVNAFILITCISAING 354

Query: 377 NIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWL 436
           ++Y+GSR L  LA  GLAPK+L+ T ++GVP  ++      G+++ M  +      ++++
Sbjct: 355 SLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYI 414

Query: 437 VNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIF 496
           VN++ +  F  W  I ++H+RF +  K +G +RD+LP+KA L P     ++   + + + 
Sbjct: 415 VNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLV 474

Query: 497 QGFTAFTPTFDVSDFFAAYI 516
           QG++ F P FD  +F  AYI
Sbjct: 475 QGWSYFKP-FDAKNFVDAYI 493

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  255 bits (651), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 163/533 (30%), Positives = 258/533 (48%), Gaps = 31/533 (5%)

Query: 31  MKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXST 90
           +K ++I ++ D S         N+G      VKR LK RH                    
Sbjct: 29  IKAVDISEEPDVSKFDP-----NTG------VKRALKNRHISLLALGGVIGPGCLVGAGN 77

Query: 91  PLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYM 150
            L   GP+  L+ +  +G + +AV +S+GE+ T  P    FT  A RF   ++ A  GY 
Sbjct: 78  ALNKGGPLALLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTLARRFHGDALSAVCGYA 137

Query: 151 YWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAA 210
           Y   +    A E + +  I+ +W   VP+  +I IFW       +  V  +GE E+W++ 
Sbjct: 138 YVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSW 197

Query: 211 VKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLG 269
            K+V +V + I+ +  + G     P  GF YW +PG    G                F G
Sbjct: 198 FKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNSPGSLSHG----------------FKG 241

Query: 270 WFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPF 329
                +  +  Y GTE V + A E+ NP K VP A+++ ++R+L+ YIG   F G  VPF
Sbjct: 242 IAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGATVPF 301

Query: 330 DDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLA 389
           DDP L          P  IAI  +G      + NA IL+T ISA N ++Y+GSR L +LA
Sbjct: 302 DDPNLSATTKVLKS-PISIAISRAGWAGGAHLVNAFILVTCISAINGSLYIGSRTLTNLA 360

Query: 390 KTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWL 449
             GLAPKIL+ T ++GVP  ++      G+++ M  + G    + ++VN++ +  F  W 
Sbjct: 361 HEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGASDAYSYIVNLSGVGVFIVWG 420

Query: 450 FILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVS 509
            I  +H+R  +    +G S ++LP+KA L P    +++   V + + QG+T+F P FD  
Sbjct: 421 VISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIANVFLALIQGWTSFVP-FDAG 479

Query: 510 DFFAAYISVILFFLIWGAFQLWFKCRW-IWKLEDVDIDSNRRDVEKIIWEDPE 561
           +F  AYI + +  +++ A  ++    + I  L+ VD+D  RR      + D E
Sbjct: 480 NFVDAYILLPVAIVLYVAICVFKNHHFRIVDLKSVDLDEGRRKDIDADFSDQE 532

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  257 bits (656), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 168/585 (28%), Positives = 289/585 (49%), Gaps = 35/585 (5%)

Query: 2   DTLESSSQSVPRQR--KSGVQTFSTMSQDDDMKKINIIQQTDASSTT---EDEEMLNSGS 56
           D+  +S +S PR +     V +F         +K   I     S T    E++ +   GS
Sbjct: 45  DSDNTSIESEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGS 104

Query: 57  VHDA-----EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLT 111
            HD+      +K+ +K RH                  +  L   GP   +I Y+ V  +T
Sbjct: 105 DHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVT 164

Query: 112 YAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIV 170
           Y + Q+ GEMA   P +  +F  ++S F+S + G A  +++   W     LEL      +
Sbjct: 165 YFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTI 224

Query: 171 DYWTFAVPIAAWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCM-VC 228
            YW   +    +I IF+V L  +++F  V  YGE EF     K++ ++GF+I  + +   
Sbjct: 225 KYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAG 284

Query: 229 GAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTG-RFLGWFNSLINAAFTYQGTELV 287
           GAG    +G ++W +PG +              K  G RF G    L++  F+Y GTEL 
Sbjct: 285 GAGNREYIGGKFWHDPGAFA------------GKTAGSRFKGICYVLVSGYFSYGGTELF 332

Query: 288 GITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPF 346
            ++  E +NPR++ P+A K  ++RIL+ Y+ ++  IG  VP+D D  +          P+
Sbjct: 333 ALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPY 392

Query: 347 IIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGV 406
           ++A   +G KI P   NA+ILI++IS  NS++Y   R++ SLA+ G APK L    ++G 
Sbjct: 393 VLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGR 452

Query: 407 PWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRG 466
           P ++++A  + GV+ ++  +   + VF WL  I  ++  + W  I++SH+RF   +K + 
Sbjct: 453 PLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQN 512

Query: 467 ISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILF 521
            S ++L +KA      + Y V   +++   Q +TA  P       + + FFA Y+++ ++
Sbjct: 513 RSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIW 572

Query: 522 FLIWGAFQLWFKCRWIWK-LEDVDIDSNRR--DVEKIIWEDPEPK 563
            + +  + LW +   + K L+ +D+D +RR  D E +  ED E K
Sbjct: 573 LVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESK 617

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  255 bits (652), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 173/598 (28%), Positives = 290/598 (48%), Gaps = 54/598 (9%)

Query: 1   MDTLESSSQSVPR--QRKSGVQTFSTMSQDDDMKKI--NIIQQTDASSTTEDEE------ 50
           M+    S+Q V    + KS    F T+ + D+ K I  N I     S+ +  E+      
Sbjct: 1   MEEFSLSTQDVSSDIKYKSSKNEFITIIESDN-KNIDDNFIPHDTLSTISRKEKKPPIYR 59

Query: 51  -MLNS------GSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIA 103
            +++S      GS H   +K+ LK RH                     L   GP+  +I 
Sbjct: 60  RIIDSFKPPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIG 119

Query: 104 YIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALEL 163
           +   G+        LGE+    PV  +F  + +RFL PSI   V  +Y   W     LE+
Sbjct: 120 WAVAGSQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEI 179

Query: 164 SVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYC 223
                 V YW  ++    +++IF+ ++ ++N+F  + +GE EF  + VK++ I GF+I C
Sbjct: 180 IASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILC 239

Query: 224 LCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282
           + ++ G G     +G +YW NPG    G                F G  + L+ A+++  
Sbjct: 240 IVLIAGGGPDHEYIGAKYWHNPGSLAHG----------------FKGVLSVLVVASYSLG 283

Query: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX 342
           GTE+  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVP+ +P L        
Sbjct: 284 GTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDN 341

Query: 343 XXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTT 402
             PF+IAI+    K+LP I NA+IL++I+S GNS I+  SR L S+A   L P       
Sbjct: 342 S-PFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYID 400

Query: 403 KKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVL 462
           + G P   ++  ++FG+LA++  +     VFDWL+ I  +A    WL I I H+RF   +
Sbjct: 401 RAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAM 460

Query: 463 KFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSD-------FFAAY 515
           K +  + D+L F + +    + Y+     +I++ Q + A  P    +D       FF  Y
Sbjct: 461 KAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNY 520

Query: 516 ISVILFFLIWGAFQLWFKC---RWIWK---LEDVDIDSNRR--DVEKIIWEDPEPKTF 565
           +  ++  +++   +++++     W W+   L+D+D+D++R+  D+E I  E  E K +
Sbjct: 521 LCALILIVLFIGHKIYYRVTTGHW-WEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMY 577

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 172/571 (30%), Positives = 286/571 (50%), Gaps = 46/571 (8%)

Query: 29  DDMK-KINIIQQTDASSTTEDEEMLNSGSVH-------DAEVKRELKQRHXXXXXXXXXX 80
            DMK K N + +    S  ED+  L  GS+          +++R LK RH          
Sbjct: 24  SDMKVKENFVTE----SIQEDD--LERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAI 77

Query: 81  XXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV--TSSFTVFASRF 138
                      L   GP   LI+YI +    + +   L EM    P+   +S    A  +
Sbjct: 78  GTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAY 137

Query: 139 LSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPV 198
           L+  +    G+  +++ A+    E++    ++ YWT A   A ++SIF VI  A+   PV
Sbjct: 138 LNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS-AIFVSIFIVITIAVTALPV 196

Query: 199 KFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGDGLTSNGV 256
           K +GE EFWV+ +K++ I G +I  + +  G G      +GF YW++PG +   +++   
Sbjct: 197 KVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHISTG-- 254

Query: 257 EISKNKNTGRFLGWFNSLINAAFTY-QGTELVGITAGEAANPRKTVPRAIKKVVFRILLF 315
                 NTG+FL  + ++I + F +    E +   + EA  PR+ +PRA  + V+R++LF
Sbjct: 255 ------NTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLF 308

Query: 316 YIGSLFFIGLLVPFDDPKLXXXXXX----XXXXPFIIAIENSGTKILPDIFNAIILITII 371
           YIG    +G+ V +D+  L              PF+I I+  G K+LP I NA IL    
Sbjct: 309 YIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAY 368

Query: 372 SAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQT 431
           SAG + +Y  SR+L S+A  G APKI +R  + GVP+ S++  + F  LAY+  +     
Sbjct: 369 SAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQ 428

Query: 432 VFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMV 491
           VF WL NI+ I+GF +W+F+ I+++RF +V+ +  ++ D + F+       AY++    V
Sbjct: 429 VFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFV 487

Query: 492 IIIIFQGFTAFTP-TFDVSDFFAAYIS---VILFFLIWGAFQLWFKCRWIWKLED----- 542
           I+ +  G+  FT   + VSDFFA YI+   V++ F++  A+   ++ R + ++       
Sbjct: 488 ILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEWRFRDMEEIRSELIPK 547

Query: 543 VDIDSNRRDVEKIIWEDPEPKTFWDKFWNVV 573
           +D+       E +I    EP T++ K  NV+
Sbjct: 548 IDMADEEESNEIVI----EPTTWYGKLGNVL 574

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  253 bits (647), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 179/550 (32%), Positives = 280/550 (50%), Gaps = 33/550 (6%)

Query: 24  TMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXX 83
           ++  D +++ I I      SS T+D   LN G V +  + R L  RH             
Sbjct: 2   SLKNDQEVEVIGIATSQSLSSDTQDAGALNRGHVRE-NLNRSLTPRHINMISIAGVIGTG 60

Query: 84  XXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSI 143
                   L + GP   LI Y  +G + Y +   LGEM+TF+P++ SF  +A +F S S+
Sbjct: 61  LYLGTGKALANGGPASLLINYGIIGLVVYLIMLCLGEMSTFMPISGSFCSYAKKFGSGSL 120

Query: 144 GAAVGYMYWFSWAVTFALELSVVGQIVDYW---TFAVPIAAWISIFWVILTALNMFPVKF 200
              +   YWF+ AV+ A +L+ +  I+DYW       P  A   IFW  L  LN+  V+ 
Sbjct: 121 AFTLMCNYWFNDAVSVASDLTALQLILDYWKNPNSHFPYWAASLIFWFALLLLNVVHVRV 180

Query: 201 YGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEIS 259
           YGE E+W+A +KV+AI+ F I  + +  G       +GF+ W      GD    NG    
Sbjct: 181 YGEAEYWLALLKVIAIIMFFIISIIVNAGHNSDHAYIGFKNWGV----GDAPFVNG---- 232

Query: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319
                  F G+ +  ++++F + GTE + +TAGEA NP +  P+ IK V +RIL+FY+ +
Sbjct: 233 -------FKGFASLFVSSSFAFGGTESITLTAGEAVNPVRNTPKIIKTVFWRILIFYVFT 285

Query: 320 LFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379
            FFIG+ VP++ P L          PF I  +  G++      NA+IL ++ISAGN  ++
Sbjct: 286 AFFIGMNVPYNYPNL--SEKSVMTSPFTIVFQMVGSRGAGSFMNAVILTSVISAGNHALF 343

Query: 380 VGSRILFSLAKTG-LAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVN 438
            GSR+LF++   G   P  +++T +  VP+V+VL T   G L +  +  G  T++ WL N
Sbjct: 344 AGSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVLITWAAGGLCFGSSFIGAGTLWTWLQN 403

Query: 439 ITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQG 498
           I  ++   AWL I +  IRF + L  +G +  +L F     P   Y+ V  +  II  QG
Sbjct: 404 IVGVSNQLAWLCISVISIRFRRGLARQGKTH-ELQFVNWTYPYGPYFLVVFVTFIIFVQG 462

Query: 499 FTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWE 558
           +++F P + VSDFF+ YI +I+F  +   +  W    W+WK  D  + S+  D     + 
Sbjct: 463 WSSFAP-WSVSDFFSYYIELIVFVAL---YAFW----WLWK-RDSFVKSDEMDFVTDKYV 513

Query: 559 DPEPKTFWDK 568
            PE +   ++
Sbjct: 514 SPEEEVLLNE 523

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/518 (29%), Positives = 264/518 (50%), Gaps = 26/518 (5%)

Query: 59  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSL 118
           D  +K+ +K RH                  +  L  +GP   +I Y  V  +TY V Q+ 
Sbjct: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133

Query: 119 GEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177
           GEMA   P +   F  +AS F+S   G A  +++   W     LEL      + YW   +
Sbjct: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPV 236
               ++ I +V L  ++ F V+ YGE EF   + K++ I GF+I  + + CG AGV G +
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           G +YWR+PG +           + +    RF G    L+ A F+Y G EL  ++  E  N
Sbjct: 254 GGKYWRDPGAF-----------ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQEN 302

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX-XXXXXXPFIIAIENSGT 355
           PR++ P A K+ ++RIL+ Y+ ++  IG  VP +  +L           P+++A+   G 
Sbjct: 303 PRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGV 362

Query: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415
           K++P I NA+ILI++ S  NS +Y   R+L SLA+ G APK  +   ++G P  +++  +
Sbjct: 363 KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCS 422

Query: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475
           +FGV+A+   +   + +F WL  I  ++  + W  IL+SH+RF   +K +G S ++L + 
Sbjct: 423 IFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYI 482

Query: 476 ANLMPGL--AYYAVFCMVIIIIFQGFTAFTP-----TFDVSDFFAAYISVILFFLIWGAF 528
           +  + G+  + Y  F  V++ I Q + A +P      +    FF +Y++  ++   +  +
Sbjct: 483 S--ITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540

Query: 529 QLWFK-CRWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563
            L+ +   ++  L+ +D+D++RR  D E +  ED E K
Sbjct: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  253 bits (647), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 169/543 (31%), Positives = 260/543 (47%), Gaps = 42/543 (7%)

Query: 19  VQTFSTMSQDDDMKKINIIQQTDASSTTEDEEM-LNSGSVHDAEVKRELKQRHXXXXXXX 77
           V  F   S+ DD+ K +  ++ D  +    E+   N+G      VKR LK RH       
Sbjct: 7   VACFKDESRSDDLSKFSK-EEPDTHNIKSFEQFDPNTG------VKRALKNRHISLLALG 59

Query: 78  XXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASR 137
                         L   GP+  L+ +  +G + +AV +S+GEM T  P  S F+  + R
Sbjct: 60  GIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRR 119

Query: 138 FLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFP 197
           F S ++ A  GY Y   +    A E + +  I+ +W   VP+  +I IF V      M  
Sbjct: 120 FHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLG 179

Query: 198 VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGDGLTSNGV 256
           V  +GE E+W+A  K++ ++ + I+ +  + G     P  GF YW NPG   DG      
Sbjct: 180 VGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALADG------ 233

Query: 257 EISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFY 316
                     F G     +  +  Y GTE V + A E+ NP K VP AIK+  +RI++ Y
Sbjct: 234 ----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVY 283

Query: 317 IGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNS 376
           +G   F G  VP++D  L          P  IAI  +G +    + NA ILIT +SA N 
Sbjct: 284 LGIAVFYGATVPYNDTSLGAHTKALKS-PIAIAITRAGWEGGVHLVNAFILITCVSAING 342

Query: 377 NIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWL 436
           ++Y+GSR L  LA  GLAPK L  T K+GVP  ++      G+++ M  + G    + ++
Sbjct: 343 SLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYI 402

Query: 437 VNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIF 496
           VN++ +  F  W  I ++H+RF +    +G S  +LP+K+ L P    +++   + + + 
Sbjct: 403 VNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLI 462

Query: 497 QGFTAFTPTFDVSDFFAAYI----SVILFFLIW----GAFQLWFKCRWIWKLEDVDIDSN 548
           QG+T F P F   DF  AYI    +VIL+ +I     G F+L         L  VD++  
Sbjct: 463 QGWTTFVP-FSAKDFVDAYILLPAAVILYIVISLVKIGGFKL-------VDLRTVDLEEG 514

Query: 549 RRD 551
           RR+
Sbjct: 515 RRE 517

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  251 bits (640), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 235/468 (50%), Gaps = 31/468 (6%)

Query: 13  RQRKSGVQTFSTMSQDDDMKKI----NIIQQ-TDASSTTEDEEMLNSGSVHDAEVKRELK 67
           ++ KS   +  T  ++D +++     N++Q+  D+    ED      GS H   +K+ LK
Sbjct: 25  QEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPED------GSFHSDNLKKSLK 78

Query: 68  QRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV 127
            RH                     L   GP+  +I +   GT        LGE+    PV
Sbjct: 79  ARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPV 138

Query: 128 TSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFW 187
             +F  + +RFL PSI   V  +Y   W     LE+      V+YW  +V    W++IF+
Sbjct: 139 VGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFY 198

Query: 188 VILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGP 246
            I+  +N+  V+ +GE EF  + +KV+ IVGF+I C+ ++CG G     VG +YW +PGP
Sbjct: 199 GIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGP 258

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
             +G                F G    L+ A+++  GTE+  + +GE  +P K +P AIK
Sbjct: 259 LANG----------------FKGVAGVLVIASYSLGGTEMACLASGE-TDP-KELPSAIK 300

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAII 366
           +V +RI+ F++ SL  +G LVP+ +  L          PF+IAI   G   LP I NA+I
Sbjct: 301 QVFWRIVFFFLVSLTLVGFLVPYTNQNL-MGGSSVDNSPFVIAIRLHGINALPSIVNAVI 359

Query: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426
           L++++S GNS I+  SR L S+A  GL P++     + G P   +L   +FG+LA++  +
Sbjct: 360 LVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKS 419

Query: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
                VF WL+ I  +A    WL I ISHIRF   +K +G+  ++L F
Sbjct: 420 GSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  251 bits (640), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 235/468 (50%), Gaps = 31/468 (6%)

Query: 13  RQRKSGVQTFSTMSQDDDMKKI----NIIQQ-TDASSTTEDEEMLNSGSVHDAEVKRELK 67
           ++ KS   +  T  ++D +++     N++Q+  D+    ED      GS H   +K+ LK
Sbjct: 25  QEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPED------GSFHSDNLKKSLK 78

Query: 68  QRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV 127
            RH                     L   GP+  +I +   GT        LGE+    PV
Sbjct: 79  ARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPV 138

Query: 128 TSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFW 187
             +F  + +RFL PSI   V  +Y   W     LE+      V+YW  +V    W++IF+
Sbjct: 139 VGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFY 198

Query: 188 VILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGP 246
            I+  +N+  V+ +GE EF  + +KV+ IVGF+I C+ ++CG G     VG +YW +PGP
Sbjct: 199 GIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGP 258

Query: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306
             +G                F G    L+ A+++  GTE+  + +GE  +P K +P AIK
Sbjct: 259 LANG----------------FKGVAGVLVIASYSLGGTEMACLASGE-TDP-KELPSAIK 300

Query: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAII 366
           +V +RI+ F++ SL  +G LVP+ +  L          PF+IAI   G   LP I NA+I
Sbjct: 301 QVFWRIVFFFLVSLTLVGFLVPYTNQNL-MGGSSVDNSPFVIAIRLHGINALPSIVNAVI 359

Query: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426
           L++++S GNS I+  SR L S+A  GL P++     + G P   +L   +FG+LA++  +
Sbjct: 360 LVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKS 419

Query: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
                VF WL+ I  +A    WL I ISHIRF   +K +G+  ++L F
Sbjct: 420 GSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 162/533 (30%), Positives = 263/533 (49%), Gaps = 39/533 (7%)

Query: 35  NIIQQT-DASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLE 93
           NI Q+  D+    ED      GS   + +K+ LK RH                     L 
Sbjct: 64  NIFQRAIDSFKPPED------GSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALA 117

Query: 94  DSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWF 153
             GP+  +I +   G+        LGE+    PV  +F  +++RFL PSI   V  +Y  
Sbjct: 118 TGGPLAVIIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVI 177

Query: 154 SWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKV 213
            W     LE+      V YW  ++    W++IF+V + ++N+F V+ +GE EF  + +KV
Sbjct: 178 QWFFVLPLEIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKV 237

Query: 214 VAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFN 272
           + I GF++ C+ ++ G G     VG RYW NPG   +G                F G  +
Sbjct: 238 ITISGFILLCIILIAGGGPDHVYVGSRYWHNPGCLANG----------------FPGVLS 281

Query: 273 SLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDP 332
            ++ A+++  GTE+  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVP+ + 
Sbjct: 282 VMVVASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNE 339

Query: 333 KLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTG 392
            L          PF+IAI+    K+LP I NA+ILI+I+S GNS I+  SR L S+A   
Sbjct: 340 NLLGGSSVDNS-PFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQH 398

Query: 393 LAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFIL 452
           L P       + G P V ++  ++FG+LA++  +     VFDWL+ I  +A    WL I 
Sbjct: 399 LLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSIN 458

Query: 453 ISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFD----- 507
           +SHIRF   +K +G S ++L F + +    + Y+     +I++ Q + +  P        
Sbjct: 459 VSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSE 518

Query: 508 --VSDFFAAYISVILFFLIWGAFQL--WFKCRWIWK---LEDVDIDSNRRDVE 553
                FF +Y+  ++   IW   ++  W +   IW    L ++D+D  R++++
Sbjct: 519 DRAKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNID 571

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  253 bits (646), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 159/558 (28%), Positives = 275/558 (49%), Gaps = 40/558 (7%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDMKKI--NIIQQTDASSTTEDEEMLNSGSVHDAEV 62
           E S Q V  Q+     T +     ++ KKI  +  +Q   S  +E E      S     +
Sbjct: 42  EESEQQVKPQK-----TGNKSKLQNECKKILSSFKRQLPPSQNSELE------SQEKNNL 90

Query: 63  KRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA 122
            + +K RH                     L  +GP G ++ Y     + Y + Q+ GE+ 
Sbjct: 91  TKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELG 150

Query: 123 -TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
             +  +T ++T + S  + PS+G AV  +Y   W     L+L      V YWT +V    
Sbjct: 151 LCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNSDI 209

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRY 240
           ++++ ++ +  +N+F  + Y E EF     K++ ++GF+I  + + CG AG    +G  Y
Sbjct: 210 FVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEY 269

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           W NPGP+  G                F G       AAF+Y G E++ ++A E  NP K+
Sbjct: 270 WHNPGPFAHG----------------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKS 313

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX--XXXXXXXPFIIAIENSGTKIL 358
           +P A KKVV+RILL Y+ +   +  LVP++  +L            PF+IA+ + G K++
Sbjct: 314 IPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVV 373

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           P   NA+ILI++IS  NS++Y G R+L SLA+ G+ PK L+   ++G P +  L +  FG
Sbjct: 374 PHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFG 433

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
            + ++ T+   + VF WL+ I++++  + W+ + +SHIRF   +  +G S +++ +KA  
Sbjct: 434 CIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQT 493

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTPTFD-----VSDFFAAYISVILFFLIWGAFQLWFK 533
               ++ AV   V  ++ Q + A  P  D     V  FF  Y+++ +  + +   +++FK
Sbjct: 494 GYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFK 553

Query: 534 CRWIWKLED-VDIDSNRR 550
               W   D +D++S+R 
Sbjct: 554 SWSFWIPADKIDLNSHRN 571

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 165/559 (29%), Positives = 275/559 (49%), Gaps = 34/559 (6%)

Query: 34  INIIQQTDASSTTEDEEMLNSGSVH---DAEVKRELKQRHXXXXXXXXXXXXXXXXXXST 90
           I+  ++ +  +  E    L  G+      + +K+ LK RH                  + 
Sbjct: 59  IDSFKRAEHGNLNEKSADLEDGTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAK 118

Query: 91  PLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGY 149
            L   GP   +I Y+ V  + Y + Q+ GEMA   P +  +F  + S F+S S G A  +
Sbjct: 119 SLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVW 178

Query: 150 MYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVA 209
           ++   W     LEL      + YWT  +    ++ IF+V L  ++   VK YGE EF   
Sbjct: 179 LFCIQWITVLPLELITSSLTIQYWT-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFN 237

Query: 210 AVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFL 268
             K++ I GF+I+ + + CG AG  G +G +YW  PG + +G             T RF 
Sbjct: 238 LCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAEG-----------GPTSRFK 286

Query: 269 GWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVP 328
           G    L+   F+Y GTEL  ++  E A PRK  P A KK ++RIL+ Y+ ++  IG  VP
Sbjct: 287 GICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVP 346

Query: 329 FDDPKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFS 387
            +  +L           P+++A    G K++P I NA+ILI+++S  NS++Y   R+L S
Sbjct: 347 HNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLAS 406

Query: 388 LAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWA 447
           LA+ G APK L+   ++G P V++L  AVFG +A++ ++   + VF WL  I  ++  + 
Sbjct: 407 LAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFT 466

Query: 448 WLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP--- 504
           W  I+ SH+RF   +K +    D++ +KA      +++     V+++I Q + A +P   
Sbjct: 467 WTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGS 526

Query: 505 --TFDVSDFFAAYISVILFFLIWGAFQLWFKCRW--IWKLEDVDIDSNRR--DVEKIIWE 558
                   FF  Y+++ ++   +  + ++ K  W  +  L  +D+D++RR  D + I  E
Sbjct: 527 GGAVSAESFFENYLAMPIWVFFYIVYSVYNK-EWTILTDLSKIDLDAHRRIYDPDLIRQE 585

Query: 559 DPEPKT------FWDKFWN 571
           D E K       FW + +N
Sbjct: 586 DAENKEKLKNSPFWVRVYN 604

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  251 bits (641), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 151/520 (29%), Positives = 259/520 (49%), Gaps = 26/520 (5%)

Query: 42  ASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSL 101
           A     D E L+S     A +++ +K RH                     +  +G  G+L
Sbjct: 5   AKEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTL 64

Query: 102 IAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFA 160
           I Y+ +G +     QS+GE+    P +   F  +  +F+ PS+G  V +++   W V   
Sbjct: 65  IGYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLP 124

Query: 161 LELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFL 220
           LEL      + YW   +  + ++S F++++  +N F    Y E EF    VKV+ +  F+
Sbjct: 125 LELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFI 184

Query: 221 IYCLCMVCGA-GVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAF 279
           +  + ++ G  G +GP+GF+Y + PG +             N N   F     +L+NAAF
Sbjct: 185 VLGIVIITGGLGNSGPIGFQYLKTPGAF-------------NTNYNVFKATAGTLVNAAF 231

Query: 280 TYQGTELVGITAGEAA--NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXX 337
           +  G E + ++A E    N  K++ RA ++V  R+ +FY+ S+  +GLLVP+D P L   
Sbjct: 232 SCGGVEFLALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGS 291

Query: 338 XX-XXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPK 396
                   P++ AI   G +I+P I NA+ILI ++S  NS +Y  SR L SLA+   AP+
Sbjct: 292 GSDTTHTSPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPR 351

Query: 397 ILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHI 456
             +   K G P   ++ +A+ G+++++   +  + VF WL++I+ ++  + W  I I+HI
Sbjct: 352 YFALLNKHGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHI 411

Query: 457 RFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDF 511
           RF   LK +G S D L +++N     +Y A    V++II Q + +  P       D   F
Sbjct: 412 RFRNALKLQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKF 471

Query: 512 FAAYISVILFFLIWGAFQLWFK--CRWIWKLEDVDIDSNR 549
           F  Y++V +  L++   +L+      WI +   VDI+++R
Sbjct: 472 FQNYMAVPVAVLLYLGHKLYTNDWTPWI-RTHCVDINTDR 510

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  251 bits (640), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 173/539 (32%), Positives = 281/539 (52%), Gaps = 37/539 (6%)

Query: 8   SQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELK 67
           S+S+     S  +   +  Q D     ++I +T +    E   +    ++ + ++ R LK
Sbjct: 2   SKSISSATNSSEEISISKKQQD-----HLIYETTSYGVNEVYTIDPEANIRE-DLTRALK 55

Query: 68  QRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV 127
            RH                  ST L   GP    I Y  +G + Y     L EM+T++P+
Sbjct: 56  PRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPI 115

Query: 128 TSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW---TFAVPIAAWIS 184
           + SF  +A +F S S   A+ + YWF+ AV+ A +L+ +  ++DYW   +   P  A   
Sbjct: 116 SGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASL 175

Query: 185 IFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWR- 242
           IFW  + +LN+  V+FYGE E+W+A +KV+AI+ F I  + +  G       +GF+ W  
Sbjct: 176 IFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWTV 235

Query: 243 NPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVP 302
              P+ DG                F G+ +  ++A+F Y GTE + +T+GE+ NP +  P
Sbjct: 236 GEAPFVDG----------------FKGFASLFVSASFAYGGTESITLTSGESDNPLRNTP 279

Query: 303 RAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIF 362
           + +K V +RIL FYIG+ FFI + VP++ P L          PF I  + +GT       
Sbjct: 280 KIVKTVFWRILFFYIGTTFFIAMNVPYNYPGL--SSGSVVTSPFTIVFKMAGTAGAGSFM 337

Query: 363 NAIILITIISAGNSNIYVGSRILFSLAKTGLAPK-ILSRTTKKGVPWVSVLATAVFGVLA 421
           NA+I+ ++ISA N  ++ GSRI++++   G  PK I+SRT +  VP+V+VL T   G L 
Sbjct: 338 NAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLC 397

Query: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481
           +  +  G  T++ WL NI  ++   AWL I I+ IRF Q L+ +  +  +L FK    P 
Sbjct: 398 FGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKFKNWTYPF 456

Query: 482 LAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILF---FLIWGAFQL--WFKCR 535
             Y+ V  +  II+ QG+++F P ++VS+FF+ YI + +F   F+IW  ++   + KC+
Sbjct: 457 GPYFLVVAVTFIILVQGWSSFAP-WNVSNFFSVYIELFVFPFCFIIWWLYKRDPFVKCK 514

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  249 bits (636), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 142/518 (27%), Positives = 261/518 (50%), Gaps = 33/518 (6%)

Query: 47  EDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIF 106
           + +E  +S +  + ++ + ++ RH                   + L  SGP+G +I YI 
Sbjct: 69  KRKEHDDSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIV 128

Query: 107 VGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSV 165
              + + + Q+ GE+   +  V  +FT + +  + P+ G A+ ++Y   W +   L+L  
Sbjct: 129 SSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVT 188

Query: 166 VGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLC 225
               + +W   V +  ++   +V++  +N+   + Y E EF+    K+V + GF+I  + 
Sbjct: 189 AAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGII 248

Query: 226 MVCGAGVTGPVGF---RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282
           +  G    GP G+   +YWRNPG + +G                F G  +    AAF+Y 
Sbjct: 249 ITAGGIPNGPDGYIGGKYWRNPGLFANG----------------FKGVCSVFCYAAFSYG 292

Query: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXX 342
           G E + ++A E  NP K++P A KKV++RIL  Y+ SL  +  LVP+  P L        
Sbjct: 293 GVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGS 352

Query: 343 XX-PFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRT 401
              PF+IAI + G  ++P + NA+ILI+++S  NS +YV  R+L SLA+ G APK L+  
Sbjct: 353 HSSPFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYI 412

Query: 402 TKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQV 461
            K+G P    L   +FG++ ++  +   + VF WL++I+ +   + W+ I +SHIRF   
Sbjct: 413 DKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDA 472

Query: 462 LKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT-----FDVSDFFAAYI 516
           ++ +G    ++ +KA      +Y A+   + +++ Q + A  P       D ++FF  Y+
Sbjct: 473 MRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYL 532

Query: 517 SVILFFLIWGAFQLWFKCRWIWKL----EDVDIDSNRR 550
           +  +    +  F++++K    W+L    + +++D+NR 
Sbjct: 533 AFPVVLCAYLGFKVYYKQ---WQLLIPADKIELDNNRN 567

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 157/557 (28%), Positives = 266/557 (47%), Gaps = 40/557 (7%)

Query: 5   ESSSQSVPRQRKSGVQTFSTMSQD--DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEV 62
           E   Q   RQ  SG        +   D  K+       D +S  E +E  N        +
Sbjct: 42  EGLQQQAKRQGTSGKFKLQNECKKFFDSFKRQ---LPADQNSELESQERNN--------L 90

Query: 63  KRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA 122
            R +K RH                     L  +GP G ++ Y     + Y + Q+ GE+ 
Sbjct: 91  TRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELG 150

Query: 123 -TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181
             +  +T ++T ++S  + PS+G AV  +Y   W     L+L      + YWT  V    
Sbjct: 151 LCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWT-NVNADI 209

Query: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRY 240
           +++  ++ +  +N+F  K Y E EF     K++ ++GF+I  + + CG AG    +G +Y
Sbjct: 210 FVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKFIGTKY 269

Query: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300
           W NPGP+  G                F G       AAF+Y G E++ ++A E  NP K+
Sbjct: 270 WHNPGPFAHG----------------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKS 313

Query: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXX--XXXPFIIAIENSGTKIL 358
           +P A KKVV+RIL  Y+ +   I  LVP++  +L            PF+IA+ + G K++
Sbjct: 314 IPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVV 373

Query: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418
           P   NA+ILI++IS  NS++Y   R+L SLA+ G  PK L+   + G P +  L + +FG
Sbjct: 374 PHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFG 433

Query: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478
            + ++ T+   + VF WL+ I++++  + W+ + +SHIRF   +  +G S D++ +KA  
Sbjct: 434 CIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQT 493

Query: 479 MPGLAYYAVFCMVIIIIFQGFTAFTPT-----FDVSDFFAAYISVILFFLIWGAFQLWFK 533
               ++ AV   +  ++ Q + A  P       D + FF  Y+++ +    +   +++ K
Sbjct: 494 GYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHKIYTK 553

Query: 534 CRWIW-KLEDVDIDSNR 549
               W   E +D+DS+R
Sbjct: 554 SWKFWIPAEKIDLDSHR 570

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  250 bits (639), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 261/499 (52%), Gaps = 20/499 (4%)

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
           E+K+ +K RH                   + L  +GP G L+ +  +GT  Y + Q++GE
Sbjct: 148 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGE 207

Query: 121 MA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179
           MA  +  +   F  + S  + P+ G +V ++Y   W     LEL      + YWT  V  
Sbjct: 208 MAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDP 267

Query: 180 AAWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT-GPVG 237
             ++ IF+V++ A+N+      Y E EF   + K++ ++GF I  + ++CG     G +G
Sbjct: 268 DVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIG 327

Query: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297
            +YW  PG +                  RF G   +L+NAAF +  +E +G+TA E +NP
Sbjct: 328 GKYWHEPGAF-----------RGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNP 376

Query: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLXXXXXXXXXXPFIIAIENSGTK 356
           RK +P A KK+++RI+  ++ S+  +G LVP+D D  L          P+++A+   G K
Sbjct: 377 RKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVK 436

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416
           ++P   NA+ILI+++S  NS  Y  SR+L SLA+ G APKI     ++G P V +   ++
Sbjct: 437 VVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASL 496

Query: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476
           FGV+A+  T+     VF WL+ I+ ++  + W+ I +SH+RF + +  +G S  +L F++
Sbjct: 497 FGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRS 556

Query: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWF 532
            +    + YA   MV I+I Q + A  P      D  +FF  Y+++ +   ++  ++++ 
Sbjct: 557 QVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYT 616

Query: 533 KCRWIW-KLEDVDIDSNRR 550
           K   I+ + +D+D+ S+R 
Sbjct: 617 KNWTIFIRAKDIDLVSHRN 635

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  249 bits (635), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 160/549 (29%), Positives = 277/549 (50%), Gaps = 35/549 (6%)

Query: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXXXXXXXXXXXXXX 88
           D  ++ +I  Q D     E + + N+G      +K+ LK RH                  
Sbjct: 76  DSYRRADIPGQDDP----EGDMVSNAG------LKQALKTRHVAMMSLGTGIGTGLLIAN 125

Query: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIP-VTSSFTVFASRFLSPSIGAAV 147
              L ++GP   LI Y  V   TY + Q+ GE+A   P +  SF  + S+ +S   G A 
Sbjct: 126 GKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFAT 185

Query: 148 GYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFW 207
            ++++  W   F +EL  +   V +WT  V    ++ IF+V L  ++   V+ YGE EF+
Sbjct: 186 TWLFFVQWLTMFPMELIAMTFAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETEFF 245

Query: 208 VAAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGR 266
           +   KV+ ++GF+I+ +C+  G AG +G +G +YW +PG       S+  E       GR
Sbjct: 246 LNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAKYWHDPG----AFVSHTAE-------GR 294

Query: 267 FLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLL 326
           F G    L++A F+Y GTEL  ++  E  NPRKT+P A K  ++RI+  Y+ ++  +G  
Sbjct: 295 FKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFT 354

Query: 327 VPFDDPKLX----XXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382
           VP + P+L              P+++A      ++LP   NA++++ ++S  NS +Y   
Sbjct: 355 VPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAP 414

Query: 383 RILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAI 442
           R++ SLA+ G  PK      ++G P  +++   + GV+A+  +++  +T+F WL  I  +
Sbjct: 415 RLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGL 474

Query: 443 AGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAF 502
           +  + W  I++SH+RF   +K +G   ++L +K+N     + Y VF  +++   Q + A 
Sbjct: 475 SELFTWSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVAL 534

Query: 503 TP-----TFDVSDFFAAYISVILFFLIWGAFQLWFK-CRWIWKLEDVDIDSNRR--DVEK 554
           +          SDFF +Y+++ ++   +  F LW +   ++  L  VD+DS RR  D E 
Sbjct: 535 SAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPEL 594

Query: 555 IIWEDPEPK 563
           +  ED E K
Sbjct: 595 LRQEDEEHK 603

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  247 bits (630), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 163/539 (30%), Positives = 251/539 (46%), Gaps = 37/539 (6%)

Query: 24  TMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE-------VKRELKQRHXXXXXX 76
           T  + DD       +   +S  T D+     G  H+A        VKR LK RH      
Sbjct: 10  TKGKGDDAS----CESYTSSGITPDQIETGEGKNHNASLYDPKTGVKRALKDRHISLLAL 65

Query: 77  XXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFAS 136
                          L   GP+  L+ +  +G + + + +S+GEM T  P    FT  A 
Sbjct: 66  GGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLAR 125

Query: 137 RFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMF 196
           RF S S+ A  GY Y   +    A E + +  I  +W   VP+  +I IFW    A  M 
Sbjct: 126 RFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMA 185

Query: 197 PVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGDGLTSNG 255
            V  +GEIE+W++  K++ +V F I+    + G     P  GF YW NPG    G     
Sbjct: 186 GVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG----- 240

Query: 256 VEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLF 315
                      F G     +  +  Y GTE V  +A E+ NP + +P AI++  +RIL+ 
Sbjct: 241 -----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVV 289

Query: 316 YIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGN 375
           YIG  FF G+ VP++D  L          P  IAI  +G +    + NA IL+T ISA N
Sbjct: 290 YIGIGFFYGVTVPYNDHNLNAGTKALKS-PISIAITRAGWEGGTHLVNAFILVTCISAIN 348

Query: 376 SNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDW 435
            ++++GSR + +LA  GLAPK L+ T ++GVP  ++      G+++ M  + G  T + +
Sbjct: 349 GSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSY 408

Query: 436 LVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIII 495
           +VN++ +  F  W  I ++H+RF +    +G +  +LP+KA   P      +   + + +
Sbjct: 409 IVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLAL 468

Query: 496 FQGFTAFTPTFDVSDFFAAYI----SVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRR 550
            QG+T+F P F   DF  AY+    + +L+  I       FK      L  +D+D  RR
Sbjct: 469 IQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTV---DLLTIDLDEGRR 523

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  248 bits (632), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 166/552 (30%), Positives = 268/552 (48%), Gaps = 51/552 (9%)

Query: 38  QQTDASSTTEDEEMLNSGSVHDA----EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLE 93
           ++ + S+  ED E   SGS+++     E+K+ +K RH                  +  L 
Sbjct: 72  KRAEKSTEAEDGE---SGSIYNGNESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLA 128

Query: 94  DSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYW 152
            SGP   +I Y  V  +TY + Q+ GE+  T+  +  +F V+    +S   G A  ++  
Sbjct: 129 ISGPAPLVIGYGLVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLAS 188

Query: 153 FSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVK 212
             W     LEL      + YWT  V    ++ I +V L  +++F VK YGE EF     K
Sbjct: 189 VQWLTVIPLELITCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCK 248

Query: 213 VVAIVGFLIYCLCM-VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWF 271
           ++ I GF+I  + + V GAG  G +G  YW NPG +           + +    RF    
Sbjct: 249 ILMIAGFIILSIVINVGGAGNDGYIGGSYWNNPGAF-----------ASDNAASRFKSIC 297

Query: 272 NSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDD 331
             L+   F+Y GTEL  ++  E  NPRK+ P+A K  ++RIL+ Y+ ++  IG  VP D 
Sbjct: 298 YILVTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPHDS 357

Query: 332 PKLXXXX-XXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAK 390
            +L           P+++A    G K++P   NA+ILI +IS  NS++Y   R++ SLA+
Sbjct: 358 DQLMGSAGSSAHASPYVLAASLHGVKVVPHFINAVILIALISVANSSLYAAPRMMVSLAQ 417

Query: 391 TGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLF 450
            G APK L+   ++G P + +   AVFGV+ +  ++   + VF WL  I  ++  + W  
Sbjct: 418 QGFAPKFLTYVDREGRPLLGIAVCAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSA 477

Query: 451 ILISHIRFMQVLKFRGISRDDLPFKA-----NLMPGLAYYAVFCMVIIIIFQGFTAFTP- 504
             +SHIRF Q +K +G +  +  + +       + GL +      +++ I Q + A +P 
Sbjct: 478 FFLSHIRFRQAMKVQGKNIKECGYLSVTGIWGSIIGLCF-----NILVFIAQFWVALSPI 532

Query: 505 ----TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK-------LEDVDIDSNRR--D 551
                 D   FF +Y++    F IW AF  +F C + +K       LE +D+D +RR  D
Sbjct: 533 GNDGKCDAQAFFQSYLA----FPIWLAF--YFGCMFYYKDYTLLNPLESIDLDDHRRIYD 586

Query: 552 VEKIIWEDPEPK 563
            E++  ED   K
Sbjct: 587 PEELKKEDLATK 598

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  245 bits (626), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 162/531 (30%), Positives = 271/531 (51%), Gaps = 29/531 (5%)

Query: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60
           +D+ E S+++      +G +      +D    KI ++   +  S ++D E  +  +V   
Sbjct: 5   IDSTEGSTKNRIGYTVNGPRNSKDDWKDGTDHKIVVVDTNN--SVSDDPE--SQDAVIRE 60

Query: 61  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120
            + R L  RH                  +  L   GP   LI Y+ +G + Y    SLGE
Sbjct: 61  RLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVIYLTMLSLGE 120

Query: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW---TFAV 177
           M+TF+P++ S+  ++ +F+S S   A+    W+S AV+ A +L+ +  ++DYW   T   
Sbjct: 121 MSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLDYWKTNTHHF 180

Query: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-V 236
           P  A   +FW ++  LN+  VK YGE E+W+A +KVVA++ F I  +   CG       +
Sbjct: 181 PYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANCGHNQQHEYI 240

Query: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296
           GF+ W +    GD     G           F G+    + ++F+Y GTE V +T GEA N
Sbjct: 241 GFKNWSH----GDAPFVQG-----------FKGFVTIFVTSSFSYGGTETVTLTGGEAKN 285

Query: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTK 356
           P +  P+ IK V +RIL+FY+ ++FF+G+ +P+D P L          PF I  + +GTK
Sbjct: 286 PVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNL--KTKSVLTSPFTIVFQMAGTK 343

Query: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAP--KILSRTTKKGVPWVSVLAT 414
                 NA+I+ + ISA N  ++ GSRIL+++   G  P  +  ++T +   P+V+V+ T
Sbjct: 344 AAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAVITT 403

Query: 415 AVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPF 474
              G L +  +  G   +F WL NI  ++   +WL I +  IRF + L+ +G    +L F
Sbjct: 404 WAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHELKF 462

Query: 475 KANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIW 525
           +    P   ++ +  + +II+ QG++AF P +  S FF+ Y+ +I+F   W
Sbjct: 463 RNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACW 512

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  246 bits (629), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 153/538 (28%), Positives = 265/538 (49%), Gaps = 39/538 (7%)

Query: 47  EDEEMLNSGSVHDAEVK--RELKQRHXXXXXXXXXXXXXXXXXXSTPLEDSGPVGSLIAY 104
           + +++ N G   + E +  + +K RH                     L  SGP G +I Y
Sbjct: 89  KRQKVRNDGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGY 148

Query: 105 IFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALEL 163
                + Y V Q+ GE+   +  +T ++T + +  + P++G AV  +Y   W     L+L
Sbjct: 149 GVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQL 208

Query: 164 SVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYC 223
                 + YWT  V    +++   V++ A+NMF  K Y E EF+    K++ + GF+I  
Sbjct: 209 VTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILG 268

Query: 224 LCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282
           + + CG AG    +G +YW+ PG + +G                F G       AAF+Y 
Sbjct: 269 IVINCGGAGDKEYIGVKYWQTPGAFANG----------------FKGVAAVFCYAAFSYG 312

Query: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLXXXX---X 339
           G E++ +TA E ANPRK +P A +KVV+R+L  Y+ +   +  LVP++ P L        
Sbjct: 313 GIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGS 372

Query: 340 XXXXXPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILS 399
                PF+IA+ + G +++P I NA ILI++IS  NS++Y G R+L SL++ G APK  +
Sbjct: 373 GSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFN 432

Query: 400 RTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFM 459
              ++G P + VL +   G++A++      + VF WL+ ++ ++  + W+ I ISH+RF 
Sbjct: 433 YIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFR 492

Query: 460 QVLKFR--GI-SRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-----TFDVSDF 511
             ++ +  G+ +RD + + A      +  A+   + I++ Q + A  P       DV  F
Sbjct: 493 DAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIF 552

Query: 512 FAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRD--VEKIIWEDPEPKTFWD 567
           F  Y++  +    + A+++W +    W+L    I +N  D  V  +  E P+  T + 
Sbjct: 553 FENYLAAPVLLGGYLAYKIWHR---DWRL---CIPANEIDLSVLPLARESPQDSTSYH 604

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  243 bits (621), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 163/544 (29%), Positives = 264/544 (48%), Gaps = 42/544 (7%)

Query: 17  SGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHXXXXXX 76
           S V+ FS +    ++K + I    D S     E   N+G      VKR LK RH      
Sbjct: 2   SDVKAFSPL----NIKTVKIRDDRDVS-----EFDPNTG------VKRALKNRHISLLAL 46

Query: 77  XXXXXXXXXXXXSTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFAS 136
                          L+  GP+  L+ ++ +G + +AV +S+GEM T  P    FT  A 
Sbjct: 47  GGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEMITLYPSGGGFTTLAR 106

Query: 137 RFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMF 196
           RF S ++ A  GY Y   +    A E + +  I+ +W   VP+ A+  IFW++     + 
Sbjct: 107 RFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVPLYAYTLIFWIVFEIFQLI 166

Query: 197 PVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGDGLTSNG 255
            V  +GE E+W++ +K++ ++ + I+ +  + G     P  GF YW++PG    G     
Sbjct: 167 GVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGFHYWKDPGSLSHG----- 221

Query: 256 VEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLF 315
                      F G     +  +  Y GTE V +TA E+ NP K+VP A+++ ++RI++ 
Sbjct: 222 -----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPYAVRQTLWRIVVV 270

Query: 316 YIGSLFFIGLLVPFDDPKLXXXXXXXXXXPFIIAIENSGTKILPDIFNAIILITIISAGN 375
           YIG   F G  VPF+DP L          P  IAI  +G      + NA IL + ISA N
Sbjct: 271 YIGIAIFYGSTVPFNDPNLSVNTKVLKS-PIAIAISRAGWAGGSHLVNAFILFSCISAIN 329

Query: 376 SNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDW 435
            ++Y+GSR L +LA  GLAPK L+ T K+GVP  ++      G+++ M  + G    + +
Sbjct: 330 GSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLMNMSVGASNAYSY 389

Query: 436 LVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIII 495
           +VN++ +  F  W  I  +H+R  +    +G   ++LP+KA   P    +++   + + +
Sbjct: 390 IVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTPIFSLISNIFLAL 449

Query: 496 FQGFTAFTPTFDVSDFFAAYI----SVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRR- 550
            QG+T+  P F   +F  AYI    ++IL+  +       F+   I  L  V++D  RR 
Sbjct: 450 IQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCVFKNHNFR---IVDLTSVNLDEGRRK 505

Query: 551 DVEK 554
           D+E 
Sbjct: 506 DMEN 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,718,367
Number of extensions: 2206289
Number of successful extensions: 9594
Number of sequences better than 10.0: 389
Number of HSP's gapped: 8226
Number of HSP's successfully gapped: 410
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)