Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D00520na 1ON59859829750.0
KAFR0D00510na 2ON61757820130.0
KAFR0D005001.50ON61759119870.0
Suva_3.1891.50ON63363319070.0
KNAG0C005901.50ON63456618970.0
TBLA0A051801.50ON67655318890.0
Suva_2.6881.50ON66160618850.0
Smik_3.531.50ON63363618790.0
YCL025C (AGP1)1.50ON63358018630.0
Skud_3.381.50ON63363318620.0
NCAS0A004201.50ON67959118650.0
Kpol_2000.921.50ON63759918550.0
Smik_4.7901.50ON66362718540.0
CAGL0B01012g1.50ON62360418450.0
CAGL0K05753g1.50ON66057818460.0
NDAI0A006401.50ON64158318400.0
KAFR0D04120na 1ON64857118400.0
NDAI0F043901.50ON66759418380.0
YDR508C (GNP1)1.50ON66362718350.0
Skud_4.7841.50ON66362318180.0
NCAS0B085801.50ON62757518120.0
TBLA0A05190na 1ON66761418070.0
SAKL0C01232gsingletonON61357918000.0
KNAG0F002701.50ON63457417810.0
TDEL0C065101.50ON64257417770.0
SAKL0C01650g1.50ON61357917670.0
KAFR0D041401.50ON63756917640.0
TPHA0B047501.50ON63961217610.0
TPHA0E036601.50ON64759317590.0
KAFR0D04130na 2ON64457117310.0
Kwal_33.132041.50ON60758316900.0
Kpol_2002.441.50ON62757916880.0
AFR698C1.50ON60952416720.0
KLLA0C01606g1.50ON62057416700.0
Ecym_10561.50ON60656016630.0
KLTH0F01584g1.50ON59658316540.0
KLTH0F01606gna 1ON60456215570.0
Kwal_33.13215na 1ON59858915540.0
SAKL0D02948gna 3ON59456315420.0
ZYRO0F17446g1.50ON63356815370.0
CAGL0L07546g3.284ON63458515120.0
Ecym_26643.285ON57556114970.0
SAKL0D02970g3.284ON60156514810.0
SAKL0D02926g3.285ON58357914660.0
AGR040C3.285ON57358114530.0
NCAS0I015303.284ON59558014460.0
Kpol_1065.133.284ON59659814430.0
AGR039Cna 3ON58655814330.0
YBR068C (BAP2)3.284ON60957614340.0
KNAG0H011503.284ON61761014250.0
KNAG0J022003.284ON60755914240.0
CAGL0H08393g3.284ON61256314160.0
Suva_4.3073.284ON60956714130.0
NDAI0A074903.284ON59656914100.0
Smik_2.2013.284ON60957614120.0
NDAI0A056203.284ON57158114040.0
Skud_2.1913.284ON60959014070.0
YDR046C (BAP3)3.284ON60459414050.0
Smik_4.2843.284ON60459514030.0
Suva_2.2033.284ON60459614020.0
TPHA0M012003.284ON60759313970.0
AGR038C3.284ON58058113950.0
Skud_4.3003.284ON60459513840.0
KAFR0A011203.284ON59255913770.0
NCAS0A106803.284ON59357513760.0
KAFR0C004003.284ON58259313530.0
KLTH0C05170g3.284ON59856013461e-180
Ecym_26623.284ON58956113401e-179
Smik_2.2023.285ON61757213311e-177
Kwal_27.105383.284ON60256013181e-175
Ecym_2663na 3ON58956113141e-175
Kpol_1052.163.284ON61358113061e-173
TPHA0A039603.284ON61556013051e-173
Skud_2.1923.285ON61958913031e-173
Suva_4.3083.285ON61858212911e-171
TBLA0G031203.284ON67355912951e-171
TBLA0I020003.284ON66456612931e-171
TBLA0I020103.285ON62852412711e-168
NDAI0B052201.244ON61160012641e-167
YBR069C (TAT1)3.285ON61956612581e-166
Kpol_1052.143.285ON60257112441e-164
KNAG0J022103.285ON58156912411e-164
ZYRO0G12342g3.284ON62060312361e-163
Kwal_27.126811.244ON59359812311e-162
KLTH0E15642g1.244ON59658012211e-161
ZYRO0D03762g1.244ON60055412201e-161
SAKL0H08184gna 4ON59852112051e-158
SAKL0D04664g1.244ON59358112041e-158
NDAI0A075003.285ON61957412031e-158
Suva_11.2731.244ON60159711891e-156
TPHA0B010901.244ON60657511751e-154
Kpol_543.791.244ON60557811741e-154
Kpol_543.78singletonON60557911611e-152
NCAS0I015203.285ON61455611601e-151
ADL272Wna 4ON56449311471e-150
KLLA0A06886gsingletonON58757311481e-150
SAKL0G14014g5.158ON60554811421e-149
YKR039W (GAP1)1.244ON60259811401e-149
Skud_11.2751.244ON60259811401e-149
Ecym_8297na 4ON56949211371e-148
NCAS0B079001.244ON61955911361e-148
Ecym_60211.244ON60059911321e-147
CAGL0L03267g1.244ON59756411291e-147
TDEL0C00930singletonON59560911201e-146
Suva_2.716singletonON60358011171e-145
KNAG0C02140singletonON59860911141e-145
KLTH0B02046g5.158ON58957611011e-143
AFR230C1.244ON60460211011e-143
KAFR0E018505.158ON56052410921e-142
Suva_7.4855.158ON60352910941e-142
KLLA0F01012gna 4ON55653810861e-141
TPHA0A002405.158ON60356410891e-141
SAKL0D00836gna 5ON60160110851e-140
Smik_16.1155.158ON60354110821e-140
KLLA0A06930g1.244ON58755910801e-140
Kwal_33.14276na 5ON59659910781e-139
Kpol_1010.325.158ON59957810761e-139
NDAI0D021605.158ON58757610711e-138
Skud_7.5255.158ON60354410731e-138
CAGL0B03773g5.158ON60552710661e-137
KLLA0A11770g5.158ON58154210631e-137
Ecym_47895.158ON58858010571e-136
Kwal_33.154075.158ON58755510561e-136
AGR319W5.158ON62657110561e-136
NDAI0C029505.158ON60955210411e-134
YGR191W (HIP1)5.158ON60355510371e-133
Kpol_534.221.368ON59260510331e-133
KNAG0G009005.158ON61352110311e-132
Smik_11.3021.244ON55354910231e-132
NCAS0A071105.158ON59252810241e-131
TBLA0C012101.368ON60060310171e-130
TBLA0B077605.158ON65861310191e-130
TPHA0A047005.158ON56948610061e-129
NCAS0D018705.158ON59554910081e-129
KLLA0A10813g1.368ON58459810071e-129
NCAS0A089201.368ON59961010071e-129
NDAI0G060301.368ON59957810041e-128
TPHA0A025001.368ON59059710041e-128
Skud_15.1381.368ON5925579881e-126
Smik_15.1461.368ON5935589851e-125
CAGL0D02178g1.368ON5775879831e-125
YOL020W (TAT2)1.368ON5925539801e-125
TDEL0E05700singletonON5845889741e-124
Suva_15.1481.368ON5925599741e-124
KAFR0F04410singletonON5805889541e-121
AEL030W1.368ON5825559531e-121
Ecym_27161.368ON5925589521e-121
TDEL0H04510singletonON5845879501e-120
TDEL0B00130singletonON5845629501e-120
KLTH0H13398g1.368ON5875569411e-119
KLLA0B06776gna 6ON5885919201e-116
SAKL0D04048gna 6ON5865709181e-115
KLTH0C08052gna 6ON5995279131e-115
Sklu_YGOB_Anc_1.3681.368ON5414909021e-114
TPHA0G03770singletonON6045959021e-113
KAFR0B00220singletonON5855668981e-113
YPL274W (SAM3)na 6ON5875758881e-111
YLL061W (MMP1)na 7ON5835878861e-111
Smik_12.2na 7ON5835868811e-110
ZYRO0D17952gna 6ON5855838711e-108
Suva_16.18na 6ON5835658681e-108
Smik_6.483na 6ON5905928661e-108
Kwal_56.22951na 6ON5965868631e-107
Suva_16.31singletonON5865508601e-107
AER405Cna 6ON4974938491e-106
TDEL0E00250singletonON5875858221e-101
Kwal_34.16254singletonOFF4814548041e-100
Kwal_YGOB_34.162541.368ON4914548041e-100
Ecym_4758na 6ON5875818082e-99
SAKL0C02662g1.83ON5485597721e-94
SAKL0C02640gsingletonON5485387461e-90
Ecym_10881.84ON5675727436e-90
NCAS0A006001.83ON5445357251e-87
TBLA0A054601.84ON6085677282e-87
Kwal_33.134011.83ON5595247217e-87
Suva_5.41.83ON5905797184e-86
Kwal_33.134111.84ON5605417155e-86
YNL270C (ALP1)1.83ON5735737158e-86
Ecym_10871.83ON5705337132e-85
Skud_14.701.83ON5735687095e-85
Smik_5.241.83ON5905237053e-84
TBLA0A07060na 8ON6255257073e-84
CAGL0J08184g1.83ON5725787034e-84
KNAG0C05920singletonON5995267045e-84
YEL063C (CAN1)1.83ON5905447028e-84
KAFR0D039401.83ON5975527038e-84
NCAS0B085701.83ON5325436962e-83
KLTH0F02420g1.84ON6215856988e-83
KLLA0E16281gna 8ON6055906942e-82
TDEL0C061701.84ON5734986913e-82
Smik_14.671.83ON5735716903e-82
Kpol_2000.641.84ON6105976934e-82
Skud_5.261.83ON5905466914e-82
NDAI0F041901.84ON5995276924e-82
CAGL0J08162g1.84ON5976086906e-82
TPHA0B044701.84ON5995196862e-81
KLTH0F02398g1.83ON5555516823e-81
NDAI0A006101.83ON5655266833e-81
NCAS0A006101.84ON6075636855e-81
NDAI0F042001.83ON5665896816e-81
Skud_14.711.84ON6125776812e-80
Smik_14.681.84ON6116196812e-80
SAKL0C02728g1.84ON5625276754e-80
AFR667C1.84ON5635146754e-80
Suva_14.731.83ON4974806704e-80
ZYRO0F16632g1.84ON6075256785e-80
SAKL0C02684gsingletonON5884696732e-79
YNL268W (LYP1)1.84ON6115856723e-79
KLLA0C02343g1.83ON5815556688e-79
TDEL0C061801.83ON5835216652e-78
KNAG0F004801.84ON5975736653e-78
AFR668W1.83ON5564896623e-78
CAGL0A01199gna 8ON6135656638e-78
KLLA0C02365g1.84ON5795126601e-77
KNAG0C007901.83ON5794986591e-77
ZYRO0F16654g1.83ON5805616573e-77
Smik_6.473na 8ON6065236567e-77
KAFR0D007001.83ON5745616547e-77
TBLA0A054501.83ON6064796559e-77
Suva_14.751.84ON6115196532e-76
YPL265W (DIP5)na 8ON6085186522e-76
NDAI0I02660na 8ON5945866443e-75
Skud_47.1singletonON3283266215e-75
Skud_16.12na 8ON6075676428e-75
Suva_16.40na 8ON6065746392e-74
SAKL0G14916gna 8ON5815836372e-74
Kpol_358.3na 8ON5755716363e-74
TPHA0H028507.44ON6015586365e-74
NCAS0D02260na 8ON5975786331e-73
TPHA0M00130singletonON6115736323e-73
Ecym_80357.44ON5635306266e-73
Ecym_2480na 8ON5865366206e-72
Suva_8.4027.44ON6836006232e-71
SAKL0F09790gsingletonON5585726133e-71
TPHA0B044801.83ON6034186164e-71
KNAG0L02470singletonON6385636184e-71
TDEL0H040707.44ON5775456111e-70
Kwal_33.15545na 8ON5765016101e-70
Smik_15.5327.44ON6315726096e-70
KLTH0B01166gna 8ON5775266041e-69
KAFR0B06430singletonON5935846051e-69
KNAG0L02460singletonON5885716032e-69
YOR348C (PUT4)7.44ON6276146019e-69
ACL135Wna 8ON5885335911e-67
CAGL0E05632g7.44ON5985255902e-67
SAKL0B10956g7.44ON5725745864e-67
Kpol_2000.651.83ON5954865866e-67
KNAG0E003907.44ON5995225868e-67
Kwal_8.590na 9ON6295875852e-66
Skud_51.1singletonON3483415616e-66
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00520
         (598 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...  1150   0.0  
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      780   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      769   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   739   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   735   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   732   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   730   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   728   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   722   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   721   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   723   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   719   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   718   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   715   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   715   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   713   0.0  
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   713   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   712   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   711   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   704   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   702   0.0  
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   700   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   697   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   690   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   689   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   685   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              684   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   682   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   682   0.0  
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              671   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   655   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   654   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   648   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   647   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   645   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   641   0.0  
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   604   0.0  
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   603   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   598   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   596   0.0  
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   587   0.0  
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   581   0.0  
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   575   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   569   0.0  
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   564   0.0  
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              561   0.0  
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   560   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   556   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   556   0.0  
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              553   0.0  
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   553   0.0  
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   550   0.0  
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   548   0.0  
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   547   0.0  
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   548   0.0  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            545   0.0  
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   546   0.0  
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   545   0.0  
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   545   0.0  
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   544   0.0  
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   542   0.0  
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   541   0.0  
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   537   0.0  
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   535   0.0  
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   534   0.0  
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                525   0.0  
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   523   e-180
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   520   e-179
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   517   e-177
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   512   e-175
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   510   e-175
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   507   e-173
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              507   e-173
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   506   e-173
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   501   e-171
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              503   e-171
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   502   e-171
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   494   e-168
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   491   e-167
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   489   e-166
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   483   e-164
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   482   e-164
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   480   e-163
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   478   e-162
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   474   e-161
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   474   e-161
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   468   e-158
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   468   e-158
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   468   e-158
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   462   e-156
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   457   e-154
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   456   e-154
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   451   e-152
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              451   e-151
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   446   e-150
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   446   e-150
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   444   e-149
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   443   e-149
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   443   e-149
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   442   e-148
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   442   e-148
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   440   e-147
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   439   e-147
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   436   e-146
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   434   e-145
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   433   e-145
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   428   e-143
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   428   e-143
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   425   e-142
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   426   e-142
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   422   e-141
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   424   e-141
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   422   e-140
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   421   e-140
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   420   e-140
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   419   e-139
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   419   e-139
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    417   e-138
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   417   e-138
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   415   e-137
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   414   e-137
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   411   e-136
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   411   e-136
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   411   e-136
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    405   e-134
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   404   e-133
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   402   e-133
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   401   e-132
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   398   e-132
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   399   e-131
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   396   e-130
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   397   e-130
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   392   e-129
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   392   e-129
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   392   e-129
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   392   e-129
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   391   e-128
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   391   e-128
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   385   e-126
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   384   e-125
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   383   e-125
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   382   e-125
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   379   e-124
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   379   e-124
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              372   e-121
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   371   e-121
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   371   e-121
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   370   e-120
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                370   e-120
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   367   e-119
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   358   e-116
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   358   e-115
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   356   e-115
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   352   e-114
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   352   e-113
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      350   e-113
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   346   e-111
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   345   e-111
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    343   e-110
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   340   e-108
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   338   e-108
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   338   e-108
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   337   e-107
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   335   e-107
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   331   e-106
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                321   e-101
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   314   e-100
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   314   e-100
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   315   2e-99
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   301   1e-94
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   291   1e-90
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   290   6e-90
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   283   1e-87
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   285   2e-87
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   282   7e-87
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   281   4e-86
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   280   5e-86
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   280   8e-86
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   279   2e-85
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   277   5e-85
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   276   3e-84
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   276   3e-84
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   275   4e-84
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            275   5e-84
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   275   8e-84
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   275   8e-84
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            272   2e-83
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   273   8e-83
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   271   2e-82
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   270   3e-82
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   270   3e-82
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   271   4e-82
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   270   4e-82
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   271   4e-82
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   270   6e-82
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   268   2e-81
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   267   3e-81
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   267   3e-81
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              268   5e-81
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            266   6e-81
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   266   2e-80
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   266   2e-80
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   264   4e-80
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   264   4e-80
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   262   4e-80
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   265   5e-80
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   263   2e-79
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   263   3e-79
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   261   8e-79
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   260   2e-78
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                260   3e-78
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   259   3e-78
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   259   8e-78
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   258   1e-77
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              258   1e-77
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   257   3e-77
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   257   7e-77
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   256   7e-77
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   256   9e-77
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   256   2e-76
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   255   2e-76
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   252   3e-75
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         243   5e-75
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   251   8e-75
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   250   2e-74
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   249   2e-74
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   249   3e-74
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   249   5e-74
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              248   1e-73
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     248   3e-73
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   245   6e-73
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   243   6e-72
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   244   2e-71
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   240   3e-71
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   241   4e-71
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             242   4e-71
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   239   1e-70
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   239   1e-70
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   239   6e-70
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   237   1e-69
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   237   1e-69
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             236   2e-69
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   236   9e-69
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   232   1e-67
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   231   2e-67
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   230   4e-67
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   230   6e-67
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   230   8e-67
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   229   2e-66
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     220   6e-66
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     220   1e-65
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   225   3e-65
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   224   2e-64
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     224   2e-64
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   224   2e-64
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   221   8e-64
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   219   4e-63
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   218   1e-62
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   215   1e-61
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   214   2e-61
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   214   3e-61
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   211   2e-60
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            211   2e-60
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      211   4e-60
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   211   4e-60
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              209   1e-59
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   210   1e-59
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   209   3e-59
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   208   4e-59
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   207   5e-59
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   209   8e-59
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   206   3e-58
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     206   7e-58
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   205   8e-58
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   204   1e-57
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   204   1e-57
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      204   2e-57
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   203   4e-57
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    202   4e-57
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   200   2e-56
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              197   3e-55
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   194   2e-54
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   195   2e-54
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   186   2e-54
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   195   3e-54
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   194   7e-54
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   190   1e-52
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   191   1e-52
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   189   4e-52
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   187   2e-51
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   186   5e-51
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   186   8e-51
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   185   1e-50
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   184   2e-50
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             172   4e-50
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   184   6e-50
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   182   2e-49
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   182   2e-49
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   180   6e-49
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            178   2e-48
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   178   4e-48
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   178   5e-48
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                177   8e-48
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   177   8e-48
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   178   8e-48
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   177   8e-48
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   177   9e-48
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   177   2e-47
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   175   2e-47
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   174   9e-47
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   172   6e-46
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   167   4e-44
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   167   6e-44
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   164   3e-43
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   162   2e-42
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   161   4e-42
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   160   1e-41
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   159   3e-41
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     147   3e-41
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   149   9e-41
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   145   3e-40
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   157   7e-40
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   156   2e-39
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   145   8e-37
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   145   5e-36
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   142   6e-35
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   141   1e-34
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   139   8e-34
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     130   2e-33
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    131   4e-33
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   135   1e-32
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   135   1e-32
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   135   2e-32
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   134   2e-32
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   134   4e-32
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   132   2e-31
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   130   2e-31
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   129   1e-30
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   129   2e-30
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   128   3e-30
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   126   1e-29
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   124   5e-29
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   124   5e-29
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         115   1e-28
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)     107   4e-27
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   117   1e-26
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   114   1e-25
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          86   1e-18
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    71   2e-12
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              45   2e-05
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    36   0.35 
ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} simil...    33   2.0  
Smik_6.139 Chr6 (225355..227079) [1725 bp, 574 aa] {ON} YGR055W ...    33   2.3  
Suva_8.15 Chr8 (27845..29485) [1641 bp, 546 aa] {ON} YHL036W (REAL)    33   2.3  
TBLA0B08340 Chr2 complement(1995588..1996175) [588 bp, 195 aa] {...    32   3.2  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    33   3.6  
SAKL0H26048g Chr8 complement(2292824..2294482) [1659 bp, 552 aa]...    32   4.5  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    32   5.3  
NDAI0H00180 Chr8 (18650..20356) [1707 bp, 568 aa] {ON} Anc_4.5         32   6.2  
YHL036W Chr8 (26241..27881) [1641 bp, 546 aa] {ON}  MUP3Low affi...    32   7.0  
NCAS0C05940 Chr3 complement(1225277..1226965) [1689 bp, 562 aa] ...    32   7.6  
TDEL0E01790 Chr5 (343205..344911) [1707 bp, 568 aa] {ON} Anc_4.1...    31   8.9  

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/598 (94%), Positives = 567/598 (94%)

Query: 1   MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE 60
           MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE
Sbjct: 1   MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE 60

Query: 61  KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLI 120
           KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMIS              ATLHNAGPAGLLI
Sbjct: 61  KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLI 120

Query: 121 GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPL 180
           GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPL
Sbjct: 121 GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPL 180

Query: 181 ELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           ELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILM     
Sbjct: 181 ELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFF 240

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                       TSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT
Sbjct: 241 ILGIILICGGAGTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA
Sbjct: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF
Sbjct: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
           GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL
Sbjct: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY 540
           NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY
Sbjct: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY 540

Query: 541 FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC
Sbjct: 541 FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/578 (63%), Positives = 446/578 (77%), Gaps = 14/578 (2%)

Query: 30  NESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEI---------NNIKSDQFNDKLNNQL 80
           + +HS+     ++F+DSFK   +  +  E + N I           ++  Q +D+LN +L
Sbjct: 45  STTHSRF----RNFIDSFKP-PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKL 99

Query: 81  QKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140
           +KTIQPRHV+M+S               TL +AGPAGL+IGY IMASCIYCIIQA GEMA
Sbjct: 100 KKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMA 159

Query: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDV 200
           VNYLTL+GGFN YP FLVD A NF++AW+YCIQW CVCPLELVTASMTI+YW  KV+ D+
Sbjct: 160 VNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADI 219

Query: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVS 260
           FV IFY+L++AIN+FGGARGYAE EF  N CKILM                   G+IG  
Sbjct: 220 FVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGK 279

Query: 261 YWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320
           YW +PGAFRG     RFKG+VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY
Sbjct: 280 YWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 339

Query: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380
           RAL IY+ SIIIVG LVPY+S ELLGS S+ TKASPYV+AV++HG+R+ PHFINAVILIS
Sbjct: 340 RALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILIS 399

Query: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440
           V SVA+S+FYSSSRMLLTLA+QGYAPK+FT++DR GRP  G +  +++A +AFCA S KE
Sbjct: 400 VFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKE 459

Query: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500
           TEVF+WLLAISGLSQVFTW  ICLSHIRFRRAMK+QGRS++E+GYKSQVGVWGS YA  +
Sbjct: 460 TEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVM 519

Query: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560
           M LI+IGQ WV + P+    A++  FF++YLAMP+ ++ Y GYK WK+DW LFIRAKDID
Sbjct: 520 MILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDID 579

Query: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           LISHRHI+D ++L+QE+ +Y+E L+NG +W ++Y FWC
Sbjct: 580 LISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/591 (62%), Positives = 450/591 (76%), Gaps = 17/591 (2%)

Query: 20  NVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQ-------- 71
            V V +E + +E  + L     +F+DSF++ +D      I  NE+N I S +        
Sbjct: 32  QVTVLDEEK-SEFSNGLRGRFDEFIDSFRRAED----VRILPNEMNPILSHESVFDTAVV 86

Query: 72  ----FNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMAS 127
                ++++N +L+KTIQPRHVIMI+               TL +AGPAGL+IGY IM++
Sbjct: 87  EISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMST 146

Query: 128 CIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASM 187
           CIYC++QA GEMAVNYLTLIGGF+ YP FL+D   NFAV+W+YCIQW CVCPLELVTASM
Sbjct: 147 CIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASM 206

Query: 188 TIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXX 247
           TI+YW  KV+ D+FV IFYLL+I IN+FGGARGYAEAEFF N+CKILM            
Sbjct: 207 TIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILI 266

Query: 248 XXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
                 SG+IG  YW++PGAFRG     RFKGIVSTLVTAAF+FG TEFLAITASEQ+NP
Sbjct: 267 CGGAGNSGFIGARYWHSPGAFRGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANP 326

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIR 367
           RKAIPSAAKKVIYRAL IYVGSIIIVGFLVPYNS ELLGS    TKASPYVIAVASHGIR
Sbjct: 327 RKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIR 386

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + PHFINAVILISV SVA+S+FYSSSR+LLTLA+QG+APKIFTY+D++GRP  G +  ++
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAI 446

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
           +A I+FCA S KE +VF+WLL+ISGLS+VFTW  I LSHIRFRRAMK+QGRSL+E+G+KS
Sbjct: 447 IAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKS 506

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWK 547
           Q GVWGS+YA  +M L+LIGQFWV + P+  + A+  +FF+ YLAMP+ ++ YFGYK W 
Sbjct: 507 QAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWN 566

Query: 548 KDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +DW LFIRAK+IDLI+HRHIYD ++L+QE+ + +E  +N  LW KIY FWC
Sbjct: 567 RDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYNFWC 617

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/633 (57%), Positives = 448/633 (70%), Gaps = 38/633 (6%)

Query: 2   SSLSPSITKD------GLHLSVNKNVIVTNENQINESHSKL---------IENLKDFVDS 46
           SS SP   KD       +H +  +N I   E   N+  S+             ++ F+DS
Sbjct: 3   SSTSPYELKDLKNSSTEVHAAEQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDS 62

Query: 47  FKKIDDNNNQYEIEKNEINNIKS--------------DQFNDKL-------NNQLQKTIQ 85
           FK+ D +  Q E E  ++N++ S              D+  DK+       ++ L+KTIQ
Sbjct: 63  FKRADQDQEQ-EAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQ 121

Query: 86  PRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLT 145
           PRHV+MI+                L +AGPAGLLIGY IM S +YCIIQACGEMA+ Y  
Sbjct: 122 PRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSN 181

Query: 146 LIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIF 205
           L GG+N YPSFLVD  + FAVAWVYC+QWLCVCPLELVTASMTIKYW   V+PDVFV IF
Sbjct: 182 LTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIF 241

Query: 206 YLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNP 265
           Y+L+I IN+FG ARGYAEAEFFFN CKILM                   GYIG  YW+ P
Sbjct: 242 YVLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEP 300

Query: 266 GAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFI 325
           GAF G     RFKG+V+TLVTAAF+FG +EF+AIT +EQSNPRKAIP AAK++IYR LF+
Sbjct: 301 GAFNGVHAIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL 360

Query: 326 YVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVA 385
           ++ +IIIVGFLVPYNS +LLGS    TKASPYVIA+ASHG+R+APHF+NAVIL+SVLS+A
Sbjct: 361 FLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMA 420

Query: 386 NSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFS 445
           NSSFYSS+R+ LTL++QGYAPKIF+Y+DR GRPL  +  ++L A IAFCA+SPKE +VF+
Sbjct: 421 NSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFT 480

Query: 446 WLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLIL 505
           WLLAISGLSQ+FTW  ICLSHIRFRRAMK+QGRSL ELG+KSQ GVWGSIY+  +M LIL
Sbjct: 481 WLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILIL 540

Query: 506 IGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHR 565
           IGQFWVA+ P+     +   FF+ YLAMPIL++ Y GYK W KDW LFIRA  IDL SHR
Sbjct: 541 IGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHR 600

Query: 566 HIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            I+DE+++KQE ++Y+E L+ G  W ++ AFWC
Sbjct: 601 QIFDEELIKQEDDEYRERLRTGPYWRRVLAFWC 633

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/566 (62%), Positives = 434/566 (76%), Gaps = 9/566 (1%)

Query: 40  LKDFVDSFKKIDDNNNQYEIE-------KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMI 92
            +DF+DSFK  ++      ++          I   K D+ +    ++L+KTIQPRHVI+I
Sbjct: 71  FRDFIDSFKPAENPQPHTNLDMELVGVTSETIEQHKKDEGDT--GDKLKKTIQPRHVILI 128

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           S              ATL  AGPAGL+IGY IM S IYCIIQACGEMAVNYLTL+GGFN 
Sbjct: 129 SLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNA 188

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAI 212
           YP+FL+D  ++FA AWVYC+QWLCVCPLELVTASMTIKYW  KVDPDVFV IFY+ I+ I
Sbjct: 189 YPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGI 248

Query: 213 NLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHT 272
           N+ GGARGYAEAEF FN CKILM                 T GYIG  YW++PGAFRG  
Sbjct: 249 NILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGER 308

Query: 273 PGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIII 332
              RFKG+V+TLVTAAFSFGQ+EF+A+TASEQSNPR+AIPSAAKK+IYRAL IY+ SII+
Sbjct: 309 AVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIIL 368

Query: 333 VGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSS 392
           +GFLVPYNS +LLG++S+  KASPYV+AVA+HG+R+ PHFINAVI+ISVLSV+NS+FYSS
Sbjct: 369 LGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSS 428

Query: 393 SRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISG 452
            RMLLTL++QG+APKIF+Y+DR GRP  GII ASL A IAFCA+SPKE +VF+WLLA+SG
Sbjct: 429 PRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSG 488

Query: 453 LSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVA 512
           LSQ+FTW +ICLSH+RFRRAM +QGRSL E G+ SQVG++GS Y+  V+ LIL+GQFWVA
Sbjct: 489 LSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVA 548

Query: 513 LWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDV 572
           L P+ S   +  +FF+ YLA PI +  Y GYK + KDW L+I+++DIDL++HR IYDED+
Sbjct: 549 LKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDI 608

Query: 573 LKQEKNQYKENLKNGSLWLKIYAFWC 598
           L+QE+ +  E LKNG  W + Y+FWC
Sbjct: 609 LRQEREEETERLKNGPYWKRAYSFWC 634

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/553 (62%), Positives = 424/553 (76%), Gaps = 5/553 (0%)

Query: 50  IDDNNNQYEIE----KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXX 105
           IDD  N+ ++E      +   +   Q  +  N +L++TI+PRHVIM+S            
Sbjct: 125 IDDLENKQQVELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVG 184

Query: 106 XXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFA 165
               L  AGPA L+IGY IM +CIYCIIQACGEMAV Y  L G FN +PSFLVD  +NFA
Sbjct: 185 NAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFA 244

Query: 166 VAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAE 225
           VAWVYCIQWLCVCPLELVTASMTI+YW  KVDPDVFV IFY+LI+ IN FG A+GYAEAE
Sbjct: 245 VAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFG-AKGYAEAE 303

Query: 226 FFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLV 285
           F FN CK+LM                 T GYIG  YWN+PGAFRG T   RFKG++ T V
Sbjct: 304 FIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFV 363

Query: 286 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL 345
           TAAF+FG TEF+A+TA+EQSNPRKAIPSAAKK+IYR L I++ +II++GFLVPY+S +LL
Sbjct: 364 TAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLL 423

Query: 346 GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYA 405
           GS  S TKASPYV+A++ HG+R+A HF+NAVILISV+SV NS+FYSSSR+L++LA+QG A
Sbjct: 424 GSGGSATKASPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSA 483

Query: 406 PKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLS 465
           PKIF Y+DR+GRPL  +  ++++A IAFCA+SPKETEVF+WL+AI+GLSQ+FTW  ICLS
Sbjct: 484 PKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLS 543

Query: 466 HIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITN 525
           H+RFRRAMK+QGRSL E+GY SQ G+ GS+YAA +M L LI QFWVAL P+ ++  +  +
Sbjct: 544 HLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANS 603

Query: 526 FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLK 585
           FF  YLAMPIL++FYFGYK WK+DW LFIRAKDIDLISHR IYDE++L+QE  +Y+E L+
Sbjct: 604 FFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEEYREKLR 663

Query: 586 NGSLWLKIYAFWC 598
           NG  W ++ AFWC
Sbjct: 664 NGPKWKRVAAFWC 676

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/606 (59%), Positives = 439/606 (72%), Gaps = 33/606 (5%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEIN--------NIKSDQFNDK 75
           T EN   E   K   +L+ F+DSFK+ + ++       N I         N  S Q +++
Sbjct: 58  TMENLEYEGDRKA-SHLRRFIDSFKRAEGSHPNSPDSSNSIGGGATPISTNDSSSQLDNE 116

Query: 76  LN--------------------NQ--LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNA 113
           LN                    NQ  L+KTI+PRH++M+S                L+NA
Sbjct: 117 LNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNA 176

Query: 114 GPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQ 173
           GPAGL+IGY IM SCIYCIIQACGE+AV Y  LIGGFN YPSFLVD A  F+VAWVYC+Q
Sbjct: 177 GPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQ 236

Query: 174 WLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKI 233
           WLCVCPLELVTASMTIKYW  KVDPDVFV IFY+LII IN+FG A+GYAEA+FFFN CKI
Sbjct: 237 WLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFG-AKGYAEADFFFNCCKI 295

Query: 234 LMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQ 293
           LM                 T GYIG  YW+NPGAFRG+T   RFKG+V+T VTAAF+FG 
Sbjct: 296 LMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFRGNTGIQRFKGVVATFVTAAFAFGM 355

Query: 294 TEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTK 353
           +E LA+TASEQSNPRKAIPSAAKK+IYR LF+++GS+++VGFLVPY S +LLG+  S TK
Sbjct: 356 SEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATK 415

Query: 354 ASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLD 413
           ASPYVIAVASHG+R+ PHFINAVIL+SVLSVAN +FYSSSR+L++LAKQG APK F Y+D
Sbjct: 416 ASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYID 475

Query: 414 RKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAM 473
           R+GRP   ++ +S+   IAFCASSPKE +VF+WLLAISGLSQ+FTW TICLSHIRFRRAM
Sbjct: 476 REGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAM 535

Query: 474 KIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLA 532
           K+QGRSL E+GYKSQVG+WGS+YA  +M L LI QFWVA+ P+   G  +  +FF+ YLA
Sbjct: 536 KVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLA 595

Query: 533 MPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLK 592
           MPIL+  Y  YK WKKDW LFI A  IDL++ R I+DE++LKQE  +Y+E L+NG  W +
Sbjct: 596 MPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEEYQEKLRNGPYWKR 655

Query: 593 IYAFWC 598
           +  FWC
Sbjct: 656 VVDFWC 661

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/636 (56%), Positives = 443/636 (69%), Gaps = 44/636 (6%)

Query: 2   SSLSPSITKD------GLHLSVNKNVIV---TNENQINESHSKL------IENLKDFVDS 46
           SS SP   KD       +H +   N +    T+ N  + S   L         L+ F DS
Sbjct: 3   SSKSPYELKDLKNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHNTSALRRFFDS 62

Query: 47  FKKIDDN---------------------NNQYEIEKNEINNIKSDQFNDKLNNQ---LQK 82
           FKK D +                       + E+EKNE     SD    +  N+   L+K
Sbjct: 63  FKKADQSAEERVETAQMNDLASAISPSSRQRQELEKNE----SSDNIGARTGNKSDSLKK 118

Query: 83  TIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVN 142
           TIQPRHV+MI+                L +AGPAGLLIGY IM S +YCIIQACGEMA+ 
Sbjct: 119 TIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALV 178

Query: 143 YLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFV 202
           Y  L GG+N YPSFLVD  + FAVAWVYC+QWLCVCPLELVTASMTIKYW   V+PDVFV
Sbjct: 179 YSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFV 238

Query: 203 TIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYW 262
            IFY+L+I IN+FG ARGYAEAEFFFN CKILM                   G+IG  YW
Sbjct: 239 IIFYVLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYW 297

Query: 263 NNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 322
           ++PGAF G     RFKG+V+TLVTAAF+FG +EF+AIT +EQ+NPRKA+P AAK++IYR 
Sbjct: 298 HDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRI 357

Query: 323 LFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVL 382
           LF+++ +II++GFLVPYNS +LLGS    TKASPYVIAVASHG+R+ PHFINAVIL+SVL
Sbjct: 358 LFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVL 417

Query: 383 SVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETE 442
           S+ANSSFYSS+R+LLTL++QGYAP++FTY+D+ GRPL  +  ++L   IAFCA+SPKE +
Sbjct: 418 SMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQ 477

Query: 443 VFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMF 502
           VF+WLLAISGLSQ+FTW  ICLSHIRFRRAMK+QGRSL ELG++SQ GVWGS YA  +M 
Sbjct: 478 VFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMI 537

Query: 503 LILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562
           LILIGQFWVA+ P+     +   FF+ YLAMPIL+  Y GYK WKKDW LFIRA  IDLI
Sbjct: 538 LILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLI 597

Query: 563 SHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           SHR I+DE+++KQE  +++E LKNG  W ++ AFWC
Sbjct: 598 SHRQIFDEELIKQEDEEFRERLKNGPCWKRVVAFWC 633

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/580 (59%), Positives = 426/580 (73%), Gaps = 23/580 (3%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKS--------------DQFNDKL-------NN 78
           ++ F DSFK+ D    Q E+E  ++N++ S              ++ +D +       ++
Sbjct: 56  VRRFFDSFKRAD-QGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSD 114

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            L+KTIQPRHV+MI+                L +AGPAGLLIGY IM S +YCIIQACGE
Sbjct: 115 SLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGE 174

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           MA+ Y  L GG+N YPSFLVD  + FAVAWVYC+QWLCVCPLELVTASMTIKYW   V+P
Sbjct: 175 MALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNP 234

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
           DVFV IFY+L+I IN+FG ARGYAEAEFFFN CKILM                   G+IG
Sbjct: 235 DVFVIIFYVLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIG 293

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YW++PGAF G     RFKG+ +TLVTAAF+FG +EF+AIT +EQSNPRKAIP AAK++
Sbjct: 294 GKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQM 353

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
           IYR LF+++ +II++GFLVPYNS +LLGS    TKASPYVIAVASHG+R+ PHFINAVIL
Sbjct: 354 IYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVIL 413

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
           +SVLS+ANSSFYSS+R+ LTL++QGYAPK+F+Y+DR GRPL  +  ++L A IAFCA+SP
Sbjct: 414 LSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASP 473

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
           KE +VF+WLLAISGLSQ+FTW  ICLSH+RFRRAMK+QGRSL ELG+KSQ GVWGS YA 
Sbjct: 474 KEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYAC 533

Query: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
            +M LILI QFWVA+ P+     +   FF+ YLAMPIL+  Y GYK W KDW LFIRA  
Sbjct: 534 IMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADK 593

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           IDL SHR I+DE+++KQE  +Y+E L+NG  W ++ AFWC
Sbjct: 594 IDLDSHRQIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC 633

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/633 (56%), Positives = 439/633 (69%), Gaps = 38/633 (6%)

Query: 2   SSLSPSITKD------GLHLSVNKNVIVTNENQINESHSKL---------IENLKDFVDS 46
           SS SP   KD       +H +   N I   E   N+  S              ++ F DS
Sbjct: 3   SSKSPYEQKDLKNSSTEIHATEQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDS 62

Query: 47  FKKIDDNNNQYEIEKNEINNIKS--------------DQFNDKLN-------NQLQKTIQ 85
           FK+ D    Q E E  ++N++ S              +   DK+N         L+KTIQ
Sbjct: 63  FKRAD-QGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQ 121

Query: 86  PRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLT 145
           PRHV+MI+                L +AGPAGLLIGY IM S +YCIIQACGE+A+ Y  
Sbjct: 122 PRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSN 181

Query: 146 LIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIF 205
           L GG+N YPSFLVD  + FAVAWVYC+QWLCVCPLELVTASMTIKYW   V+PDVFV IF
Sbjct: 182 LTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIF 241

Query: 206 YLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNP 265
           Y+L+I IN+FG ARGYAEAEFFFN CKILM                   G+IG  YW++P
Sbjct: 242 YVLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDP 300

Query: 266 GAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFI 325
           GAF G     RFKG+V+TLVTAAF+FG +EF+AIT +EQSNPRKAIP AAK++IYR LF+
Sbjct: 301 GAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL 360

Query: 326 YVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVA 385
           ++ +II++GFLVPYNS +LLGS    TKASPYVIA+ASHG+R+ PHF+NAVIL+SVLS+A
Sbjct: 361 FLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMA 420

Query: 386 NSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFS 445
           NSSFYSS+R+ LTL++QGYAPK F+Y+DR GRPL  +  ++L A IAFCA+SPKE +VF+
Sbjct: 421 NSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFT 480

Query: 446 WLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLIL 505
           WLLAISGLSQ+FTW  IC SHIRFRRAMK+QGRSL ELG+KSQ GVWGS+YA  +M LIL
Sbjct: 481 WLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLIL 540

Query: 506 IGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHR 565
           IGQFWVA+ P+     +   FF+ YLAMPIL+  Y GYK W KDW LFIRA  IDL SHR
Sbjct: 541 IGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHR 600

Query: 566 HIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            I+DE+++KQE  +Y+E L+NG  W ++ AFWC
Sbjct: 601 QIFDEELIKQEDEEYRERLRNGPYWKRVAAFWC 633

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/591 (60%), Positives = 442/591 (74%), Gaps = 23/591 (3%)

Query: 31  ESHSKLIENLKDFVDSFKKIDD-----NNNQYEIEKNEINNI--------------KSDQ 71
           E H+     +++F+DSFK+ +      NNN    E +  N I                 Q
Sbjct: 89  EEHTTKPSRIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQ 148

Query: 72  FND-KLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIY 130
            ND   +++L+KTI+PRHV+MIS              ++L  AGPAGL+IG+ IM SC+Y
Sbjct: 149 INDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLY 208

Query: 131 CIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIK 190
           CIIQA GE+AV Y  L+GGFN YPSFLVD A+ FAVAW+Y IQWLCVCPLELVTASMTIK
Sbjct: 209 CIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIK 268

Query: 191 YWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXX 250
           YW  KVDPD+FV IFY+LII INL GGA GYAEAEF FN CKI+M               
Sbjct: 269 YWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGG 328

Query: 251 XXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
             T GYIG  YW++PGA RG T   RFKG ++TLV AAF+FG +EF+ +TASEQSNPRKA
Sbjct: 329 AGTDGYIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKA 388

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           IPSAAKK+IYR L +++ SI IVGFLVPYNS +LLGS  S  KASPYV+A+++HG+R+ P
Sbjct: 389 IPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVP 448

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
           HFINAVILISVLSVANS++YSSSRMLL+LA+QGYAPKI++Y+DR+GRPL G+  A++   
Sbjct: 449 HFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGV 508

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           IAFCA+SPKE EVF WLLAISGLSQ+FTW  IC+SHIRFRRAM +QGRS+ ELG++SQVG
Sbjct: 509 IAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVG 568

Query: 491 VWGSIYAATVMFLILIGQFWVALWPLNSN---GANITNFFKEYLAMPILLLFYFGYKTWK 547
            +GS YAA +MF+ILI QFWVAL P+N++     +  NFF+ YLAMPILL FYFGYK WK
Sbjct: 569 WYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWK 628

Query: 548 KDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           KDW LFIRAK+IDLISHR+I+DE+++KQE+++Y+E L+ G  W ++Y FWC
Sbjct: 629 KDWKLFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/599 (58%), Positives = 434/599 (72%), Gaps = 26/599 (4%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINN----------IKSDQFND 74
           +E+ +    +K    ++ F+DSFK+ D N+N      N+I            +   +F+D
Sbjct: 40  DESSVRNRKTKEGTFVRSFIDSFKRADRNSNPLHDLDNDITTSISRTSMDAALNKTKFDD 99

Query: 75  KLNN---------------QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
            +++                L+KTI+PRHVIMIS                L  AGPA L+
Sbjct: 100 AISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALV 159

Query: 120 IGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCP 179
           IGY IM +C+YCIIQA GE+AV Y  L GGFN YPSFLVD A  F+VAWVYC+QWLCVCP
Sbjct: 160 IGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCP 219

Query: 180 LELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXX 239
           LELVTASMTIKYW  KVDPDVFV IFY+LIIAIN FG ARGYAEAEFFFN CK+LM    
Sbjct: 220 LELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFG-ARGYAEAEFFFNCCKVLMMTGF 278

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAI 299
                          GY+G  YW++PGAF G     RFKG++ T VTAAF+FG TEF+A+
Sbjct: 279 FILGIIITAGGAGNDGYLGAKYWHDPGAFNGDKSIDRFKGVMDTFVTAAFAFGATEFIAL 338

Query: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVI 359
           TA+EQSNPRKAIPSAAKKV+YR + I++ SI ++GFLVPYNS +LLGS  S  KASPYVI
Sbjct: 339 TAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVI 398

Query: 360 AVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPL 419
           AV+SHG+R+ PHFINAVIL+SVLSV NS+FYSSSR+LL+LA+QGYAPK F Y+DR+GRP 
Sbjct: 399 AVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPF 458

Query: 420 FGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRS 479
             ++ ++L   IAFCA+SPKETEVFSWLLAISGLSQ+FTW TIC+SHIRFRRAM++QGRS
Sbjct: 459 RAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRS 518

Query: 480 LNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLF 539
           L E+GY SQ GV+GS YAA ++FL LI QFWVA+ P+     +  NFF+ YLAMPIL+ F
Sbjct: 519 LGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAF 578

Query: 540 YFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           YFGY+ WK+DW LFIRAKDIDL +HR I+DE++L+QE  +YKE L+NG +W +  AFWC
Sbjct: 579 YFGYRVWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/627 (57%), Positives = 447/627 (71%), Gaps = 35/627 (5%)

Query: 1   MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKID--------- 51
           + S+ P    +    +V KN I + E Q  E+H+     L+ F+DSFK+ +         
Sbjct: 43  IGSIEPENEIEYFEETVEKN-IESMEYQ-GENHASY---LRRFIDSFKRAEGSHANSSDS 97

Query: 52  ------------DNNNQYEIEKNE------INNIK-SDQFNDKLNNQLQKTIQPRHVIMI 92
                       D+++Q + E N       ++ IK + Q  ++    L+K+I+PRH +M+
Sbjct: 98  SNSNTTTPIFTNDSSSQLDNELNRKSSYITVDGIKQAPQEQEQKQENLKKSIKPRHTVMM 157

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           S                L+NAGP GL+IGY IM SC+YCIIQACGE+AV Y  LIGGFN 
Sbjct: 158 SLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNT 217

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAI 212
           YP FLVD A  F+VAW++C+QWLCVCPLELVTASMTIKYW  KVDPDVFV IFY+LII I
Sbjct: 218 YPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVI 277

Query: 213 NLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHT 272
           N+FG A+GYAEA+FFFN CKILM                 T GYIG  YW +PGAFRG T
Sbjct: 278 NVFG-AKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDT 336

Query: 273 PGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIII 332
           P  RFKGIV+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR LF+++ S+ +
Sbjct: 337 PIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTL 396

Query: 333 VGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSS 392
           VGFLVPY S +LLG+  S TKASPYVIAV+SHG+R+ PHFINAVIL+SVLSVANS+FY+S
Sbjct: 397 VGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTS 456

Query: 393 SRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISG 452
           SR+L++LAKQG APK F Y+DR+GRP   ++ ++L   IAFCASS KE +VF+WLLAISG
Sbjct: 457 SRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISG 516

Query: 453 LSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVA 512
           LSQ+FTW TICLSHIRFRRAMK+QGRSL E+GYKSQVGVWGS YA  +M L LI QFWVA
Sbjct: 517 LSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVA 576

Query: 513 LWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDED 571
           + P+   G  +  +FF+ YLAMPIL+  Y  +K WK DW+LFI A  +DL+SHR+I+DE+
Sbjct: 577 IAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEE 636

Query: 572 VLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +LKQE  +YKE L+NG  W +I  FWC
Sbjct: 637 LLKQEDEEYKERLRNGPYWKRIVDFWC 663

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/604 (57%), Positives = 432/604 (71%), Gaps = 30/604 (4%)

Query: 19  KNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNN----------------------- 55
           + V VT E      ++      + FVDSFK+ +  NN                       
Sbjct: 26  REVSVTPETSAT-PNTPAPSQFRRFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEV 84

Query: 56  -QYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAG 114
              E+++N++   KS+Q     N +L++TI+PRHVI+IS                LHNAG
Sbjct: 85  ADLEVQENQVLTEKSNQ----KNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAG 140

Query: 115 PAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQW 174
           PAGLLIGY IM +C+YCIIQA GE+AV+Y +L GGFN YPSFLVD A+ F+VAWVYCIQW
Sbjct: 141 PAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQW 200

Query: 175 LCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL 234
           LCVCPLELVTASMTIKYW   V+ D+FV IFY+LII IN FG ARGYAEAEFFFN CKIL
Sbjct: 201 LCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFG-ARGYAEAEFFFNCCKIL 259

Query: 235 MXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQT 294
           M                   GYIG  YW+ PGAF G  P   FKGI++T+VTAAF+FG T
Sbjct: 260 MMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGAT 319

Query: 295 EFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA 354
           EF+A+TA+EQSNPRKAIPSAAKKV+YR LFI++GSI +VGFLVPY+S +L+GS  S TKA
Sbjct: 320 EFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKA 379

Query: 355 SPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDR 414
           SPYV+AV++HG+++ PHFINAVIL+SVLSV NS+FYSSSR+L +LA+QG APK F Y+DR
Sbjct: 380 SPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDR 439

Query: 415 KGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMK 474
           +GRP   ++ A + A I+FCA+SPKE +VF+WLLAISGLSQVFTW  ICLSHIRFR+AM 
Sbjct: 440 EGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMF 499

Query: 475 IQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMP 534
           +Q RSL E+G+K+Q GVWGS Y   ++ +ILI QFWVA+ P+     +   FF+ YLAMP
Sbjct: 500 VQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMP 559

Query: 535 ILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIY 594
           IL+LFY GYK WKKDW+LFIRA +IDL  HR I+DE++LKQE  +Y+E LKNG    +I 
Sbjct: 560 ILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKNGGYLKRIA 619

Query: 595 AFWC 598
           AFWC
Sbjct: 620 AFWC 623

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/578 (59%), Positives = 427/578 (73%), Gaps = 19/578 (3%)

Query: 39  NLKDFVDSFKKIDDNNNQY----EIEKNEINNIKSDQFNDKLNNQ-------------LQ 81
           N++ F+DSFK+ +   NQ     E  +N++    S    D++ N+             L+
Sbjct: 84  NIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALK 143

Query: 82  KTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAV 141
           K+I+PRHV+MIS                LHNAGPAGL+IGY IM SCIYCIIQA GEMAV
Sbjct: 144 KSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAV 203

Query: 142 NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVF 201
            Y  L+GGFN YPS LVD  + FAVAWVYC+QWLCVCPLELVT S+TIKYW   V+PD F
Sbjct: 204 VYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAF 263

Query: 202 VTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSY 261
           V IFY++II I +FG ARGYAEAEFFFN CKILM                   GY+G  Y
Sbjct: 264 VVIFYVVIIFIQIFG-ARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKY 322

Query: 262 WNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 321
           W++PGAFRG     RFKGI++T V+AAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR
Sbjct: 323 WHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYR 382

Query: 322 ALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISV 381
            + I+VG+I ++GFLVP++S +L+G+  S TKASPYV+A++ HG+R+ PHFINAVILISV
Sbjct: 383 VICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISV 442

Query: 382 LSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKET 441
            SVANS+FYSSSR+LL LA+QGYAPK F Y+DR+GRP   +  A+L   IAFCA+SPKE 
Sbjct: 443 FSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKED 502

Query: 442 EVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVM 501
           +VF+WLLAISGLSQ+FTW  IC+SHIRFRRAM +QGRSL E+G+K+Q+GV+GS YA  +M
Sbjct: 503 QVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMM 562

Query: 502 FLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560
            L LI QFWVA+ P+ +NG  +   FF+ YLAMPIL+ FYFGYK WK+DW LFIRAKDID
Sbjct: 563 VLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDID 622

Query: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           L S+R ++DE++LKQE  +YKE LKNG +W ++  FWC
Sbjct: 623 LDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDFWC 660

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/583 (59%), Positives = 432/583 (74%), Gaps = 9/583 (1%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNN---QYEIEKNEINNIKSDQFNDK------ 75
           +++Q   SHS+     ++F+DSFK+ D       ++++ K     ++  +   +      
Sbjct: 59  SQDQNTTSHSRTRAKFQNFIDSFKRADKEQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAG 118

Query: 76  LNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQA 135
            + +L+ +I+PRHVIMIS               +L N+GPAGL+IGY IM SCIYCIIQA
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 136 CGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK 195
            GEMAV Y  LIGGFN+YPSFL++ A  F+VAWVYCIQWLCVCPLELVTASMTIKYW  K
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSG 255
           VDPDVFV IFY+LII IN+ GGA GYAEAEFFFN CKILM                   G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 256 YIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           YIG  YW++PGAFRG     RFKG+VSTLV AAF+FG +E + +TASEQSNPRKAIPSAA
Sbjct: 299 YIGGRYWHDPGAFRGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAA 358

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINA 375
           KK+IYR + IY+GS++IVGFLVP+NS +LLGS     KASPYV+AV++HG+R+ PHFINA
Sbjct: 359 KKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINA 418

Query: 376 VILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCA 435
           VIL+SVLSVANS+FYSSSR+LL LA+QGYAPKIF Y+DR+GRP  G+  A+L+  I+FCA
Sbjct: 419 VILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCA 478

Query: 436 SSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSI 495
           +SPKE +VF WLLAISGLSQ+FTW  ICLSHIRFRRAM +QGRSL E+G+KSQ GVWGS 
Sbjct: 479 TSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSW 538

Query: 496 YAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIR 555
           YA  +M LILI QFWVA+ P+     ++  FF+ YLA PIL+  YFGYK + KDW LFIR
Sbjct: 539 YAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIR 598

Query: 556 AKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           AKDIDL  +R ++DE++++QE+ +YKE ++N  +W KIY FWC
Sbjct: 599 AKDIDLDINRDVFDEELIRQEEEEYKEKMRNAPIWQKIYEFWC 641

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/571 (59%), Positives = 427/571 (74%), Gaps = 12/571 (2%)

Query: 39  NLKDFVDSFKKIDDNN--------NQYEIEKNEINNIKSDQFN---DKLNNQLQKTIQPR 87
           +L+  +DSF++ +D +        N+     + ++  K  QF    ++ ++ LQKTI+PR
Sbjct: 79  HLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPR 138

Query: 88  HVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147
           HV+++S              + LH AGP GL+IGY IM SC+YCIIQACGEMAV Y  L 
Sbjct: 139 HVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLP 198

Query: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207
           G FN YPSFLVD A+ F+VAWVYC+QWLCV PLELVTASMTI+YW   V+ DVFV IFY+
Sbjct: 199 GNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYV 258

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
           LII IN+FG A+GYAEAEFFFN CK+LM                   GYIG  YW+NPGA
Sbjct: 259 LIIFINVFG-AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGA 317

Query: 268 FRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYV 327
           FRG     RFK ++ST  TAAF+FG +EF+AI ASEQSNPR+AIPSAAK +IYR LFI++
Sbjct: 318 FRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFL 377

Query: 328 GSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANS 387
            SI +VGFLVPYNS EL+GS S+ TKASPYVIAVASHG+R+ PHFINAVIL+SVLSVANS
Sbjct: 378 TSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 437

Query: 388 SFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWL 447
           +FYSS R+L +L++QGYAP  F Y+DR+GRP   +I ++L + IAFCA S KE +VF+WL
Sbjct: 438 AFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWL 497

Query: 448 LAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG 507
           LAISGLSQ+FTW  IC+SHIRFRRAMK+QGRS++E+G+KSQVGVWGS YAA +M L LI 
Sbjct: 498 LAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIA 557

Query: 508 QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHI 567
           +FWV++ P+  +  +  NFF+ YLAMPIL++ YFGYK  K+DW LFIRAKDIDL+SHR I
Sbjct: 558 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKI 617

Query: 568 YDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           YD +++KQE+ ++KE L+NG  W K+ AFWC
Sbjct: 618 YDGELIKQEEEEFKERLRNGPFWKKVVAFWC 648

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/594 (58%), Positives = 438/594 (73%), Gaps = 18/594 (3%)

Query: 23  VTNENQINESHSKLIENLKDFVDSFKKIDDNN----NQYEIEKNE---------INNIKS 69
           +T  N   ++ +K    +++F+DSFK  +  N    +   I  NE         ++N+  
Sbjct: 74  ITQTNDYEQNITKPTSRVRNFIDSFKPAEVKNSPEKDTASITSNEMMIDEEILSLSNLDG 133

Query: 70  DQFN-----DKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYII 124
            +       +  +++L+KTI+PRHV+MIS              ++L  AGPAGLL+G+ I
Sbjct: 134 QRVPPPRKIENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGI 193

Query: 125 MASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVT 184
           M +C+YCIIQA GEMAV Y  L+GGFN YPSFLVD A+ F+VAWVY +QWLCVCPLELVT
Sbjct: 194 MGTCLYCIIQAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVT 253

Query: 185 ASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXX 244
           ASMTIKYW  KVDPDVFV IFY+LI+AIN+ GGA GYAEAEF FN CKILM         
Sbjct: 254 ASMTIKYWTTKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGI 313

Query: 245 XXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQ 304
                     GYIG  YW+ PGAFRG     RFKG+++TLV AAF+FG +EF+ +TASEQ
Sbjct: 314 IIICGGAGNDGYIGGKYWHEPGAFRGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQ 373

Query: 305 SNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASH 364
           SNPRKAIPSAAKK++YR + +++ SI IVGFLVPY+S +LLGS     KASPYV+AV++H
Sbjct: 374 SNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTH 433

Query: 365 GIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIA 424
           G+++ PHFINAVILISVLSVANS+FYSSSRMLL+LA+QGYAPKIF Y+DR+GRPL G+  
Sbjct: 434 GVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAM 493

Query: 425 ASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELG 484
           ASL   IAFCA+SPKE EVF WLLAISGLSQ+FTW  IC+SH+RFRRAM +QG+S+ ELG
Sbjct: 494 ASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELG 553

Query: 485 YKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544
           ++SQVG WGS YAA +M  ILI QFWVA+ P+     +  NFF+ YLAMPILL  YFGYK
Sbjct: 554 FRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYK 613

Query: 545 TWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            + K+W +FIRAKDIDL+SHR+I+DE+++KQE+ +Y+E L+NG +W ++Y FWC
Sbjct: 614 IYTKNWTIFIRAKDIDLVSHRNIFDEEIIKQEEEEYREKLRNGPMWRRVYDFWC 667

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/627 (55%), Positives = 441/627 (70%), Gaps = 35/627 (5%)

Query: 1   MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKID--------- 51
           + S+ P    +    +V K +   N     E H+     L+ F+DSF++ +         
Sbjct: 43  IGSIEPENEVEYFEKTVEKTI--ENMEYEGEHHASY---LRRFIDSFRRAEGSHANSPDS 97

Query: 52  ------------DNNNQYEIEKNE------INNIK-SDQFNDKLNNQLQKTIQPRHVIMI 92
                       D+++Q + E N       ++ IK S Q  ++    L+K+I+PRH +M+
Sbjct: 98  SNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMM 157

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           S                L+NAGP GL+IGY IM SC+YCIIQACGE+AV Y  LIGGFN 
Sbjct: 158 SLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNT 217

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAI 212
           YP FLVD A  F+VAW++C+QWLCVCPLELVTASMTIKYW   V+PDVFV IFY+LI+ I
Sbjct: 218 YPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVI 277

Query: 213 NLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHT 272
           N+FG A+GYAEA+FFFN CKILM                 T GYIG  YW +PGAFRG T
Sbjct: 278 NVFG-AKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDT 336

Query: 273 PGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIII 332
           P  RFKG+V+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR LF+++ S+ +
Sbjct: 337 PIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTL 396

Query: 333 VGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSS 392
           VGFLVPY S +LLG+  S TKASPYVIAV+SHG+R+ PHFINAVIL+SVLSVAN +FY+S
Sbjct: 397 VGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTS 456

Query: 393 SRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISG 452
           SR+L++LAKQG APK F Y+DR+GRP   ++ ++L   IAFCASS KE +VF+WLLAISG
Sbjct: 457 SRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISG 516

Query: 453 LSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVA 512
           LSQ+FTW TICLSHIRFRRAMK+QGRSL E+GYKSQVGVWGS YA  +M L LI QFWVA
Sbjct: 517 LSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVA 576

Query: 513 LWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDED 571
           + P+   G  +  +FF+ YLAMPI +  Y  YK WKKDW+LFI A  +DL+SHR+I+DE+
Sbjct: 577 IAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEE 636

Query: 572 VLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +LKQE  +YKE L+NG  W ++  FWC
Sbjct: 637 LLKQEDEEYKERLRNGPYWKRVLDFWC 663

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/623 (55%), Positives = 441/623 (70%), Gaps = 44/623 (7%)

Query: 19  KNVIVTNENQIN---ESHSKLIENLK-----------DFVDSFKKID------------- 51
           +N  +  EN++     +  K +EN++            F+DSF++ +             
Sbjct: 42  ENASIERENEVEYFENTMEKTMENMEYKGDHQRSYFHRFIDSFRRAEGSHPNSPDSTNLN 101

Query: 52  --------DNNNQYEIEKNE------INNIK-SDQFNDKLNNQLQKTIQPRHVIMISXXX 96
                   D++++ + E N       ++ IK S Q  +     L+K+I+PRH +M+S   
Sbjct: 102 GSTPISTKDSSSRLDNELNPKSSYITVDGIKQSSQEQEPKQENLKKSIKPRHTVMMSLGT 161

Query: 97  XXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSF 156
                        L+NAGP GL+IGY IM SC+YCIIQACGE+AV Y  LIGGFN YPSF
Sbjct: 162 GIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSF 221

Query: 157 LVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFG 216
           LVD A  F+VAW++C+QWLCVCPLELVTASMTIKYW  KV+ DVFV IFY+LI+ IN+FG
Sbjct: 222 LVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVINIFG 281

Query: 217 GARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTR 276
            A+GYAEA+FFFN CKILM                 T GYIG  YW +PGAFRG T   R
Sbjct: 282 -AKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAFRGDTSIQR 340

Query: 277 FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336
           FKG+V+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR LF+++ S+ +VGFL
Sbjct: 341 FKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFL 400

Query: 337 VPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396
           VPY S +LLG+  S TKASPYVIAV+SHG+R+ PHFINAVIL+SVLSVANS+FY+SSR+L
Sbjct: 401 VPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRIL 460

Query: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456
           ++LAKQG APK F Y+DR+GRP   +I +++   IAFCASS KE +VF+WLLAISGLSQ+
Sbjct: 461 MSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQL 520

Query: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516
           FTW TICLSHIRFR+ MK+QGRSL E+GYKSQVGVWGS YA  +M L LIGQFWVA+ P+
Sbjct: 521 FTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPI 580

Query: 517 NSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQ 575
             +   +  +FF+ YLAMPIL+  Y  YK WK+DW+LFI A  IDL+SHR+I+DE++LKQ
Sbjct: 581 GGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEELLKQ 640

Query: 576 EKNQYKENLKNGSLWLKIYAFWC 598
           E  +YK+ L+NG  W ++  FWC
Sbjct: 641 EDEEYKDRLRNGPFWKRVLDFWC 663

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/575 (58%), Positives = 423/575 (73%), Gaps = 6/575 (1%)

Query: 30  NESHSKLIENLKDFVDSFKKIDD------NNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           ++ H+      + F+DSFKK +       +++    + +     +++   D    +L+KT
Sbjct: 53  SDHHAASNTRFRRFIDSFKKAEGPQPGSLDHDVLAGDSDIEGKPRTEPEKDDDARELKKT 112

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           I+PRHV+MIS               +L N+GPAGL+IGY IM SCIYCIIQA GE+AV Y
Sbjct: 113 IKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLY 172

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
             L GGFN YPS L+D A+ FAVAWVYCIQWLCVCPLELVTASMTIKYW  KVDPDVFV 
Sbjct: 173 TKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVV 232

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IFY LI+ IN+ GGA GYAEAEFFFN  KILM                   GYIG   W+
Sbjct: 233 IFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWH 292

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           NPG+FRG  P  RFKG+VSTLV AAF+FG +EFL +TASEQSNPRKAIPSAAKK++YR +
Sbjct: 293 NPGSFRGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRII 352

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLS 383
            IY+GS+ IVGFLVPY+S +LLGS  + TKASPYV+A++ HG+R+ PHFINAVIL+SVLS
Sbjct: 353 CIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLS 412

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
           V NS+FYSSSR LL+L++ GYAP    Y+DR GRPL     ++L+  IAFCA+SPKE +V
Sbjct: 413 VGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQV 472

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F WLLAISGLSQ+FTW +ICLSH+RFRRAM++QGRS+ E+G+KSQVG++GS+Y+  +M L
Sbjct: 473 FVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVL 532

Query: 504 ILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
           ILI QFW AL P+     ++  FF+ YLAMPI ++ YFG+K WKKDW LFIRA+DIDL+S
Sbjct: 533 ILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVS 592

Query: 564 HRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           HR I+DE++LKQE  +Y+  L++G +W ++Y FWC
Sbjct: 593 HREIFDEELLKQEDEEYRRKLRDGPMWRRVYDFWC 627

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/614 (56%), Positives = 436/614 (71%), Gaps = 40/614 (6%)

Query: 24  TNENQINESH--SKLI-----ENLKDFVDSFKKIDD-NNNQYEIEKNEINNIKSDQFNDK 75
           TN NQ +  H  SK +     E  ++++DSFK+ +  N +    ++N + N    +F++ 
Sbjct: 55  TNNNQSSSPHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDND 114

Query: 76  LNN-------------------------------QLQKTIQPRHVIMISXXXXXXXXXXX 104
           L N                               QL++TI+PRHVIM+S           
Sbjct: 115 LENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLV 174

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164
                L  AGPA L+IGY IM +C+YCIIQACGE+AV Y  + G FN +PSFLVD  +NF
Sbjct: 175 GNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNF 234

Query: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
           AVAWVYCIQWLCVCPLELVT+SMTIKYW  KVDPDVFV IFY+LI+ IN FG A+GYAEA
Sbjct: 235 AVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFG-AKGYAEA 293

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTL 284
           EFFFN CK++M                 T GYIG  YWN+PGAFRG T   RFKG++ T 
Sbjct: 294 EFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTF 353

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           VTAAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV YR L I++ SII++GFLVPYNS +L
Sbjct: 354 VTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQL 413

Query: 345 LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGY 404
           +GS S    ASPYV+A + HG+ +  HFINAVIL+SVLSVANS+FYSSSR+LL LA+ GY
Sbjct: 414 MGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGY 473

Query: 405 APKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICL 464
           APK F Y+DR GRPL  ++ A+++A IAFCA+SPKET+VF+WLLAISGLSQ+FTW  IC+
Sbjct: 474 APKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICV 533

Query: 465 SHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANIT 524
           SHIRFRR M++QGRSL ELG+++Q GV GS YAA ++FL L+ QFWVAL P+N++  +  
Sbjct: 534 SHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAE 593

Query: 525 NFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENL 584
           NFF+ YLAMPILL  Y G+K W++D+ LFIRAK+IDLISHR I+DE++L+QE  +YKE L
Sbjct: 594 NFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKL 653

Query: 585 KNGSLWLKIYAFWC 598
           +NG  W ++  FWC
Sbjct: 654 RNGPKWKRVVDFWC 667

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/579 (58%), Positives = 421/579 (72%), Gaps = 15/579 (2%)

Query: 25  NENQINESHSKLIEN----LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQL 80
            +  +  S  + +EN     + F +SFK+   +NN  + + ++          DK +N+L
Sbjct: 45  EKTSVQNSGFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAG--------DKGDNKL 96

Query: 81  QKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140
           +KTI+ RHV+MIS                L N GPAGL+IGY IM SC+YCIIQA GE+A
Sbjct: 97  KKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELA 156

Query: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDV 200
           V Y +L GGFN YPS L+D A  F+VAWVYC+QWLCV PLELVTAS+TIKYW   V+PD+
Sbjct: 157 VCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDI 216

Query: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVS 260
           FV IFY++II IN+FG ARGYAEAEFFFN  K+LM                   GYIG  
Sbjct: 217 FVAIFYVVIITINVFG-ARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYIGGK 275

Query: 261 YWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320
           YWN+PG+F G  P   FKG+VSTLVTAAF+FG TEF+A+TA+EQ+NPRK+IPSAAKK++Y
Sbjct: 276 YWNDPGSFSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKILY 335

Query: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380
           R L +YVGSII++GFLVP+NS EL+GS  S T ASPYVIA+ASHG+++ PH INAVIL+S
Sbjct: 336 RILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHLINAVILLS 395

Query: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440
           V+S+ NS+FYSSSR+LLTLA+QGYAP    Y+DR+GRP   ++ +S+   I+F A+SPKE
Sbjct: 396 VISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASPKE 455

Query: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500
             VF+WLLAISGLSQ+FTW  ICLSHIRFRRAMK+QGRSL ELG+KSQVGVWGS YA  +
Sbjct: 456 ETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGM 515

Query: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560
           M LILIGQFW A+ P+     +   FF+ YLAMPIL+  YFGYK WK+DW L+I A  ID
Sbjct: 516 MLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKID 575

Query: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA-FWC 598
           LIS+R I+DEDVLKQE  +Y+E L+N S WL+  A FWC
Sbjct: 576 LISNRRIFDEDVLKQEDAEYREKLRN-SGWLRRAAEFWC 613

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/574 (58%), Positives = 426/574 (74%), Gaps = 8/574 (1%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           T E  I+ S          FVDSFK++D+     ++E   +  +  +      N+ L++T
Sbjct: 68  TQEETIHNSDGSSRSPFGKFVDSFKRVDEKQTTSDLESG-LGEVPGE------NSDLKQT 120

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           I+ RHV++IS                L +AGP GL+IGY IM SC+YCIIQACGE+AV Y
Sbjct: 121 IKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAVCY 180

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
            +L   FN YP+FLVD A+ FAVAWVYC+QWLCVCPLELVTASMTIKYW   V+PD+FV+
Sbjct: 181 SSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIFVS 240

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IF++LII IN FG ARGYAEAEFFFN CK+LM                 TSGYIG  YW+
Sbjct: 241 IFFVLIIVINTFG-ARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYWH 299

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           +PGAF G+ P   FKG+++T  TAAF+FG +EF+++TA+EQSNPRKAIP AAK +IYR L
Sbjct: 300 SPGAFNGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRIL 359

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLS 383
           F+++ SI ++GFLVPYNSP LLGS S  TKASPYV+AVASHG+R+ PHFINAVIL+SVLS
Sbjct: 360 FVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPHFINAVILLSVLS 419

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
           V NS+FYSSSR+L +LA+QGYAPK+FTY+D++GRPL  ++ ++L  TIAFCA+SPKE +V
Sbjct: 420 VGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQV 479

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F+WLLAISGLSQ+FTW  IC+SH+RFRRA+K+QG SL E+G+KSQVG++GS+YAAT++ L
Sbjct: 480 FTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLIL 539

Query: 504 ILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
            LI QFWVAL P+  NG +  NFF+ YLAMPILL+ YFGYK  K+DW  +I A  IDL+S
Sbjct: 540 ALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLVS 599

Query: 564 HRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFW 597
           HR ++DED+LKQE  + ++  KN S   KI  F+
Sbjct: 600 HRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/574 (59%), Positives = 424/574 (73%), Gaps = 18/574 (3%)

Query: 42  DFVDSFKKIDDNNNQYEIEKNEINNIKS----------------DQFNDKLNNQ-LQKTI 84
           +F+D F++  ++N+  E  +NE+    S                D+   K   + L+K+I
Sbjct: 70  NFIDGFRRQTNHNSAAEDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSI 129

Query: 85  QPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYL 144
           +PRHV+MIS                L++AGPAGL IGY IM SCIYCIIQA GEMAV Y 
Sbjct: 130 KPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYS 189

Query: 145 TLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTI 204
            L+GGFN YPSFLV     FAVAWVY +QW CVCPLELVTASMTIKYW  KV+PDVFV I
Sbjct: 190 NLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVI 249

Query: 205 FYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNN 264
           FY LII IN+FG ARGYAEAEFFFN CK+LM                   GYIG  YW++
Sbjct: 250 FYFLIIVINVFG-ARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHD 308

Query: 265 PGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALF 324
           PGAFRG     RFKG+ +TLVTAAF+FG +EF+A+TASEQSNPRKAIP+AAKK++YR + 
Sbjct: 309 PGAFRGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIII 368

Query: 325 IYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSV 384
           I++GSII+VGFLVP+NS +L+GS SS+TKASPYVIA++SHG+R+ PHF+NAVIL+SVLSV
Sbjct: 369 IFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSVLSV 428

Query: 385 ANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVF 444
            NS+FYSSSR+L++L++QGYAPK F Y+DR+GRP   ++  +L A IAFCA+S KE +VF
Sbjct: 429 GNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVF 488

Query: 445 SWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLI 504
           +WLLAISGLSQ+FTW  ICLSHIRFRRAM +QGRSL E+G+KS++GVWGS YAA +MFL+
Sbjct: 489 TWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLV 548

Query: 505 LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISH 564
           LI QFWV L P+  N  +  +FF+ YLAM +L+ FY GY  WKKDW LFIRAKDIDL  H
Sbjct: 549 LIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHH 608

Query: 565 RHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           R I+DEDVL+QE  + KE L+NG LW +I  FWC
Sbjct: 609 RQIFDEDVLRQEDEETKEKLRNGPLWKRILNFWC 642

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/579 (58%), Positives = 422/579 (72%), Gaps = 15/579 (2%)

Query: 25  NENQINESHSKLIEN----LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQL 80
            +  +  S  + +EN     + F +SFK+   +NN  + + ++          DK +N+L
Sbjct: 45  EKTSVQNSDFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAG--------DKGDNKL 96

Query: 81  QKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140
           +KTI+ RHV+MIS                L N GPAGL+IGY IM SC+YCIIQA GE+A
Sbjct: 97  KKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELA 156

Query: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDV 200
           V Y +L GGFN YPS L+D A  F+VAWVYC+QWLCV PLELVTAS+TIKYW   V+PD+
Sbjct: 157 VCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDI 216

Query: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVS 260
           FV IFY+L IAIN+FG ARGYAEAEFFFN CK+LM                   GYIG  
Sbjct: 217 FVAIFYVLTIAINVFG-ARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGK 275

Query: 261 YWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320
           YWN+PG+F G  P   FKG+VSTLVTAAF+FG TEF+A+TA+EQ+NPRK+IPSAAKKV+Y
Sbjct: 276 YWNDPGSFSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLY 335

Query: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380
           R + I++GSI +VGFLVP+NS EL+GS  S T ASPYVIA+ASHG+++ PHFINAVIL+S
Sbjct: 336 RIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLS 395

Query: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440
           VLSV NS+FYSSSR+LL+LA+QGYAP    Y+DR+GRP   +I +++   I+F A+SPKE
Sbjct: 396 VLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASPKE 455

Query: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500
             VF+WLLAISGLSQ+FTW  ICLSHIRFRRAMK+QGRSL ELG+KSQVGVWGS YA  +
Sbjct: 456 ETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGM 515

Query: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560
           M LILIGQFW A+ P+     +   FF+ YLAMPIL+  YFGYK WK+DW L+I A  ID
Sbjct: 516 MLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKID 575

Query: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA-FWC 598
           LIS+R I+DEDVLKQE  +++E L+N S WL+  A FWC
Sbjct: 576 LISNRRIFDEDVLKQEDAEFREKLRN-SGWLRRAAEFWC 613

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/569 (58%), Positives = 418/569 (73%), Gaps = 10/569 (1%)

Query: 39  NLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ--------LQKTIQPRHVI 90
           +++ FVDSF++ +D+    E  +NE+ +  S   + +L+ Q        LQK+I+PRHV+
Sbjct: 70  HVRKFVDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVL 129

Query: 91  MISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGF 150
           M+S              + L  AGP  L+IGY IM SC+YCIIQACGEMAV Y  L G F
Sbjct: 130 MMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNF 189

Query: 151 NNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLII 210
           N YPSFLVD    F VAWVYC+QWLCV PLELVTASMTI YW  KV+ DVFV IF++LI 
Sbjct: 190 NAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLIT 249

Query: 211 AINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRG 270
            IN FG A+GYAEAEFFFN CK+LM                   GYIG  YW+NPGAFRG
Sbjct: 250 LINTFG-AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG 308

Query: 271 HTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSI 330
                RFK ++ST  TAAF+FG +EF+AI ASEQSNPR+AIPSAAK +IYR LFI++ SI
Sbjct: 309 DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSI 368

Query: 331 IIVGFLVPYNSPELLGSKSSQTKAS-PYVIAVASHGIRIAPHFINAVILISVLSVANSSF 389
            +VGFLVPY+S ELLGS  S +  + PYVIAVASHG+R+ PHFINAVIL+SVLSVANS++
Sbjct: 369 TLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAY 428

Query: 390 YSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLA 449
           YSS R+L +LA+QGYAPK F Y+DR+GRP   ++  ++   IAFC+ S KE +VF+WLL+
Sbjct: 429 YSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLS 488

Query: 450 ISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQF 509
           I+GLSQ+FTW  ICLSHIRFRRAMK+QGRS++E+G+KSQVGVWGS YAA +M L LI +F
Sbjct: 489 IAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEF 548

Query: 510 WVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYD 569
           WV++ P+  +  +  NFF+ YLAMPIL++ YFGYK +KKDW LFIRAKDIDLISHR I+D
Sbjct: 549 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFD 608

Query: 570 EDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            ++++QE+ +YKE L+NG  W ++ AFWC
Sbjct: 609 GELVRQEEEEYKEKLRNGPKWKRVVAFWC 637

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/612 (56%), Positives = 435/612 (71%), Gaps = 28/612 (4%)

Query: 14  HLSVNKNVIVTNENQINESHSKLIE-NLKDFVDSFKKIDDNNNQYEIEKNEIN------- 65
           +L    N   ++ N I E  S   + + K FVDSF++ D   N     +N+I        
Sbjct: 29  YLDSQLNGDSSSNNSIKEPTSTGAKGHFKSFVDSFRRGDHAKNALHDLENDITTSISHAS 88

Query: 66  -------------------NIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXX 106
                              + +  + N+  ++ LQKTI+PRHVIMIS             
Sbjct: 89  LVHAVSKAREDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGN 148

Query: 107 XATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAV 166
            + L  AGPA L+IGY IM SC+YCIIQA GEMAV Y  L GGFNNYPSFL+D A  F+V
Sbjct: 149 SSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSV 208

Query: 167 AWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEF 226
           AWVYC+QWLCVCPLELVTAS+TIKYW  KVDPDVFV IFY+LII+IN+FG ARGYAEAEF
Sbjct: 209 AWVYCLQWLCVCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINVFG-ARGYAEAEF 267

Query: 227 FFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVT 286
           FFN+CK+LM                   GY+G  YW+ PGAFRG     RFKG++ T V 
Sbjct: 268 FFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFRGEHAVDRFKGVMDTFVA 327

Query: 287 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLG 346
           AAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR + I++ SII++GFLVPY+S +LLG
Sbjct: 328 AAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLG 387

Query: 347 SKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAP 406
           S  S  KASPYV+AV+ HG+R+ PHFINAVIL+SVLSV NS+FYSSSR+LL+L++QGYAP
Sbjct: 388 SSGSGVKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAP 447

Query: 407 KIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSH 466
           K F Y+DR+GRP   ++ ++L   IAFCA+SPKET+VF+WLLAISGLSQ+FTW  IC+SH
Sbjct: 448 KWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSH 507

Query: 467 IRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNF 526
           +RFR AMK+QGRS+ E+G+ SQ GV+GS+YAAT+M L L+ QFWVA+ PLN    +  NF
Sbjct: 508 VRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNF 567

Query: 527 FKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKN 586
           F+ YLAMPIL+  YFGYK + +DW L+I+A  IDLISHR I+DE++LKQE  +YKE L+N
Sbjct: 568 FQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFDENILKQEDEEYKEKLRN 627

Query: 587 GSLWLKIYAFWC 598
           G  W +I  FWC
Sbjct: 628 GPAWRRIADFWC 639

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/593 (56%), Positives = 417/593 (70%), Gaps = 23/593 (3%)

Query: 28  QINESHSKLIENLKDFVDSFKK--------IDDNNNQYE--IEKNEINNIKSDQFNDKLN 77
            +N S  K   N+K F+DSFK+        ID     YE  +E     ++     N +  
Sbjct: 56  DLNPSDKKKKSNIKRFIDSFKQPIRPNSDYIDAAELDYEQALENGITTSVSPSAPNLRKL 115

Query: 78  NQLQ------------KTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIM 125
           NQL+            +TI+PRHV+MIS                L NAGPAGL+IGY IM
Sbjct: 116 NQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIM 175

Query: 126 ASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTA 185
            S IYCIIQA GEMA+ Y  L GG+N YPSFLV+  + FA+AWVYCIQWL VCPLELVTA
Sbjct: 176 GSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTA 235

Query: 186 SMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXX 245
           S+TIKYW   V+ D+FV IFY LII IN+FG A+GYAEAEFF N CK+LM          
Sbjct: 236 SLTIKYWTTSVNSDIFVAIFYALIIIINVFG-AKGYAEAEFFCNCCKVLMMIGFFILSIT 294

Query: 246 XXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQS 305
                    GY+G  YW+ PGAFRG +    FKGI  TLVTAAF++G TEFLA+TA+EQS
Sbjct: 295 ITAGGAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQS 354

Query: 306 NPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHG 365
           NPR AIPSAAKKV+YR + +Y+ SI+++GFLVP++S  LLGS  S T ASPYV+A + HG
Sbjct: 355 NPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHG 414

Query: 366 IRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAA 425
           +R+ PHFINAVILISVLSV NS+FYSSSR+L++LA+QGYAPK F Y+DR+GRP   ++ +
Sbjct: 415 VRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMS 474

Query: 426 SLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGY 485
           +L   IAFCA+SPKETEVF+WLLAISGLSQ+FTW  ICLSHIRFR AMK+QGRSL E+GY
Sbjct: 475 ALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGY 534

Query: 486 KSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKT 545
            +Q GVWGS YA  +MFLI I QFWVA+ P+ S   +  NFF+ YLAMPIL++ Y GYK 
Sbjct: 535 LAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKI 594

Query: 546 WKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           + KDW L I+A+DIDL SHR I+DED+LK+E  +Y++ LKNG  W ++  FWC
Sbjct: 595 YYKDWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFWC 647

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/571 (57%), Positives = 428/571 (74%), Gaps = 12/571 (2%)

Query: 39  NLKDFVDSFKKIDDNNNQYEIEKNEINN--------IKSDQF---NDKLNNQLQKTIQPR 87
           +LK F+DSFK+ ++   + +  + E+          IK       + + +  L+K+IQPR
Sbjct: 75  HLKRFIDSFKRAEEGTEETKHMETELTTTLSPLSAAIKEHDVAITSKEEDAHLRKSIQPR 134

Query: 88  HVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147
           HV+M S              + LH AGPAGL+IGY IM +C+YCIIQACGEMAV+Y  L 
Sbjct: 135 HVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLP 194

Query: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207
           G FN YP+FLVD  + FAVAWVYCIQWLCV PLELVTASMTI YW  KV+ D+FV IFY+
Sbjct: 195 GNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDIFVVIFYV 254

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
           LII IN+FG A+GYAEA+FFFN CK+LM                 TSGYIG  YW++PGA
Sbjct: 255 LIILINVFG-AKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGA 313

Query: 268 FRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYV 327
           FRG     RFK +++T  TAAF+FG +EF+AI ASEQSNPR+AIPSAAK +IYR LFI++
Sbjct: 314 FRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFL 373

Query: 328 GSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANS 387
            SI +VGFLVPY+S EL+GS S  TKASPYV+A++SHG+R+ PHFINAVIL++VLSV+NS
Sbjct: 374 SSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNS 433

Query: 388 SFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWL 447
           +FYSS R+L +L++QGYAP+ F Y+DR+GRP   +I + L   IAFCA S KE EVF+WL
Sbjct: 434 AFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWL 493

Query: 448 LAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG 507
           LAISGLSQ+FTW  ICLSHIRFRRAM +QGRS++ELG++SQ+GVWGS+YAAT++FL LI 
Sbjct: 494 LAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIA 553

Query: 508 QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHI 567
           +FWV++ P+  +  +  +FF+ YLAMPIL++FYFGYK + +DW LFIRAK+IDLI+HR+I
Sbjct: 554 EFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNI 613

Query: 568 YDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +D ++++QE+ +Y+E LKNG  W ++  FWC
Sbjct: 614 FDAEIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/583 (54%), Positives = 410/583 (70%), Gaps = 7/583 (1%)

Query: 16  SVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDK 75
           SV +  +  ++ + +E  SK     + F  +F + D   +       E     + Q   K
Sbjct: 32  SVERISLPGDDYKFHEDDSK--SRFRRFARTFHRADGLGDGASGNDVEFGAEVARQTETK 89

Query: 76  LNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQA 135
           L    ++TI  RHV M+S                LHN GPAGL+IGY IM SC+YCIIQA
Sbjct: 90  L----KQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQA 145

Query: 136 CGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK 195
            GE+AV+Y +L G FN YPS L++ A+ F+VAW+YC+QWLCV PLELVTAS+TIKYW   
Sbjct: 146 AGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTS 205

Query: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSG 255
           V+PD+FV IFY+LII +N+FG ARGYAEAEFFFN CK+LM                   G
Sbjct: 206 VNPDIFVAIFYVLIILVNMFG-ARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDG 264

Query: 256 YIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           YIG  YWNNPGAF G  P   FKGI+ST+VTAAF+FG TEF+A+TA+EQ+NPR+AIPSAA
Sbjct: 265 YIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAA 324

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINA 375
           KKV+YR L I++  I+++GFLVP+NSPEL+GS SS T ASPYVIAVASHG+R+ PHFINA
Sbjct: 325 KKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHFINA 384

Query: 376 VILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCA 435
           VIL+SVLSV NS+FYSSSR+LL LA Q YAP    ++DR GRP+  ++ + +   I+F A
Sbjct: 385 VILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVA 444

Query: 436 SSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSI 495
           +SPKE  VF+WLLAISGLSQ+FTW +IC+SHIRFR+A+ +QG+ + ELGYKSQ GV GS 
Sbjct: 445 ASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSY 504

Query: 496 YAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIR 555
           YA  +M  ILIGQFWVA+ P+ S   +  +FF+ YLA+P+ ++ YFG+K WK+DW L+I 
Sbjct: 505 YATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIP 564

Query: 556 AKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            + IDL SHR  +DE++LKQE  +Y+EN++N     +I  +WC
Sbjct: 565 LEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYWC 607

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/579 (57%), Positives = 418/579 (72%), Gaps = 12/579 (2%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTI 84
             + INES +K   NL+ FVDSFK+ + +    + + NE+   + +     + + L++TI
Sbjct: 56  GSSSINESPAKKKSNLRRFVDSFKRAE-HMIPADDKINEMTTAEPEAEMASVEDNLKQTI 114

Query: 85  QPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYL 144
           +PRHVIMIS              + L  AGPAGL+ GY IM +C+YCIIQ+ GEMAV Y 
Sbjct: 115 KPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYS 174

Query: 145 TLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASM-----TIKYWNEKVDPD 199
            L GGFN YP+ LV+  +     WV C   +    ++ ++  +       KYW  +VDPD
Sbjct: 175 KLNGGFNAYPTMLVEPGF-----WVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPD 229

Query: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGV 259
           VFV IFY+LII IN+FG ARGYAEAEFFFN CK+LM                   GY+G 
Sbjct: 230 VFVVIFYVLIIVINVFG-ARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGN 288

Query: 260 SYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
            YW NPGAFRG      FKG+V+TLVTAAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+
Sbjct: 289 IYWRNPGAFRGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVL 348

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILI 379
           YR + +Y+ SII++GFLVP+ SPELLGS S+ T ASPYVIAVASHG+R+ PHFINAVIL+
Sbjct: 349 YRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILL 408

Query: 380 SVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPK 439
           SVLSV NS+FYSSSR+LL+L+KQGYAPK F Y+DR+GRP   +I ++L   IAFCA+SPK
Sbjct: 409 SVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPK 468

Query: 440 ETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT 499
           ETEVF+WLLAISGLSQ+FTW +ICLSHIRFR AMK QGRS+ E+G+K+Q G+WGS Y+  
Sbjct: 469 ETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIF 528

Query: 500 VMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDI 559
           +M L LIGQFWVA+ P+ +   +  NFF+ YLAMPIL+ FYFGYK WKKDW L+I+A+DI
Sbjct: 529 LMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDI 588

Query: 560 DLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           DLISHR I+DE++LKQE  + KE LKNG +W +I AFWC
Sbjct: 589 DLISHRQIFDEELLKQEDYELKEKLKNGPVWRRIVAFWC 627

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/524 (58%), Positives = 384/524 (73%), Gaps = 3/524 (0%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           +  L++TI+ RH+IMIS                LH+ GPAG  IG++IM  C+YC+IQA 
Sbjct: 87  HENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAA 146

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NE 194
           GE+AV Y +L GGFN YPSFL+D A  FA AWVYC+QWLCV PLELVTAS+TIK+W  + 
Sbjct: 147 GELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSR 206

Query: 195 KVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS 254
            V+PD++V IFY+LII IN FG ARGYAEAEFFFN CK+LM                 TS
Sbjct: 207 SVNPDIYVAIFYVLIIVINFFG-ARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 255 GYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSA 314
           GYIG  YW +PG+  G T    FKGIV+TLV AAFS G +EF+A+TA+EQ+NPRK+IP+A
Sbjct: 266 GYIGGKYWRDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAA 325

Query: 315 AKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFIN 374
           AKK+IY+   +++GS+I++GFLVP +S EL+GS  S    SPYVIAV  HG+ + P FIN
Sbjct: 326 AKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPSFIN 385

Query: 375 AVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFC 434
           AVIL+SVLSV NS+FYSSSR+L +LA+Q YAPKIF Y+DR GRPL  +I + L  TI F 
Sbjct: 386 AVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFV 445

Query: 435 ASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGS 494
           A+SPKE EVF WLLAISGLSQ+FTW TICLSHIRFRRA+ +QG S +ELG+K+Q G+ GS
Sbjct: 446 AASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGS 505

Query: 495 IYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFI 554
             +A +M L LIGQFWV+L P+ +   +  +FF  YLAMP+ LLFYFGYK W KDW LFI
Sbjct: 506 YVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFI 565

Query: 555 RAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           RA  IDL+SHR I+D DVLKQE  +Y+  L+N S+W +I  FWC
Sbjct: 566 RADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANFWC 609

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/574 (56%), Positives = 413/574 (71%), Gaps = 5/574 (0%)

Query: 27  NQINESHSKLIENLKDFVDSFKKIDD-NNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQ 85
           +Q +E ++        F DSFK+ D  N N +   + E+N   S     +    L++ I+
Sbjct: 50  SQSDEEYAAKSSVWHRFKDSFKRADHINTNIHGNAELELN--PSQSLLPEKGASLKRDIK 107

Query: 86  PRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLT 145
           PRHV+M+S                L   GPAGL IGY IM SC+Y IIQA GE+AV Y T
Sbjct: 108 PRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPT 167

Query: 146 LIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIF 205
           L G FNNYPSFLVD A  FA A +YCIQWLCV PLE+++A++TIKYWN  ++P+V+  IF
Sbjct: 168 LTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIF 227

Query: 206 YLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNP 265
           Y++II IN+ G A GYAEA+FFFN CKILM                  S YIG  YWN+P
Sbjct: 228 YVMIIGINMCGSA-GYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDP 286

Query: 266 GAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFI 325
           GAF G T  +RFK IVSTLVTAAF+FG +E +A+TASEQ+NPRKAIPSAAK+V+YR + I
Sbjct: 287 GAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAI 346

Query: 326 YVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVA 385
           Y+ SII+VGFLVPYNSPEL+GS SS   +SPYVIAVASHG+++ P FINAVILISVLSV 
Sbjct: 347 YLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVG 406

Query: 386 NSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFS 445
           N SFYSSSR+LL L++ GYAPK F Y+DR+GRPL+ +I  +L+  I F ++S  E  VF+
Sbjct: 407 NFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFT 466

Query: 446 WLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLIL 505
           WL+A+SGLSQ+FTW  IC+SH+RFR+AM++Q RS+ ELG++SQVGVWGS Y   +M L+ 
Sbjct: 467 WLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVF 526

Query: 506 IGQFWVALWPL-NSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISH 564
           IGQFWVAL+P+  ++GA+  NFF  YLAMP+ L  YFG+K WKKDW L+I A +IDLISH
Sbjct: 527 IGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISH 586

Query: 565 RHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           R I+DE++LKQE  +YK  +K+ S+W+K+  FWC
Sbjct: 587 RKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC 620

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/560 (55%), Positives = 396/560 (70%), Gaps = 12/560 (2%)

Query: 39  NLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXX 98
             + FV+SFKK     N  E          S Q N+K + +L++TI+PRHV+MIS     
Sbjct: 59  KFRRFVNSFKKAPGRENDQE----------SLQDNNK-HEKLKQTIRPRHVVMISLGTGI 107

Query: 99  XXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLV 158
                      L+N GP GL +G+ +M +C+YC+IQA GEMAVNY  L GGFN YPSFLV
Sbjct: 108 GTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLV 167

Query: 159 DTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGA 218
           D  + FA AW+YCIQWLCV PLELVTAS+TIKYW   ++PD+FV +FYLLII IN FG A
Sbjct: 168 DPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFG-A 226

Query: 219 RGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFK 278
           RGYAEAEFFFN CK+LM                   GYIG  YW  PG+F GHT    FK
Sbjct: 227 RGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGGHTAIDHFK 286

Query: 279 GIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVP 338
           G+VSTLV AAFS G +EF+A+TA+EQ+NPRK++PSAAKK++Y+   +++GS+ ++GFLVP
Sbjct: 287 GVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVP 346

Query: 339 YNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLT 398
            NS EL+GS  S    SPYVIAVASHG+R+ PHFINAVIL+SVLSV NS+FYSSSR+LL+
Sbjct: 347 KNSSELMGSTDSSVHVSPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLS 406

Query: 399 LAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFT 458
           LA+QGYAP +F Y+DR+GRPL  ++ +  +  + F A+SPKE  VF WLLAISGLSQ+FT
Sbjct: 407 LAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFT 466

Query: 459 WGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNS 518
           W +IC+SHIRFR+A+ +QGR  + LG+K+Q GVWGS Y+A +M L  I QFW  L P+ S
Sbjct: 467 WTSICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGS 526

Query: 519 NGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKN 578
           +  N  +FF+ YLA PI +  YFGYK + K+W LFI A+ IDL  HR I+D DVLKQE  
Sbjct: 527 SKPNAESFFEGYLAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDA 586

Query: 579 QYKENLKNGSLWLKIYAFWC 598
           +Y+  L++ S+W +I A WC
Sbjct: 587 EYRAKLRDSSMWHRIAALWC 606

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/583 (53%), Positives = 412/583 (70%), Gaps = 10/583 (1%)

Query: 16  SVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDK 75
           S+ K  +  ++ Q ++   +++   +   +SFK+  ++    +++          Q    
Sbjct: 24  SIEKVSLPASDYQYHDG--QVLSRFQRLTNSFKRAGEHGRGGDVDAE-------GQPVAP 74

Query: 76  LNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQA 135
              +L++TI  RH+ MIS                LHN GPAGL IGY IM SCIYCIIQA
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 136 CGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK 195
            GEMAV+Y +L G FN YPS L+D A  F+VAWVYC+QWLCV PLELVTA++TIKYW   
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSG 255
           V+PDVFV IFY+L + +NLFG ARGYAEAEFFFN CK+LM                   G
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFG-ARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDG 253

Query: 256 YIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           Y+G  YW++PGA  G  P   FKGI++T+VTAAF+FG TEF+A+TA+EQ+NPR+AIPSAA
Sbjct: 254 YLGGKYWHDPGALYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAIPSAA 313

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINA 375
           KK++YR L I++  II++GFLVPYNS EL+GS  S T ASPYVIA+ASHG+++ PHFINA
Sbjct: 314 KKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPHFINA 373

Query: 376 VILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCA 435
           VIL+SVLSV NS+FYSSSR+LL+L++Q YAP    Y+DR+GRP+  ++ + +   IAF A
Sbjct: 374 VILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVA 433

Query: 436 SSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSI 495
           +SPKE  VF+WLLAISGLSQ+FTW  IC+SHIRFR+A+ +QG+SL ELGYKSQ GV GS 
Sbjct: 434 ASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGVVGSY 493

Query: 496 YAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIR 555
           YA  +M  +L GQFWVA+ P+ ++  +  NFF+ YLAMPIL+  YFGY+ WK+DW L+I 
Sbjct: 494 YATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDWKLYIP 553

Query: 556 AKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            + IDL+SHR ++DED+LKQE  +Y+E+++N     ++  FWC
Sbjct: 554 LEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHFWC 596

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/562 (52%), Positives = 404/562 (71%), Gaps = 7/562 (1%)

Query: 43  FVDSFKKIDDNNNQYEIEKNEINNIKSDQF------NDKLNNQLQKTIQPRHVIMISXXX 96
           FVDSFK+ ++  N  +   +    +  + F      +   +  L++ I+PRHV+MIS   
Sbjct: 44  FVDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLAT 103

Query: 97  XXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSF 156
                       +LHN GPA LLIGY I+++ +YC+IQ+  E+A+ Y +L GGFN YP+ 
Sbjct: 104 GIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPAL 163

Query: 157 LVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFG 216
           LVD A+ F+V+WVYC+QWLC+ PLELVTASMTIKYWN+ ++PD FV IFY+++I IN F 
Sbjct: 164 LVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVIN-FI 222

Query: 217 GARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTR 276
           GA GYAEAEFFFN CK+LM                   GY+G  YW++PGAFRG+    R
Sbjct: 223 GAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGINR 282

Query: 277 FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336
           FKG+V+ LV AAF++G  EF  +TA+EQ NP+K+I SA+KK++YR + IY+ +  ++GFL
Sbjct: 283 FKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFL 342

Query: 337 VPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396
           VPYNSPELLGS S+ T ASP+VIA+ASHG+++ PH INAVIL+SVLSVANS+ YSSSR+L
Sbjct: 343 VPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRIL 402

Query: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456
           L+L++QG+APK+F Y+DR+GRP+  ++ + +   + F A+SPKE  VF+WLLAISGLS++
Sbjct: 403 LSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSEL 462

Query: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516
           FTW +I LSH+RFRR+M +QGRSL+ELGY+S  GVWG+ YA  ++ LILIGQFWVA+ P+
Sbjct: 463 FTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPV 522

Query: 517 NSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQE 576
            SN  +  NFF+ YLAMPIL+  Y GYK W +DW + I A ++DL+SHR I+D ++++ E
Sbjct: 523 GSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSE 582

Query: 577 KNQYKENLKNGSLWLKIYAFWC 598
           + + KE L++ S   +   FWC
Sbjct: 583 QLEEKEQLRHASWTKRAAEFWC 604

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/589 (50%), Positives = 412/589 (69%), Gaps = 3/589 (0%)

Query: 10  KDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKS 69
            +G+  S +   ++  E+  ++S S  +   + F DSF++ + +N       +E +   +
Sbjct: 13  DNGVVESFDSVEVLKEESPRSDSRSDGL--FRRFADSFRRHEAHNGGGGDGDDEDHEGLT 70

Query: 70  DQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCI 129
              +   +  L++ I+PRHV+MIS               +LHN GPA L+IGY I++S +
Sbjct: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130

Query: 130 YCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTI 189
           YC+IQ+  E+A+ Y +L GGFN YPS LVD A+ F+V+WVYC+QWLCV PLELVTASMTI
Sbjct: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190

Query: 190 KYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXX 249
           KYWN+ ++PD FVTIFY++++AIN F GA GYAEAEFFFN CK+LM              
Sbjct: 191 KYWNQTINPDAFVTIFYVVLVAIN-FVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCG 249

Query: 250 XXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
                GY+G  YW++PGAFRG     RFKGIV+ LV AAF++G  EF  +TA+EQ NP+K
Sbjct: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIA 369
           +I SA+KK++YR L IY+ + I++GFLVP+NS ELLGS  S T ASP+VIAVASHG+R+ 
Sbjct: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369

Query: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429
           PHFINAVIL+SVLSVANS+ YSSSR+LL+L++QG+AP+   Y+DR GRP+  ++ + +  
Sbjct: 370 PHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429

Query: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489
            ++F A+SPKE  VF+WLLAISGLS++FTW +I LSH+R RRAM +QGRS +ELGY +  
Sbjct: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489

Query: 490 GVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKD 549
           GVWG+ YA  ++  IL+GQFWVA+ P+ SN  +  NFF+ YLAMPIL+  Y GYK W +D
Sbjct: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549

Query: 550 WNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           W L I + ++DL++HR I+D +VL+ E+ + KE L++     ++  FWC
Sbjct: 550 WRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/563 (50%), Positives = 389/563 (69%), Gaps = 7/563 (1%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEK--NEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXX 97
           +++F+DSFK+ +        EK  N +  ++++ +N     ++++T++ RH+ MIS    
Sbjct: 35  VRNFMDSFKRAEPQGQTIREEKLENGLETVRTNDYN-ATQKKMKQTMKSRHITMISLGTG 93

Query: 98  XXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFL 157
                       LH  GP GL+IGY+  ++ +YC+IQAC E+ V+Y TL G +N+YPSFL
Sbjct: 94  IGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFL 153

Query: 158 VDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGG 217
           VD+ +NFAVAWVY +QW  V PLELVT+SMTIKYWN+ ++PDVFV IFY  I+ I+ FG 
Sbjct: 154 VDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFG- 212

Query: 218 ARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRF 277
           ++GYAE+EF FN CK+LM                  SGYIG  YW+ PGAF G      F
Sbjct: 213 SQGYAESEFIFNSCKVLMMVGFIIMGISVNCGAS-KSGYIGGKYWHTPGAFVGEKAIDHF 271

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
           KGI S  V +AF++G +EF+A+TA+EQ+NPRK++P A K+ +YR L +++  II+VGFLV
Sbjct: 272 KGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLV 331

Query: 338 PYNSPELLGSKS-SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396
           PY+SP LLGS   + + ASP+VIA ASHG+++ PH INAVILISV+SV NS+FYS+ R+L
Sbjct: 332 PYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRIL 391

Query: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456
           L+LA+QG  PK+FTY+DRKGRPL  ++  ++   I+F A+S  E  VF+WL AI  LSQ+
Sbjct: 392 LSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQL 451

Query: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516
           FTW  I LSHIRFR AMK QGRSL ELGYK+  G WGS YA     ++L  QFWVA+ P+
Sbjct: 452 FTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPI 511

Query: 517 NSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQ 575
            + G  ++ NFF+ YLA P+L+ FYFGYK W +DW LFI A  +DL SHR I+D D++KQ
Sbjct: 512 GNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLESHRKIFDADLIKQ 571

Query: 576 EKNQYKENLKNGSLWLKIYAFWC 598
           E  ++KE ++N S W++   FWC
Sbjct: 572 EDFEHKERIRNSSFWVRALDFWC 594

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/568 (51%), Positives = 404/568 (71%), Gaps = 14/568 (2%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKN-------EINN----IKSDQFNDKLNNQLQKTIQPRH 88
            ++F+DSFK+ +      ++E +       +++N    I SD+   K   +L++ I  RH
Sbjct: 67  FRNFIDSFKRGETTARIADLENDLTTAVSPQLSNYHGSIPSDEVVIK-KEELKRDINQRH 125

Query: 89  VIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIG 148
           ++ ++              +TL++AGPAGLLIGY +M +C+YC+IQA GE+ V Y  LIG
Sbjct: 126 MVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIG 185

Query: 149 GFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLL 208
           GFN YP+ LV  ++ F+V W+Y +QWLC+ PLELVTAS+TIKYW  KVDPDVFV IFYLL
Sbjct: 186 GFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVFVVIFYLL 245

Query: 209 IIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF 268
           I+ IN FG ++GYAEA+FFFN  K+ M                   GY+G  YW+NPGAF
Sbjct: 246 ILLINFFG-SKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAF 304

Query: 269 RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVG 328
           RG      FKG+ S  VT+AF+FG +EF+A++ASEQ+NPRK+IPSAAK ++YR +++Y+ 
Sbjct: 305 RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLT 364

Query: 329 SIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSS 388
           SI I+GFLVP++SP+L  S S   K SPYV+A+A HG+++ PH INAVIL++VLSV+NS+
Sbjct: 365 SITILGFLVPWDSPQLQPS-SDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSVSNSA 423

Query: 389 FYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLL 448
           F+ SSR+LL+L+++GYAPK F Y+DRKGRP+  ++ ++L   I FCA+S KET+VFSWLL
Sbjct: 424 FFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSWLL 483

Query: 449 AISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQ 508
           AISGLS +FT+ +IC+SHIR R AMK+QGRSL ELG++SQVG +GS YA  ++ L L+ +
Sbjct: 484 AISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVLSLMAE 543

Query: 509 FWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIY 568
           FWVAL P+     +  +FF+ YLA PI ++FYFGY  WKKD+ +FIR+KDIDL   R ++
Sbjct: 544 FWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVF 603

Query: 569 DEDVLKQEKNQYKENLKNGSLWLKIYAF 596
           DED++KQE  +Y E ++N   W K+ AF
Sbjct: 604 DEDLIKQEDEEYAEQMRNAPRWRKVIAF 631

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/585 (48%), Positives = 383/585 (65%), Gaps = 19/585 (3%)

Query: 30  NESHSKLIENLKDFVDSFKKIDD-----------NNNQYE----IEKNEINNIKSDQFND 74
           +E  +KL+     FVDSFK+  D           NN   +     E++ ++   SD  + 
Sbjct: 53  SEPRTKLVHR---FVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGSDHDSI 109

Query: 75  KLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQ 134
             N  L+K ++ RHV+M+S                LH  GPA L+IGY++++   Y +IQ
Sbjct: 110 ITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQ 169

Query: 135 ACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNE 194
           A GEMAV Y TL G FN Y S  V  A+ FA  W++CIQWL V PLEL+TAS+TIKYWN+
Sbjct: 170 AAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWND 229

Query: 195 KVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS 254
           K++ DVF+ IFY+ ++ I+LFGG   Y E EF FNLCKILM                   
Sbjct: 230 KINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNR 289

Query: 255 GYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSA 314
            YIG  +W++PGAF G T G+RFKGI   LV+  FS+G TE  A++ +EQSNPR++ P A
Sbjct: 290 EYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTPQA 349

Query: 315 AKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFIN 374
           +K  +YR L IY+ ++I++GF VPY+S EL+GS  S T ASPYV+A + +G++IAPHFIN
Sbjct: 350 SKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHFIN 409

Query: 375 AVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFC 434
           AVILISV+SVANSS Y++ R++ +LA+QGYAPK   Y+DR+GRPL  +IA  L+  I F 
Sbjct: 410 AVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIGFV 469

Query: 435 ASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGS 494
           A+SPKE EVF+WL AI+GLS++FTW +I LSH+RFR AMK+Q RSL ELGYK+  G++GS
Sbjct: 470 AASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIYGS 529

Query: 495 IYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLF 553
           IY      L+   QFW AL+P   +G AN  +FF  YLAMPI L+FYFGY  W +D+ L 
Sbjct: 530 IYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDFQLL 589

Query: 554 IRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
                IDL  HR IYD ++++QE  + KE L+NGS  +++Y FWC
Sbjct: 590 KPLDKIDLDFHRRIYDPELMRQEDEESKERLRNGSFMMRMYHFWC 634

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/561 (51%), Positives = 378/561 (67%), Gaps = 23/561 (4%)

Query: 40  LKDFVDSFKKI-DDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXX 98
            +DFVDSFKK  DD+   Y+ E                +++++KTI+ RH++MIS     
Sbjct: 36  FRDFVDSFKKKQDDDVVGYDEETGT-------------SSKMKKTIKSRHLLMISLGTGI 82

Query: 99  XXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLV 158
                      L  AGP GL+IGY + ++ +YCIIQA GE+ + Y  + G +  Y S LV
Sbjct: 83  GTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLV 142

Query: 159 DTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGA 218
           D A  F+V+WVYCIQW+ V PL+LVTA++TIKYW +  +PD+FV I Y LI+ INLFG A
Sbjct: 143 DPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTD-TNPDIFVAILYFLIVFINLFG-A 200

Query: 219 RGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFK 278
           +GYAEAEF FN CK+LM                   GYIG  YW+ PGAF      T FK
Sbjct: 201 KGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIGARYWHTPGAFS-----TGFK 255

Query: 279 GIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVP 338
           G+      AAF++G  E + +TASEQ NPRK+IPSA KKVIYR L IY+ + +IV FLVP
Sbjct: 256 GVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVP 315

Query: 339 YNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLT 398
           Y++PEL  S  S ++ASP+VIA+ASHGI + PH INAVIL++V+SV NSS YS+ R+LL+
Sbjct: 316 YDAPELT-STGSASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLS 374

Query: 399 LAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFT 458
           L++QGYAPK+F Y+DR+GRPL   + A  +  +AF A+S  E +VFSWLLAISGLSQ+F 
Sbjct: 375 LSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFI 434

Query: 459 WGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNS 518
           W +ICLSH+RFR AMK QGRSL E+GYKSQ G WGS +A  V   +L+ QFWVA+ P+ +
Sbjct: 435 WISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGN 494

Query: 519 NGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEK 577
            G  +  +FF+ YLA P+L+  YFGYK + KDW L I A ++DL SHR I+DED LKQE 
Sbjct: 495 GGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQED 554

Query: 578 NQYKENLKNGSLWLKIYAFWC 598
             +KE ++  S+W+KIY FWC
Sbjct: 555 LDWKEKMRTASIWVKIYHFWC 575

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/565 (50%), Positives = 384/565 (67%), Gaps = 12/565 (2%)

Query: 38  ENLKDFVDSFKKIDDN--NNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXX 95
             L +F +SFK+ + +  +   ++E   IN+++S       N++ +++++ RHV+M+S  
Sbjct: 45  RKLHNFCNSFKRANSDTFDASQDLEGASINSVRS-------NSKFKQSMKSRHVVMMSLG 97

Query: 96  XXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPS 155
                        +LH  GPAGLLIGY +++   Y ++QA GEMAV Y TL G FN Y S
Sbjct: 98  TGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSS 157

Query: 156 FLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLF 215
             +  ++ FA  W+YC+QWL V PLEL+TAS+TIKYWN  ++PD F+ IFY +I+ I+ F
Sbjct: 158 IFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFF 217

Query: 216 GGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT 275
           G A GY EAEF F+ CK+ M                 T GYIG  YW NPGAF G +P  
Sbjct: 218 GAA-GYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSPIG 276

Query: 276 RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGF 335
            FKGI   LVTA FS+G  E  A+T +EQ+NPRKA+PSA KK IYR L IY+ ++I++GF
Sbjct: 277 HFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGF 336

Query: 336 LVPYNSPELLGSKS-SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSR 394
           LVPYNS EL+GS   S T ASPYVIAVASHG+++ PH INAVILISV+SV NS+ YS+ R
Sbjct: 337 LVPYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPR 396

Query: 395 MLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLS 454
           +L +LA+QGYAPKIF+Y+DR GRPL  ++  S+   ++F A+S KE +VF+WL AI+GLS
Sbjct: 397 LLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLS 456

Query: 455 QVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALW 514
           ++FTW  ICLSH+RFR AMK QG SL+ELGYKS+ G WGSIYA     ++ + QFWVAL 
Sbjct: 457 ELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALA 516

Query: 515 PLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVL 573
           P+ + G A+   FF+ YLA PI +  Y GYK + K+W L +   +IDL SHRHI+D+ +L
Sbjct: 517 PIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHIL 576

Query: 574 KQEKNQYKENLKNGSLWLKIYAFWC 598
           +QE +++KE LKN   W+K+  FWC
Sbjct: 577 QQEDDEHKEKLKNSGWWVKMANFWC 601

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/579 (48%), Positives = 383/579 (66%), Gaps = 17/579 (2%)

Query: 22  IVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQ 81
           I+   +  ++ +S +   +  F++SF++        + E  ++  +K +        +++
Sbjct: 20  IIQTSSPCSKKYSYISGQVNRFINSFRR--------KGESEDVKELKGENEECGAATKMK 71

Query: 82  KTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAV 141
           K+I+ RH++MIS                L  AGPAGL+IGY + +  +YCIIQA GE+ +
Sbjct: 72  KSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGELGI 131

Query: 142 NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVF 201
            Y  + G +  Y S LVD A  F+V+WVYC+QW+ V PL+LVTA+MT++YW    +PD+F
Sbjct: 132 CYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWT-NANPDIF 190

Query: 202 VTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSY 261
           V +F+++I+ IN+FG A+GYAEAEF FN+CK+LM                 TSGYIG  Y
Sbjct: 191 VAVFFVVIMVINMFG-AKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGAKY 249

Query: 262 WNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 321
           W++PG+F        FKG+      AAFS+G  E + +TASEQ NPRK+IP+A KKVIYR
Sbjct: 250 WHSPGSF-----AAGFKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNACKKVIYR 304

Query: 322 ALFIYVGSIIIVGFLVPYNSPELLGSKS-SQTKASPYVIAVASHGIRIAPHFINAVILIS 380
            L IY+ + IIV FLVPYNS EL+GS   S + ASP VIAVASHG++I PH INAVILIS
Sbjct: 305 ILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHIINAVILIS 364

Query: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440
           V+SV NSS YS+ R+LL+L++QGYAPK   Y+DR+GRPL       L+A IAF A+S  E
Sbjct: 365 VISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAFVAASDAE 424

Query: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500
            ++F+WLLAISGLSQ+F W +ICLSH+RFR AM  QG SL ++GYKSQ G WGS +A  +
Sbjct: 425 EDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVI 484

Query: 501 MFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDI 559
             L+LI QFWVA+ P+   G  N   FF+ YLA PILL  YFGYK + KDW L I A ++
Sbjct: 485 SVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRLCIPASEV 544

Query: 560 DLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           DL SHR+I DE++L+QE  ++ E + N S+W+++  FWC
Sbjct: 545 DLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRLCHFWC 583

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/581 (47%), Positives = 383/581 (65%), Gaps = 21/581 (3%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN 77
           +++ +  + N +     +    ++ F+DSF++  D +             K+D   D   
Sbjct: 14  DESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLM----------CKADA-EDGTT 62

Query: 78  NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
            +++KTI+ RH++MI+              + L  AGPAGL++GY++ ++ +Y I++A G
Sbjct: 63  AKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAG 122

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           E+ + Y  + G +  Y S LVD A  F+V+WVYCIQW+ V PL+LVTA+M I+YW + ++
Sbjct: 123 ELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD-IN 181

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYI 257
           PD+FV I Y +I+ INLFG A+GYAEAEFFFNLCK+LM                 TSGYI
Sbjct: 182 PDIFVAIIYAVIVFINLFG-AKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYI 240

Query: 258 GVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKK 317
           G  YW+ P  F        FKG+      AAF++G  E + ++ASEQ NPRK+I SA KK
Sbjct: 241 GDKYWHEPRPFM-----NGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKK 295

Query: 318 VIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVI 377
           VIYR + IY+ + +IV FLVP + P L    S  ++ASP VIAV+ HG++I PH INAVI
Sbjct: 296 VIYRIVLIYLLTTVIVCFLVPADHPSL---ASEGSRASPLVIAVSFHGVKIVPHIINAVI 352

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           LI+V+SV NSS YS+ R+LL+LA+QGYAPKIFTY+DR+GRPL     A +   +AF A+S
Sbjct: 353 LIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAAS 412

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
           P + +VF WLLAISGLSQ+F W +IC+SHIRFR AMK QGRS+ E+GYK++ G WGS  A
Sbjct: 413 PAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIA 472

Query: 498 ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAK 557
               FLILI QFWVA+ P+ + G +  +FF+ YLA PILLL YFGYK + KDW + I A 
Sbjct: 473 VVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPAS 532

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           ++DLISHR ++DED LKQE  ++K  LK+  +W++IY FWC
Sbjct: 533 EVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/580 (48%), Positives = 375/580 (64%), Gaps = 10/580 (1%)

Query: 20  NVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ 79
           NV    E   + +  K   +   FVDSFK+ + N+N  ++E +  N+I+SD       + 
Sbjct: 25  NVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLE-DGTNSIQSD-------DN 76

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           L+K ++ RHVIM+S                L+ AGPA L+IGY +++   Y +IQA GEM
Sbjct: 77  LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEM 136

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPD 199
           AV Y TL GGFNNY S  V   + FA  W++CIQWL V PLEL+TASMTIKYWN+K++ D
Sbjct: 137 AVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINAD 196

Query: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGV 259
           VFV I Y+ ++ I+ FG  R Y EAEF FN CKILM                   GYIG 
Sbjct: 197 VFVVILYVFLLFIHFFG-VRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGG 255

Query: 260 SYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
            YW +PGAF      +RFKG+   LVTA FS+G  E  A++ +EQ NPR++ P+AAK+ I
Sbjct: 256 KYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSI 315

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILI 379
           YR L IY+ ++I++GF VP+NS +L+G+  S T ASPYV+AV+ HG+++ PH INAVILI
Sbjct: 316 YRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILI 375

Query: 380 SVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPK 439
           SV SVANS+ Y+S R+L +LA+QGYAPK F Y+DR+GRPL  +I  S+   IAFCA S +
Sbjct: 376 SVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQ 435

Query: 440 ETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT 499
           E  +F+WL AI+GLS++FTW +I LSH+RFR AMK QG+SLNELGY S  G+WGS+Y   
Sbjct: 436 EEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCF 495

Query: 500 VMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
              L+ I QFWVAL P  S G  +   FF+ YLA P+ L FY GY  + +D+      K 
Sbjct: 496 FNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKK 555

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           IDL +HR +YD ++L+QE  + KE ++NG    K+  FWC
Sbjct: 556 IDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/598 (46%), Positives = 383/598 (64%), Gaps = 12/598 (2%)

Query: 6   PSITKDGLHLSVNKNVIVT-NENQINESHSKLIENLKDFVDSFKKIDD---NNNQYEIEK 61
           P  TK   + S   + IV+ N    +  +SK     ++F+DS+K+ D    +N + E  +
Sbjct: 6   PKETKSPSYASSEHSSIVSANSYNSSAGNSKTRGYFRNFIDSYKRADPSQLHNARSEDVE 65

Query: 62  NEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIG 121
           + I +I+SD        Q +K++  RHVIM+S                L+  GP  L+IG
Sbjct: 66  DGIASIRSD-------TQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIG 118

Query: 122 YIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLE 181
           Y++++   Y +IQA GEMAV Y TL G FN Y S  +  +W FA  W++CIQWL V PLE
Sbjct: 119 YVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLE 178

Query: 182 LVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXX 241
           L+T+S+TIKYWN+K++ D+FV IFY+ ++AI+L GG R Y E EF FN CKILM      
Sbjct: 179 LITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFII 238

Query: 242 XXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITA 301
                        GYIG  YW+ PG+F      +RFKGI   LV+  FS+G TE   ++ 
Sbjct: 239 LSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATSRFKGICLVLVSGYFSYGGTELYVLSV 298

Query: 302 SEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAV 361
           +EQ+ PRKA P+AAKK IYR L IY+ ++I++GF VP+N+ +L+G+  S T ASPYV+A 
Sbjct: 299 NEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAA 358

Query: 362 ASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFG 421
             HG++I PHFINAVILISV+SVANSS ++  R+L +LA QGYAPKI +Y+DR+GRPL  
Sbjct: 359 TIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVA 418

Query: 422 IIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLN 481
           +  + L+  IAF + +  E EVF+WL AI+GLS++FTW  I  SH+RFR AMK+QG+ +N
Sbjct: 419 LGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDIN 478

Query: 482 ELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFY 540
           ELGYK+  GVWGS Y A    L+LI QFWVAL P+ + G  +   FF+ YLA PI +  Y
Sbjct: 479 ELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACY 538

Query: 541 FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           FGY  + KD+ L      IDL S+R IYD +++KQE  + KENLK+  L+ KIY FWC
Sbjct: 539 FGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSRPLYYKIYRFWC 596

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/558 (48%), Positives = 376/558 (67%), Gaps = 10/558 (1%)

Query: 43  FVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXX 102
           F DSFK+   +         ++    +D   +K    L+  I+ RH+ MIS         
Sbjct: 37  FTDSFKRAQVDT------AVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGL 90

Query: 103 XXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAW 162
                  LH  GPAGL+IGY+  ++ +YC++QAC E+ V Y TL G +N YP+FLVD  +
Sbjct: 91  LVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGF 150

Query: 163 NFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYA 222
            FAVA VY +QW  V PLELVTASMT+KYW   V+PDVFV IFY+ ++ I+ FG +RGYA
Sbjct: 151 GFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFG-SRGYA 209

Query: 223 EAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVS 282
           EAEF FN  K+L+                   GYIG  YW++PGAF G     RFKGI S
Sbjct: 210 EAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFKGICS 268

Query: 283 TLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSP 342
             V AAF++G +EF+A+TA+EQ+NPR+++P A K+ +YR + +++  +I++GFLVP+NS 
Sbjct: 269 VWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSD 328

Query: 343 ELLGSKS-SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAK 401
           +LL ++  S ++ASP+VIA A HG+R+ PH IN +IL SV+SV NS+ YS+ R+LL+LA+
Sbjct: 329 QLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAE 388

Query: 402 QGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGT 461
            G  PKIFTY+DR+GRPL  +I  SL   IAF A+S +E  VF+WL AI+GLSQ+FTW  
Sbjct: 389 HGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTA 448

Query: 462 ICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA 521
           I +SH+RFRRAM++QGRSL ELGY++  G  GS YA     ++LI QFW+A+ P+  +G 
Sbjct: 449 IAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGE 508

Query: 522 -NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQY 580
            ++  FF+ YLA P+L++FY GYK WK+D+ L I + ++DL+SHR I+DE+VL QE+ + 
Sbjct: 509 LDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAER 568

Query: 581 KENLKNGSLWLKIYAFWC 598
           KE L+N +L+ ++  FWC
Sbjct: 569 KERLRNSTLFKRLLDFWC 586

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/576 (46%), Positives = 374/576 (64%), Gaps = 2/576 (0%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           ++E   ++  S   + +  F DSFK+ + +  + +      ++++    +   +++L+K+
Sbjct: 35  SSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKS 94

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           ++ RHV+M+S                LH  GPA L+IGYI+++   Y +IQA GEMAV Y
Sbjct: 95  MKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTY 154

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
            TL   FN Y S  +  ++ FA  W+YC QWL V PLEL+TASMTI++WN+K++PD+++ 
Sbjct: 155 PTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYIL 214

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IFY+ ++ I+ FG  + Y E EF FN CKILM                   GYIG +YW+
Sbjct: 215 IFYVFLVFIHFFG-VKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWH 273

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           NPGAF G T   RFK +   LVTA FSFG  E  A++  EQSNPRK+ P AAK+ IYR +
Sbjct: 274 NPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIV 333

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLS 383
            IY+ ++I++GF VPYN  +L+G+  S T ASPYV+A + HG++I PH INAVILISV+S
Sbjct: 334 VIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVS 393

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
           VANSS Y+  R++ +LA+QGYAPK   Y+DR+GRPL  +I   +   IAF A+S KE  V
Sbjct: 394 VANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIV 453

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F+WL AI+GLS++FTW +I LSH+RFR+AMK+QGRSL+ELGYK+  G+WGSIY      L
Sbjct: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNIL 513

Query: 504 ILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562
           + + QFWVAL PL + G  +  +FF+ YLA PI L FYFGY  + +D+ L      IDL 
Sbjct: 514 VFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLD 573

Query: 563 SHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            HR IYD ++++QE  + KE L+N SL  K Y FWC
Sbjct: 574 FHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFWC 609

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/610 (45%), Positives = 381/610 (62%), Gaps = 23/610 (3%)

Query: 5   SPSITKDGLHLSVNKNVIVTNEN-QINESHSKLIENLKD---------------FVDSFK 48
           SPS   + +H  +  +        Q    HS+ +ENL                 F+DSFK
Sbjct: 15  SPSSDTNEIHNRLGASSTTDKAKLQNGMEHSEKLENLASSTALDEAPRTGLVHRFMDSFK 74

Query: 49  KIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXA 108
           + D     ++      N+++S   +    + L+K+++ RHV+M++              +
Sbjct: 75  RADGQRAGFDD-----NDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANAS 129

Query: 109 TLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAW 168
            LH +GPA L++ Y +++   Y +IQA GEMAV Y TL G FN+Y S  V   + FA  W
Sbjct: 130 GLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVW 189

Query: 169 VYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFF 228
           ++ +QWL V PLEL+T+S+TIKYWN+K++ DVFV IFY+ ++ I+ FG  + Y E EF F
Sbjct: 190 LFLLQWLTVLPLELITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFG-VQAYGETEFIF 248

Query: 229 NLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAA 288
           N CKILM                   GYIG  YW++PGAF  HT   RFKGI   LVTA 
Sbjct: 249 NSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAFTSHTNIGRFKGICFILVTAY 308

Query: 289 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK 348
           FS+G TE   ++ +EQ NPRK+ P AAK+ IYR + IY+ ++I++GF VP+++ +L+GS 
Sbjct: 309 FSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSH 368

Query: 349 SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKI 408
            S T ASPYV+A + HG+RI PHFINAVILISV+SVANSS Y+S R+L +LA+QGYAPK 
Sbjct: 369 GSATHASPYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKF 428

Query: 409 FTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIR 468
            TY+DR+GRPL  +   SL   I F A+S +E +VF+WL AI+GLS++FTW  I LSH+R
Sbjct: 429 LTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVR 488

Query: 469 FRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFK 528
           FR+AMK+QGR LNELGYK+  GVWGS+Y      L+   QFWVAL P  S    ++ FF+
Sbjct: 489 FRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALS-FFE 547

Query: 529 EYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGS 588
            YLA PI   FYFGY  W KD+   I  + IDL  HR +YD + ++QE+ + K  LKN S
Sbjct: 548 SYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNSS 607

Query: 589 LWLKIYAFWC 598
           +W ++Y FWC
Sbjct: 608 IWTRMYYFWC 617

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/559 (48%), Positives = 362/559 (64%), Gaps = 4/559 (0%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXX 99
            + FVDSFK  +DN +  E++ +   N     ++   +  L+K ++ RHVIM++      
Sbjct: 53  FRRFVDSFKPAEDNKHS-EVDSDVERN-GDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIG 110

Query: 100 XXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVD 159
                     LH  GPA L+IGY +++   Y +IQA GEMAV Y TL G FN Y S  V 
Sbjct: 111 TGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVS 170

Query: 160 TAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGAR 219
             + FA  W++CIQWL V PLEL+TAS+ IKYW EKV+ DVFV IFY+ ++ I+ F G +
Sbjct: 171 KPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIH-FIGVK 229

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
            Y E EF FNLCKILM                   GYIG  YW++PGAF G     RFKG
Sbjct: 230 AYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFAGTNAAERFKG 289

Query: 280 IVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339
           +   LV+  FS+G TE   ++ +EQ NPRK+ P AAK+ IYR L IY+ ++I++GF VP+
Sbjct: 290 VCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPF 349

Query: 340 NSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
           N  +L+G+  S T ASPYV+A + HG+R+ PH INAVILI+V+SVANSS Y++ R+L +L
Sbjct: 350 NDDQLMGAGGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSL 409

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           A+QGYAPK  TY+DR+GRPL+ ++A ++   IAF A S +E +VF+WL AI+GLS++FTW
Sbjct: 410 AEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTW 469

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
            +I LSH+RFR+AMK+QGR LNE+GY +  G WGS+Y      L+ I QFWVAL P  S 
Sbjct: 470 SSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSP 529

Query: 520 GANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
                +FF+ YLA PI + FYFGY  W KD+        IDL  HR IYD +VLKQE  +
Sbjct: 530 -ITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDME 588

Query: 580 YKENLKNGSLWLKIYAFWC 598
            KE ++NG++W K+  FWC
Sbjct: 589 NKERVRNGNIWTKLKWFWC 607

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/563 (47%), Positives = 365/563 (64%), Gaps = 14/563 (2%)

Query: 38  ENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXX 97
            +L+ F+DSFK+ DD+ +  ++EK               + + +KT++ RHVIM+S    
Sbjct: 62  RHLQGFIDSFKRADDSPDHNDLEKTT-----------TAHQEQKKTMKSRHVIMMSLGTG 110

Query: 98  XXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFL 157
                       L  AGPA L+I Y +++   Y +IQA GEMAV Y TL G FN Y SF 
Sbjct: 111 IGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFF 170

Query: 158 VDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGG 217
           +   + FA  W++CIQWL V PLEL+TA+MTIKYWN  +DPDVFV IFY+ ++ I+ FG 
Sbjct: 171 ISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFG- 229

Query: 218 ARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRF 277
            + Y E EF FN CKILM                   GYIG  YW++PGAF      +RF
Sbjct: 230 VQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRF 289

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
           KGI   LV A FS+G  E   ++ ++Q NPRK+ P+AAK  +YR + IY+ ++I++GF+V
Sbjct: 290 KGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV 349

Query: 338 PYNSPELLG-SKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396
           P+NS ELLG S  +   ASPYV+A + HGI++ PH INAVILI+++SVANSS Y+  R+L
Sbjct: 350 PHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409

Query: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456
            +LA+QGYAP+  +Y+DR+GRPL  ++ ++L+  I F A+SP+E EVF+WL AISGLS++
Sbjct: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469

Query: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516
           FTW +I  SHIRFRRAMK+Q +SL+ LGYK+  G+WGS +      L+   QFWVAL P 
Sbjct: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529

Query: 517 NSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQ 575
           NS G  +  +FF  YLAMPI L+FYFGY  W KD+ +      +DL +HR +YD + L+Q
Sbjct: 530 NSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQ 589

Query: 576 EKNQYKENLKNGSLWLKIYAFWC 598
           E  + KE L+N S  +KIY FWC
Sbjct: 590 EDLENKERLRNSSFLVKIYEFWC 612

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/567 (46%), Positives = 364/567 (64%), Gaps = 5/567 (0%)

Query: 33  HSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMI 92
           ++KLI     FVDSFK+ + +    +      ++++ D  +   +++L+K+++ RHV+M+
Sbjct: 47  NNKLIHR---FVDSFKRAEGSTTHTKQINENTSDLEGDVNSFTSDSKLKKSMKSRHVVMM 103

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           +                LH  GPA L+IGY +++   Y +IQA GEMAV Y TL   FN 
Sbjct: 104 TLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNA 163

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAI 212
           Y S  +   + FA  WVYC QWL V PLEL+TA+MTIK+WN+ ++PD+F+ IF++ ++ I
Sbjct: 164 YSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFI 223

Query: 213 NLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHT 272
           + FG  +GY E EF FN CKILM                   GYIG  YW NPGAF G T
Sbjct: 224 HFFG-VKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAFAGDT 282

Query: 273 PGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIII 332
              RFK +   LVTA FSFG  E  A++  EQ+NPRK  P AAK+ IYR L IY+ ++I+
Sbjct: 283 SAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMIL 342

Query: 333 VGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSS 392
           +GF VPYN  +L+G+  S T ASPYV+A + HG+++ PH INAVILISV+SVANSS Y+ 
Sbjct: 343 IGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAG 402

Query: 393 SRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISG 452
            R++ +LA+QGY PK   Y+DR+GRPL  +I  S+   I F A+S KE  VF+WL AI+G
Sbjct: 403 PRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAG 462

Query: 453 LSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVA 512
           LS++FTW +I LSH+RFR+AMK+QGRSL+ELGYK+  G+WGS Y      L+ I QFWVA
Sbjct: 463 LSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVA 522

Query: 513 LWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDED 571
           L PLN+ G  +  +FF+ YLA PI + FY GY  + +D+        IDL  HRHIYD +
Sbjct: 523 LAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPE 582

Query: 572 VLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +++QE  + +E  ++ SL  K Y FWC
Sbjct: 583 LMRQEDLENEERKRDMSLMRKTYHFWC 609

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/569 (46%), Positives = 367/569 (64%), Gaps = 9/569 (1%)

Query: 31  ESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVI 90
           +S  K   +   FVDSF++ +D +   ++E     +I SD      ++ ++K ++ RHVI
Sbjct: 36  DSTLKRRTHFTKFVDSFRRAEDKHADSDLEDGS-KSITSD------DDHMKKAMKSRHVI 88

Query: 91  MISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGF 150
           M++                L  AGPA L++GY +++   Y +IQA GEMAV Y T+   F
Sbjct: 89  MMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASF 148

Query: 151 NNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLII 210
           N Y S  V   + FA  W++CIQWL V PLEL+TASMTIKYWN+ ++PDVF+ IFY+ ++
Sbjct: 149 NTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLL 208

Query: 211 AINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRG 270
            I+ FG  + Y E EF FN CKILM                   GYIG  YW NPGAF  
Sbjct: 209 FIHFFG-VKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFAS 267

Query: 271 HTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSI 330
            +P  RFKG+   LVT  FS+G TE  +++ +EQ NPRK+ P+AAK+ IYR L IY+ ++
Sbjct: 268 ESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTM 327

Query: 331 IIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFY 390
           I++GF VP++S +L+G+  S T ASPYV+A + HG+++ PHFINAVILISV+SVANS+ Y
Sbjct: 328 ILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALY 387

Query: 391 SSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAI 450
           +S R++ +LA+QGYAPK F Y+DR+GRPL  +    L   I F A SP+E + F+WL AI
Sbjct: 388 ASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAI 447

Query: 451 SGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFW 510
           +GLS++FTW +I +SHIRFR AMK+QG+SL ELGY++  G+WGS+Y+     L+ I QFW
Sbjct: 448 AGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFW 507

Query: 511 VALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYD 569
           VAL P  SNG  +   FF+ YLA P+ L+FYFGY  + +D+        IDL  HR IYD
Sbjct: 508 VALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYD 567

Query: 570 EDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            ++L+QE  + KE L+N     ++ +FWC
Sbjct: 568 PELLRQEDAETKERLRNSGWLARLRSFWC 596

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/576 (46%), Positives = 369/576 (64%), Gaps = 2/576 (0%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           +NE   +E   K    +  F DSFK+ + +  + +      ++++    +   +++L+K+
Sbjct: 35  SNEKIYSEQKPKRNRLIHRFTDSFKRAEGSTTKIKPINENTSDLEDGIQSFTSDSKLKKS 94

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           ++ RHV+M+S                LH  GPA L+IGY++++   Y +IQA GEMAV Y
Sbjct: 95  MKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTY 154

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
            TL   FN Y S  +   + FA  W+YC QW  V PLEL+TASMTI++WN+K++PD+++ 
Sbjct: 155 PTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYIL 214

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IFY+ ++ ++ FG  + Y E EF FN CKILM                   GYIG +YW+
Sbjct: 215 IFYVFLLFVHFFG-VKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWH 273

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
            PGAF G T   RFK +   LVTA FSFG  E   ++  EQ+NPRK+ P AAK+ IYR +
Sbjct: 274 KPGAFAGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIV 333

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLS 383
            IY+ ++I++GF VPYN  +LLG+  S T ASPYV+A + HG+RI PH INAVILISV+S
Sbjct: 334 VIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVS 393

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
           VANSS Y+  R++ +LA+QGYAPK   Y+DR+GRPL  +I   ++  IAF A+S KE  V
Sbjct: 394 VANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIV 453

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F+WL AI+GLS++FTW +I LSH+RFR+AMK+QGRSLNELGYK+  G+WGSIY +    L
Sbjct: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNIL 513

Query: 504 ILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562
           + I QFWVAL PL + G  N   FF+ YLA PI L+FY GY  + +D+ L      IDL 
Sbjct: 514 VFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLD 573

Query: 563 SHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            HR +YD ++++QE  + KE +KN S   K + FWC
Sbjct: 574 FHRRVYDPELMRQEDEENKEKIKNMSFLSKAHHFWC 609

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/581 (45%), Positives = 375/581 (64%), Gaps = 12/581 (2%)

Query: 19  KNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78
           K +     + +  S S L+     FVDSF++ +      E+E+N++ +            
Sbjct: 2   KTLQSPRSDDVEISKSNLVHR---FVDSFRRAESP----ELEENDLEDGTRSIVT---KT 51

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            L+K ++ RHV+M+S                L+ +GPA L+IGY++++   Y +IQA GE
Sbjct: 52  HLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGE 111

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           MAV Y TL G FN+Y S  +   + FA  W++ IQWL V PLEL+TAS+T+KYWN+K++ 
Sbjct: 112 MAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINA 171

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
           DVF+ IFY  ++ I+ FG  + Y E EF FN CK+LM                 T GYIG
Sbjct: 172 DVFIIIFYAFLLFIHFFG-VKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIG 230

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YW++PG+F    P TRFKG+   LV+A FS+G  E  +++ +EQ NPRK+ P+AAK+ 
Sbjct: 231 AKYWHDPGSFADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQS 290

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
           IYR L IY+ ++I++GF VP+NS EL+G+ S+ T ASPYV+A + H +++ PHFINAVIL
Sbjct: 291 IYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVIL 350

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
           ISV+SVANS+ Y++ R++ +LA+QGYAPK   Y+DR+GRPL G+I  +L   I F ++S 
Sbjct: 351 ISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASS 410

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
           KE EVF+WL AI+GLS++FTW  I LSHIRFR+AMK  G+S +E+G+K+  G+WGS Y  
Sbjct: 411 KEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGC 470

Query: 499 TVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAK 557
               L+ I QFWVAL P  S G  +   FF+ YLA PI L+FYFGY  +K+D+ +    +
Sbjct: 471 AFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLE 530

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            IDL  HR IYD D +KQE  + KE LKN S+W +IY +WC
Sbjct: 531 KIDLDFHRRIYDPDFIKQEDEENKERLKNSSIWARIYHWWC 571

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/590 (46%), Positives = 376/590 (63%), Gaps = 18/590 (3%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDD--------NNNQYEIEKNEINNIKS 69
           N   I + E   +   SK  + +    +SFK+ +         N N  ++E + I +I S
Sbjct: 29  NDFQISSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINENTSDLE-DGIESITS 87

Query: 70  DQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCI 129
           D       ++L+K+++ RHV+M+S                LH  GPA L+IGY++++   
Sbjct: 88  D-------SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVT 140

Query: 130 YCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTI 189
           Y +IQA GEMAV Y TL   FN Y S  +   + FA  W+YC QWL V PLEL+TASMTI
Sbjct: 141 YFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTI 200

Query: 190 KYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXX 249
           +YWN+K++PDV++ IFY+ ++ I++FG  + Y E EF FN CKILM              
Sbjct: 201 QYWNDKLNPDVYILIFYIFLLFIHVFG-VKAYGETEFIFNCCKILMIAGFIILSVVINCG 259

Query: 250 XXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
                GYIG +YW+NPGAF G T   RFK +   LVT  FSFG  E  A++  EQSNPRK
Sbjct: 260 GAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRK 319

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIA 369
           + P AAK+ IYR + IY+ ++I++GF VPYN  +L+G+  S T ASPYV+A + HG++I 
Sbjct: 320 STPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIV 379

Query: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429
           PH INAVILISV+SVANSS Y+  R++ +L++QGYAPK   Y+DR+GRPL  +I   +  
Sbjct: 380 PHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFG 439

Query: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489
            IAF A+S KE  VF+WL AI+GLS++FTW +I LSH+RFR+AMK+QGRSL+ELGYK+  
Sbjct: 440 VIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATT 499

Query: 490 GVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKK 548
           G+WGS+Y      L+ I QFWVAL PL ++G  ++ +FF+ YLA PI L F+FGY  + +
Sbjct: 500 GIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNR 559

Query: 549 DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           D+ L      IDL  HR IYD ++++QE  + +E  KN SL  K Y FWC
Sbjct: 560 DFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLMRKAYHFWC 609

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/594 (44%), Positives = 379/594 (63%), Gaps = 11/594 (1%)

Query: 8   ITKDGLHLSVNKNVIVTNENQINESHSKLIEN--LKDFVDSFKKIDDNNNQYEIEKNEIN 65
           +T   L+ + N +   +   +I E HS+   N  +  FVDSF++ +    +      E N
Sbjct: 19  VTDSALYNNFNTSTTASLTPEIKE-HSEESRNGLVHRFVDSFRRAESQRLE------EDN 71

Query: 66  NIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIM 125
           +++    + K NN L+K+++ RHV+M+S                L  AGP  L+IGY+++
Sbjct: 72  DLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMV 131

Query: 126 ASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTA 185
           +   Y ++QA GEM V Y TL G FN Y S  +  ++ FA  W++CIQWL V PLEL+T+
Sbjct: 132 SFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITS 191

Query: 186 SMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXX 245
           SMT+KYWN+ ++ DVF+ IFY+ ++ I+ FG  + Y E EF FN CKILM          
Sbjct: 192 SMTVKYWNDTINADVFIVIFYVFLLFIHFFG-VKAYGETEFIFNSCKILMVAGFIILSVV 250

Query: 246 XXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQS 305
                    GYIG  YW +PG+F   +  TRFKGI   LV+A FSFG  E   ++ +EQS
Sbjct: 251 INCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQS 310

Query: 306 NPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHG 365
           NPRK+ P AAK+ +YR L IY+ ++I++GF VP+N+ +L+GS  S T ASPYV+A + H 
Sbjct: 311 NPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHK 370

Query: 366 IRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAA 425
           +R+ PH INAVILISV+SVANS+ Y++ R++ +LA+QGYAPK   Y+DR+GRPL  ++  
Sbjct: 371 VRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVC 430

Query: 426 SLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGY 485
           SL+  + F A SP+E + F+WL AI+GLS++FTW  I LSHIRFR+AMK+QGRSL+E+GY
Sbjct: 431 SLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGY 490

Query: 486 KSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYK 544
           K+  G+WGS Y      L+ + QFWVAL P+ + G  +   FF+ YLA P+ +  Y GY 
Sbjct: 491 KANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYM 550

Query: 545 TWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            +K+D+        IDL  HR +YD ++++QE  + KE LKN S+++++Y FWC
Sbjct: 551 VYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRVYKFWC 604

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/595 (44%), Positives = 378/595 (63%), Gaps = 11/595 (1%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIEN--LKDFVDSFKKIDDNNNQYEIEKNEI 64
            +T   L+ + N +   +   ++ E HS+   N  +  FVDSFK+ +  + +      + 
Sbjct: 18  EVTDSALYNNFNTSTTASLSQEVKE-HSEESRNGLVHRFVDSFKRAESQHLE------DD 70

Query: 65  NNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYII 124
           N+++    + K NN+L+K+++ RHV+M+S                L  AGP  L+IGY++
Sbjct: 71  NDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVM 130

Query: 125 MASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVT 184
           ++   Y ++QA GEM V Y TL G FN Y S  +  ++ FA  W++CIQWL V PLEL+T
Sbjct: 131 VSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELIT 190

Query: 185 ASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXX 244
           +SMTIKYWN+K++ DVF+ IFY+ ++ I+ FG  + Y E EF F+ CKILM         
Sbjct: 191 SSMTIKYWNDKINSDVFIVIFYVFLLFIHFFG-VKAYGETEFIFSSCKILMIAGFIILSV 249

Query: 245 XXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQ 304
                     GYIG  YW +PG+F      TRFKGI   LVTA FSFG  E   ++ +EQ
Sbjct: 250 VINCGGAGVDGYIGGKYWRDPGSFAEGNGATRFKGICFILVTAYFSFGGIELFVLSINEQ 309

Query: 305 SNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASH 364
           SNPRK+ P AAK+ +YR L IY+ ++I++GF VP+N+ +L+GS S+ T ASPYV+A + H
Sbjct: 310 SNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIH 369

Query: 365 GIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIA 424
            +R+ PH INAVILISV+SVANS+ Y++ R++ +LA+QGYAPK   Y+DR+GRPL  +  
Sbjct: 370 KVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFV 429

Query: 425 ASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELG 484
             L+  I F A SP+E + F+WL AI+GLS++FTW  I LSHIRFR+AMK+QGRSL+E+G
Sbjct: 430 CCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVG 489

Query: 485 YKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGY 543
           YK+  G+WGS Y      L+ + QFWVAL P+ + G  N   FF+ YLA P+ L  Y GY
Sbjct: 490 YKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGY 549

Query: 544 KTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
             +++D+        IDL  HR +YD ++++QE  + KE LKN S + +IY FWC
Sbjct: 550 MLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEENKERLKNSSFFFRIYNFWC 604

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/596 (44%), Positives = 378/596 (63%), Gaps = 11/596 (1%)

Query: 4   LSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNE 63
           ++ S  +D  + S   +     +    ES S L+     FVDSF++ +       +E + 
Sbjct: 19  VTDSALRDNFNTSTAASFSPEVKEHSEESRSGLVHR---FVDSFRRAESQ----RLEDD- 70

Query: 64  INNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYI 123
            N+++    + + NN L+K+++ RHV+M+S                L  AGP  L+IGY+
Sbjct: 71  -NDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYV 129

Query: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183
           +++   Y ++QA GEM V Y TL G FN Y S  V  ++ FA  W++CIQWL V PLEL+
Sbjct: 130 LVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELI 189

Query: 184 TASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXX 243
           T+SMTIKYWN+ ++ DVF+ IFY+ ++ I+ FG  + Y E EF FN CKILM        
Sbjct: 190 TSSMTIKYWNDTINADVFIAIFYVFLLFIHFFG-VKAYGETEFIFNSCKILMIAGFIILS 248

Query: 244 XXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASE 303
                      GYIG  YW NPG+F   +  TRFKGI   LVTA FSFG  E   ++ +E
Sbjct: 249 VIINCGGAGVDGYIGGEYWRNPGSFADGSSATRFKGICFILVTAYFSFGGIELFVLSINE 308

Query: 304 QSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVAS 363
           Q+NPRK+ P AAK+ IYR L IY+ ++I++GF VP+++ +L+GS SS T ASPYV+A + 
Sbjct: 309 QANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASI 368

Query: 364 HGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGII 423
           HG+++ PH INAVILISV+SVANS+ Y++ R++ +LA+QGYAPK   Y+DR+GRPL  ++
Sbjct: 369 HGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALV 428

Query: 424 AASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNEL 483
             S +  + F A S +E + F+WL AI+GLS++FTW  I LSHIRFR+AMK+QGRSL+E+
Sbjct: 429 VCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEV 488

Query: 484 GYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFG 542
           GYKS  G+WGS Y      L+ + QFWVAL P  S+G  ++ +FF+ YLA P+ +  Y G
Sbjct: 489 GYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLG 548

Query: 543 YKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           Y  + KD+ L      IDL  HR +YD ++++QE  + KE L+N S++ ++Y  WC
Sbjct: 549 YMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLRNSSVFFRMYNMWC 604

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/593 (45%), Positives = 381/593 (64%), Gaps = 16/593 (2%)

Query: 15  LSVNKNVIVTNENQIN--------ESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINN 66
           L    N+  TN++ I+         SH K     ++F+DSFK+ +  N     EK+   +
Sbjct: 22  LDYANNLASTNDDDISIASSQNRSLSHRKNTSYYRNFIDSFKRAEHGNLN---EKSA--D 76

Query: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMA 126
           ++    + +  + ++K+++ RHVIM+S               +L   GPA L+IGY+I++
Sbjct: 77  LEDGTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVS 136

Query: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186
             +Y +IQA GEMAV Y TL G FN Y S  +  +W FA  W++CIQW+ V PLEL+T+S
Sbjct: 137 FIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSS 196

Query: 187 MTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXX 246
           +TI+YW + ++ D+FV IFY+ ++ I+ F G + Y E EF FNLCKILM           
Sbjct: 197 LTIQYWTD-LNGDIFVVIFYVFLLLIH-FIGVKAYGETEFIFNLCKILMISGFIIFSIVV 254

Query: 247 XXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSN 306
                   GYIG  YW+ PG+F    P +RFKGI   LV   FS+G TE   ++ +EQ+ 
Sbjct: 255 NCGGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAE 314

Query: 307 PRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGI 366
           PRKA P+AAKK IYR L IY+ ++I++GF VP+NS +L+G+  S T ASPYV+A + HG+
Sbjct: 315 PRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGV 374

Query: 367 RIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAAS 426
           ++ PH INAVILISV+SVANSS Y+S R+L +LA+QGYAPK  TY+DR+GRPL  ++  +
Sbjct: 375 KVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCA 434

Query: 427 LLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYK 486
           +   IAF ASS KE +VF+WL AI+GLS+VFTW  I  SH+RFR AMK+Q + ++E+GYK
Sbjct: 435 VFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYK 494

Query: 487 SQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKT 545
           +  G++GS + +    L+LI QFWVAL P  S GA +  +FF+ YLAMPI + FY  Y  
Sbjct: 495 ATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSV 554

Query: 546 WKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           + K+W +      IDL +HR IYD D+++QE  + KE LKN   W+++Y FWC
Sbjct: 555 YNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYNFWC 607

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/581 (44%), Positives = 370/581 (63%), Gaps = 10/581 (1%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN 77
           N+  +V      + +  +     + FVDSF++ +D +   ++E  EIN+  +        
Sbjct: 10  NEKTVVQTAYSPSYASPESTGPFRRFVDSFRR-EDTSRSGDLEDGEINSTDT-------- 60

Query: 78  NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
            +LQ+ ++ RHV+M+S              A+LH  GPAGLLIGY++++   Y ++ A G
Sbjct: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           EMAV Y TL G FN Y S  +   + FA  W++C+QWL V PLEL+TA++ IKYW   V+
Sbjct: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN 180

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYI 257
            +VFV IFYL II I+ FG ARGY E EF FN+CK+LM                  +GYI
Sbjct: 181 ANVFVVIFYLFIICIHFFG-ARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYI 239

Query: 258 GVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKK 317
           G  YW NPG+F   TP  + KG    LVTA FSFG  E  A++ +E  NP+ AIPSA KK
Sbjct: 240 GDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKK 299

Query: 318 VIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVI 377
            +YR L +Y+ ++I++GFLVP++S  L+GS S+    SPYV+A+  HG+++ PH +NAVI
Sbjct: 300 GVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVI 359

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           LISV+SV NS+ YS+ R+L  LA+QGYAPK   Y+DR+GRPL  +I  ++   IAF A+S
Sbjct: 360 LISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAAS 419

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
             + ++F WL AI+GLS++FTW +ICLSH RFR+AMK+QGRSL  LGY++  G WGS+YA
Sbjct: 420 DNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYA 479

Query: 498 ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAK 557
                L+ I QFWVAL P+     ++ +FF+ Y+A P+ L+ + GY  + ++W L     
Sbjct: 480 VFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLD 539

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            +DL +HR +YD +VLKQE+ ++KE ++N   ++K+  FWC
Sbjct: 540 KMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/595 (44%), Positives = 378/595 (63%), Gaps = 11/595 (1%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIEN--LKDFVDSFKKIDDNNNQYEIEKNEI 64
            +T   L+ + N +   +   ++ E HS+   N  +  FVDSF++ +       +E+N  
Sbjct: 18  EVTDSPLYNNFNTSTTASLSPEVKE-HSEESRNGLVHRFVDSFRRAESQC----LEEN-- 70

Query: 65  NNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYII 124
           N+++      K NN L+K+++ RHV+M+S                L  AGP  L+IGY++
Sbjct: 71  NDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVL 130

Query: 125 MASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVT 184
           ++   Y ++QA GEM V Y TL G FN Y S  +  ++ FA  W++CIQWL V PLEL+T
Sbjct: 131 VSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190

Query: 185 ASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXX 244
           +SMTIKYWN+ ++ DVF+ IFY+ ++ I+ FG  + Y E EF FN CKILM         
Sbjct: 191 SSMTIKYWNDSINADVFIVIFYVFLLFIHFFG-VKAYGETEFIFNSCKILMVAGFIILSV 249

Query: 245 XXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQ 304
                     GYIG  YW +PG+F   +  TRFKGI   LVTA FSFG  E   ++ +EQ
Sbjct: 250 VINCGGAGVDGYIGGKYWRDPGSFADGSNATRFKGICFILVTAYFSFGGIELFVLSINEQ 309

Query: 305 SNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASH 364
           SN RK+ P AAK+ +YR L IY+ ++I++GF VP+N+ +L+GS S+ T ASPYV+A + H
Sbjct: 310 SNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIH 369

Query: 365 GIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIA 424
            +R+ PH INAVILISV+SVANS+ Y++ R++ +LA+QGYAP+   Y+DR+GRPL  +  
Sbjct: 370 KVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAV 429

Query: 425 ASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELG 484
            +L+  + F A SP+E + F+WL AI+GLS++FTW  I LSHIRFR+AMK+QGRSL ELG
Sbjct: 430 CALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELG 489

Query: 485 YKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGY 543
           YK+  G+WGS Y      L+ + QFWVAL P+ + G  ++  FF+ YLA P+ +  Y GY
Sbjct: 490 YKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGY 549

Query: 544 KTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
             + KD+ L      IDL  HR +YD ++++QE  + KE L+N S++ ++Y FWC
Sbjct: 550 MLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKEKLRNSSIFFRMYNFWC 604

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 363/559 (64%), Gaps = 7/559 (1%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXX 99
           +  FV+SFK+ +    Q  ++++  ++++ D      + QL+KT++ RHV+M+S      
Sbjct: 41  IHRFVNSFKRAE----QPPLKQD--SDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIG 94

Query: 100 XXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVD 159
                     LH AGPA L+I Y +++   Y +IQA GEMAV Y TL G FN Y S  + 
Sbjct: 95  TGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFIS 154

Query: 160 TAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGAR 219
             + FA  W++ IQWL V PLEL+TA+MT++YWN+ ++ DV+V IFY+ ++ I+ FG  +
Sbjct: 155 KPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFG-VK 213

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
            Y E EF FNLCKIL                   SGYIG  YW++PGAF   T   RFKG
Sbjct: 214 AYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNAGRFKG 273

Query: 280 IVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339
           +   LVTA FS+G  E  A++ +EQ NPR++ P+AAK+ IYR + IY+ ++I+VGF VP 
Sbjct: 274 VCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPS 333

Query: 340 NSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
           NS EL+GS  S T ASPYV+A + HG+++ PH +NAVILIS++SV NS+ Y++ R++  L
Sbjct: 334 NSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCAL 393

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           A+QG+APK   Y+DR+GRPLF +I  S+   I F A S KE +VF+WL AI+GL+++FTW
Sbjct: 394 AQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTW 453

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
             I +SHIRFR+AMK+Q +SL+E+GYKS  GV+GS +      L+ + QFWVAL P    
Sbjct: 454 SGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYT 513

Query: 520 GANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
             +   FF+ YLA PI   FYFGY  WK+D+ LF   + +DL  HR IYD +++KQE  +
Sbjct: 514 EMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEE 573

Query: 580 YKENLKNGSLWLKIYAFWC 598
            KE LKN  +W ++Y FWC
Sbjct: 574 KKEMLKNSPMWKRMYYFWC 592

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/575 (45%), Positives = 371/575 (64%), Gaps = 14/575 (2%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTI 84
           N +   ES S L+     FVDSFK+  D+       +N++ +  +    D   + L+K +
Sbjct: 32  NLDATEESRSGLVHR---FVDSFKRAQDST------ENDLED-GTKPLGDA--SHLKKAM 79

Query: 85  QPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYL 144
           + RHVIM+               + L   GP  L+IGY++++   Y +IQA GEMAV Y 
Sbjct: 80  KSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYP 139

Query: 145 TLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTI 204
           TL G FN+Y S  +   + FA  W++ IQWL V PLEL+TAS+TIKYWN+K++ DVF+ I
Sbjct: 140 TLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVI 199

Query: 205 FYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNN 264
           FY+ ++ I+ FG  + Y EAEF FN CK+LM                   GYIG  YW +
Sbjct: 200 FYVFLLFIHFFG-VKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRD 258

Query: 265 PGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALF 324
           PG+F       +FKGI   LVTA FS+G  E  +++ +EQ NPRK+ P AAK+ IYR L 
Sbjct: 259 PGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILI 318

Query: 325 IYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSV 384
           IY+ ++I++GF VP+N+ +L+GS  S T ASPYV+A + HG+++ PHFINAVILISV+SV
Sbjct: 319 IYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISV 378

Query: 385 ANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVF 444
           ANS+ Y+S R++ +LA+QGYAPK   Y+DR+GRPL  +I  ++   I F ++S KE EVF
Sbjct: 379 ANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVF 438

Query: 445 SWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLI 504
           +WL AI+GLS++FTW  I LSH+RFR+ MK+ GRS  E+G+++  G+WGS+Y  +   L+
Sbjct: 439 TWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLV 498

Query: 505 LIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
            I QFWVAL P + +G  +  +FF+ YLA PI L FYFGY  +K+D+   +    IDL  
Sbjct: 499 FIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNF 558

Query: 564 HRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           HR IYD ++++QE  + KE +KN S+W++++ FWC
Sbjct: 559 HRRIYDPELIRQEDEENKEKIKNSSVWVRMFHFWC 593

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/593 (43%), Positives = 366/593 (61%), Gaps = 26/593 (4%)

Query: 18  NKNVIVTNENQINESHSKLIENL----------KDFVDSFKKIDDNNNQYEIEKNEINNI 67
           +K+ I T +   NE+ +    +L            F+DSFK         E EK+++  +
Sbjct: 4   DKDSIRTKDINFNETSNSTAVDLGGEGRASGVFHRFIDSFKP------PVEDEKSDLEEM 57

Query: 68  KSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMAS 127
             +      +  L+K ++ RHVIM++                L   GP  L+IGYI+++ 
Sbjct: 58  SMES----TDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSF 113

Query: 128 CIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASM 187
             Y +IQA GEMAV Y TL G FN Y S  +     FA  W++ IQWL V PLEL+T +M
Sbjct: 114 VTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTM 173

Query: 188 TIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXX 247
           TI+YWN+ ++ DV++ IFY+ ++ +++FG  + Y E EF FN CKIL             
Sbjct: 174 TIQYWNDSINADVWIVIFYVFLLCVHVFG-VKAYGELEFIFNTCKILFIGGFIIFSIVVN 232

Query: 248 XXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
                T GYIG  YW NPG+F   T   RFK +   LVTA FS+G TE   ++ +EQ+NP
Sbjct: 233 AGGAGTDGYIGAKYWKNPGSFASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANP 292

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIR 367
           R++ P AAK+ IYR L IY+ ++I++GF VP+++ +L+G+  S T ASPYV+A + HG++
Sbjct: 293 RRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVK 352

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + PH INAVILI V S+ NSS Y++ R+  +LA+QGYAPK   Y+DR+GRP+  + A ++
Sbjct: 353 VVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAV 412

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
           +  IAF A+S +E +VF+WL AI+ LS++FTW TI LSHIRFR AMK+QG+ LNELGYK+
Sbjct: 413 VGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKA 472

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANIT--NFFKEYLAMPILLLFYFGYKT 545
             GVWGS++      L+ I QFWVAL P    G  I+   FF+ YLA P+ L FYF Y  
Sbjct: 473 LTGVWGSMWGFGFCVLVFIAQFWVALSP---PGGTISAEGFFESYLAFPLWLFFYFAYML 529

Query: 546 WKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           WK+D+    + +DIDL +HR IYD + L+QE  + KE ++N S W+K+  FWC
Sbjct: 530 WKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRNSSFWIKMKYFWC 582

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 257/560 (45%), Positives = 361/560 (64%), Gaps = 12/560 (2%)

Query: 43  FVDSFKKIDDNN--NQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXX 100
           F DSFK+    +     ++E   +         D  + +L+++I+PRHV M+S       
Sbjct: 47  FRDSFKRAQKRSVPQGGDLETASVQT-------DLTDGRLRRSIRPRHVAMMSVCTGIGT 99

Query: 101 XXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDT 160
                   +L   GP GL+IGY  ++   Y ++QA GEMAV Y ++ G FN Y S  +  
Sbjct: 100 GLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISK 159

Query: 161 AWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARG 220
            + FA  W+YC+QWL V PLEL+TAS+TIKYW + V+ DVF+ IFY+ I+ I+ FG +RG
Sbjct: 160 PFGFASVWLYCLQWLTVFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFG-SRG 218

Query: 221 YAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGI 280
           Y E+EF F LCK+LM                  SGYIG  YW++PGAF    P ++FKG 
Sbjct: 219 YGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPASKFKGF 278

Query: 281 VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYN 340
              LVT  FS+G TE  A+T +EQS+PR+AI SA K+ IYR L IY+ +++++GFLVP+ 
Sbjct: 279 CYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHT 338

Query: 341 SPELLGSKS-SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
           S EL+GS   S T ASPYV+AV+ HG+++ PH +NAVILI+V+SV NS+ YS  R+L  L
Sbjct: 339 SDELMGSGGKSATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNAL 398

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           A+QGYAPK   Y+DR GRPL  +IA S++  +AF A+S  E +VF+WL AI+GLS++FTW
Sbjct: 399 AEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTW 458

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
             I LSHIRFR+AMK  G SL++LGYKS  G+WGSIY      L+ + QFWVAL P+ +N
Sbjct: 459 SAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNN 518

Query: 520 G-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKN 578
           G  ++ +FF+ YLA P+  +F+ GY  +  +W +    KDID+   R +YDE+ ++QEK 
Sbjct: 519 GKTDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKL 578

Query: 579 QYKENLKNGSLWLKIYAFWC 598
           ++K  L+N +   ++  FWC
Sbjct: 579 EHKTMLQNSNWLGRLKHFWC 598

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  520 bits (1340), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 258/561 (45%), Positives = 353/561 (62%), Gaps = 11/561 (1%)

Query: 40  LKDFVDSFKKIDDN-NNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXX 98
            +  VDSFK+++    N  ++E  E+ +  S         +L++ ++ RHV+++S     
Sbjct: 38  FQRIVDSFKRVEGEVRNSSDLEDGEVTSAHS--------TKLKQNMKTRHVVLMSLGTGI 89

Query: 99  XXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLV 158
                    ++LH  GP GLLIGY  ++   Y ++QA GEMAV Y TL G FN Y S  +
Sbjct: 90  GTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFI 149

Query: 159 DTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGA 218
              + FA  W++CIQW  + PLEL+T+S+ +KYW  K++ D+FV IFYL I+ I+ F GA
Sbjct: 150 SKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIH-FCGA 208

Query: 219 RGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFK 278
           RGY E EF FN CK+LM                   GYIG  YW+ PGAF   +   RFK
Sbjct: 209 RGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAGSGIDRFK 268

Query: 279 GIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVP 338
           GI   LVTA FS+G  E  A++ +E  NPRKAIPSA  K +YR L IY+ +++I+GFLVP
Sbjct: 269 GIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVP 328

Query: 339 YNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLT 398
           ++S +LLGS SS    SPYV+A++ HGI+I PH INAVILISV+SV NS+ YS  R+L +
Sbjct: 329 HDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCS 388

Query: 399 LAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFT 458
           LA+QGYAPKI  Y+DR+GRPL  +I  S+   IAF A+S  E ++F WL AISGLS++FT
Sbjct: 389 LAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFT 448

Query: 459 WGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNS 518
           W  ICLSH RFRRAMK+QGRSL  LGY+S  G WGS+YA      +LI Q WVA+ P+++
Sbjct: 449 WTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDN 508

Query: 519 NGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEK 577
            G  ++ + FK  LA+P+ L    GY    K+W +      I + SHR  YD +V+KQE 
Sbjct: 509 GGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQED 568

Query: 578 NQYKENLKNGSLWLKIYAFWC 598
            +YK+ +K    ++++   WC
Sbjct: 569 LEYKQKMKRSKWYVRMSYTWC 589

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  517 bits (1331), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 277/572 (48%), Positives = 359/572 (62%), Gaps = 33/572 (5%)

Query: 28  QINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPR 87
           Q   + SKL    K  + SFK+    +   E+E  E NN             L K+I+ R
Sbjct: 51  QKTGNKSKLQNECKKILSSFKRQLPPSQNSELESQEKNN-------------LTKSIKSR 97

Query: 88  HVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147
           H++MIS                L  AGPAGL++GY + +  +YCIIQA GE+ + Y  L 
Sbjct: 98  HLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLT 157

Query: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207
           G +  YPS LVD +  FAV+ VY IQWL V PL+LVTA+MT+KYW   V+ D+FV + ++
Sbjct: 158 GNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS-VNSDIFVAVVFI 216

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
            +I INLFG +RGYAEAEF FN+CKILM                    YIG  YW+NPG 
Sbjct: 217 FVIIINLFG-SRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGP 275

Query: 268 FRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYV 327
           F        FKG+ +    AAFS+G  E L ++A+EQ NP K+IP+A KKV+YR L IY+
Sbjct: 276 F-----AHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYM 330

Query: 328 GSIIIVGFLVPYNSPELLGSK-SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVAN 386
            + I+V FLVPYNS ELLGS  SS + ASP+VIAVASHG+++ PHFINAVILISV+SVAN
Sbjct: 331 LTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVAN 390

Query: 387 SSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSW 446
           SS YS  R+LL+LA+QG  PK   Y+DR+GRPL   + +     I F A+S  E EVF+W
Sbjct: 391 SSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTW 450

Query: 447 LLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILI 506
           LLAIS LSQ+F W ++ LSHIRFR AM  QGRS+NE+GYK+Q G WGS  A  +    L+
Sbjct: 451 LLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFFLV 510

Query: 507 GQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHR 565
            QFWVA+ P+N +G  N+  FF+ YLAMPI+L+ YFG+K + K W+ +I A  IDL SHR
Sbjct: 511 CQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFWIPADKIDLNSHR 570

Query: 566 HIY-----------DEDVLKQEKNQYKENLKN 586
           +I+           D+DV + E  +  ENL N
Sbjct: 571 NIFVHSTLTEFDKADDDVKEYENQESLENLNN 602

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  512 bits (1318), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 257/560 (45%), Positives = 364/560 (65%), Gaps = 12/560 (2%)

Query: 43  FVDSFKKIDDNN--NQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXX 100
           FV+SFK+ + ++  +  ++E    +++ S       ++ L+++I+PRHV M+S       
Sbjct: 51  FVNSFKRAEKHSTPSNGDLEHATTHSVAS-------SSPLKRSIKPRHVAMMSICTGIGT 103

Query: 101 XXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDT 160
                   +L   GPAGL+IGY  ++   Y ++QA GEMAV Y +L G FN Y S L+  
Sbjct: 104 GLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISR 163

Query: 161 AWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARG 220
            + FA  W+YCIQWL V PLEL+TAS+TIKYWN+ ++ DVF+ IFY+ I+ I+ FG +RG
Sbjct: 164 PFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFG-SRG 222

Query: 221 YAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGI 280
           Y E+EF F +CK+LM                    YIG  YW +PGAF   +  T+FKG+
Sbjct: 223 YGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGV 282

Query: 281 VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYN 340
              LVT  FS+G TE  A+T +EQSNPR+AI S  K+ IYR L IY+ ++I++GFLVP+ 
Sbjct: 283 AYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHT 342

Query: 341 SPELLGSKS-SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
           S EL+GS   S T ASPYV+AV+ HG++I PH INAVILI+V+SV NS+ YS  R+L TL
Sbjct: 343 SSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTL 402

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           A+QGYAP+   Y+DR GRPL  +IA S+   +AF A+S  E +VF+WL AI+GLS++FTW
Sbjct: 403 AEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTW 462

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
             I LSH+RFR+AM+   R L+ELGYK+  GV GS+   +   L+ I QFWV++ P   +
Sbjct: 463 SAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKD 522

Query: 520 GA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKN 578
           G  ++ +FF+ YLA P+ ++ +FGY    ++W +    KDIDL  +R IYD+D L QE  
Sbjct: 523 GKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDL 582

Query: 579 QYKENLKNGSLWLKIYAFWC 598
           ++K  ++N S   K++ FWC
Sbjct: 583 EHKILIQNSSWARKLHNFWC 602

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  510 bits (1314), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 265/561 (47%), Positives = 360/561 (64%), Gaps = 8/561 (1%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXX 99
            + F DSFK+ D   + +E E  E    +     +K   +L+  I+ RH+ MIS      
Sbjct: 35  FQRFKDSFKRADVVEDVHEKEGQE----EYATGLNKTQQKLKHNIKTRHLTMISLGTGIG 90

Query: 100 XXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVD 159
                     LH  GP GLLIGY+  ++ +YC++QAC E+ V Y TL G +N YP+FLVD
Sbjct: 91  TGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVD 150

Query: 160 TAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGAR 219
             + FAVA VY +QW  V PLELVTASMTIKYW E V+PDVFV IFYL I+ I+ FG +R
Sbjct: 151 RGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFG-SR 209

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
           GYAE+EF FN  K+L+                   GYIG  YW+NPG F G       KG
Sbjct: 210 GYAESEFIFNTLKVLLMAGFIIMGISLNCGASKL-GYIGAKYWSNPGTFAGERSINHLKG 268

Query: 280 IVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339
           I S  V +AF++G +EF+A+TA+EQ+NPR+++PSA K+ +YR + +++  I ++ FLVPY
Sbjct: 269 ICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPY 328

Query: 340 NSPELLGSKSSQTKAS-PYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLT 398
            S +LL S  +    + P+VIA A HG++I PH INA+IL SV+SV NS  YS+ R+LL+
Sbjct: 329 TSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLS 388

Query: 399 LAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFT 458
           LA+ G  PKIFTY+DR GRPL  ++   +   ++F A+S  +  VF+WL AI+GLSQ+FT
Sbjct: 389 LAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFT 448

Query: 459 WGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNS 518
           W +I LSHIRFR AMK+QGRSL ELGY S  G  GS YA     ++L+ QFW+A+ P++ 
Sbjct: 449 WTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDK 508

Query: 519 NGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEK 577
           +G  +  +FFK YLA  +L+LFY GYK W ++  L I    IDL +HR I+DE+VL+QE+
Sbjct: 509 HGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFDEEVLQQEE 568

Query: 578 NQYKENLKNGSLWLKIYAFWC 598
            + KE +K  S   +  AFWC
Sbjct: 569 LERKERMKTASFKQRFIAFWC 589

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  507 bits (1306), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 254/581 (43%), Positives = 358/581 (61%), Gaps = 19/581 (3%)

Query: 27  NQINESHSKLIEN--------LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78
           N I+ S    +E+        ++ ++DS+K+        E  +  I+  +  +  D ++ 
Sbjct: 43  NDIDTSERTSVESSEVYRSGRIRRWIDSYKRA-------EHPREHIDGFEDGESKDGIH- 94

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            L+K ++ RHV+M+S                LH AGPA L+IGY +++   Y +IQA GE
Sbjct: 95  -LKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTYFMIQAAGE 153

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           +AV Y TL G FN+Y   L+   + FA  W+  +QWL V PLE + AS+TIKYWN+++  
Sbjct: 154 LAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIKYWNDRISG 213

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
           DVFV IFY+ ++ I+ F G R Y E EF FNLCK+LM                   GYIG
Sbjct: 214 DVFVVIFYVFLLFIH-FVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAGGAGNDGYIG 272

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YWN+PGAF G T G+RFKG+   LVT  FS+G TE   ++ +EQ NPRK+ P AAK  
Sbjct: 273 GKYWNDPGAFAGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHS 332

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSK-SSQTKASPYVIAVASHGIRIAPHFINAVI 377
           IYR + IY+ ++I++GF VPYN P L+G+  +S + ASPYV+A + HG++I PHFINAV+
Sbjct: 333 IYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHASPYVLAASIHGVKIVPHFINAVV 392

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           LI+++SV NS+ Y++ RM+++LA+QG+APKI  Y+DR+GRPL  +   +L   I F ASS
Sbjct: 393 LIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSLGICALFGLIGFAASS 452

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
            KE +VF+WL AI+GLS++FTW    +SHIRFR AMK+QG+ + E+G+ +  G++GS Y 
Sbjct: 453 SKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYG 512

Query: 498 ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAK 557
                L+   QFWVAL P+ S      +FF+ YLA PI L FYFGY  W KD+      +
Sbjct: 513 LFFNILVFAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLE 572

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            IDL  HR IYD + + +   Q KE  KN S+  KI  + C
Sbjct: 573 SIDLDFHRRIYDPEEMAEINRQEKEEYKNSSIVGKIIYWLC 613

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  507 bits (1305), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 256/560 (45%), Positives = 351/560 (62%), Gaps = 9/560 (1%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXX 99
            + + DSFK+ + +    E E  E  +I    +N   + +L+K ++ RHV+M+S      
Sbjct: 64  FRRWADSFKRAEKST---EAEDGESGSI----YNGNESTELKKAMKSRHVVMMSLGTGIG 116

Query: 100 XXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVD 159
                     L  +GPA L+IGY +++   Y +IQA GE+ V Y +L G FN Y   LV 
Sbjct: 117 TGLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVS 176

Query: 160 TAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGAR 219
             + FA  W+  +QWL V PLEL+T ++TIKYW EKV+ D+FV I Y+ ++ I++FG  +
Sbjct: 177 RPFGFATVWLASVQWLTVIPLELITCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFG-VK 235

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
            Y EAEF FN CKILM                   GYIG SYWNNPGAF      +RFK 
Sbjct: 236 AYGEAEFLFNTCKILMIAGFIILSIVINVGGAGNDGYIGGSYWNNPGAFASDNAASRFKS 295

Query: 280 IVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339
           I   LVT  FS+G TE   ++ +EQ NPRK+ P AAK  IYR L IY+ ++I++GF VP+
Sbjct: 296 ICYILVTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPH 355

Query: 340 NSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
           +S +L+GS  S   ASPYV+A + HG+++ PHFINAVILI+++SVANSS Y++ RM+++L
Sbjct: 356 DSDQLMGSAGSSAHASPYVLAASLHGVKVVPHFINAVILIALISVANSSLYAAPRMMVSL 415

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           A+QG+APK  TY+DR+GRPL GI   ++   I F ASS KE +VF+WL AI+GLS++FTW
Sbjct: 416 AQQGFAPKFLTYVDREGRPLLGIAVCAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTW 475

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
               LSHIRFR+AMK+QG+++ E GY S  G+WGSI       L+ I QFWVAL P+ ++
Sbjct: 476 SAFFLSHIRFRQAMKVQGKNIKECGYLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGND 535

Query: 520 G-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKN 578
           G  +   FF+ YLA PI L FYFG   + KD+ L    + IDL  HR IYD + LK+E  
Sbjct: 536 GKCDAQAFFQSYLAFPIWLAFYFGCMFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDL 595

Query: 579 QYKENLKNGSLWLKIYAFWC 598
             K  LK      ++ AF+C
Sbjct: 596 ATKAELKRRGFHAQLVAFFC 615

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  506 bits (1303), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 277/589 (47%), Positives = 368/589 (62%), Gaps = 38/589 (6%)

Query: 28  QINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPR 87
           Q  +   KL    + F DSFK+   ++   E+E  E NN             L+K+I+ R
Sbjct: 51  QKTDRKPKLRNEFRKFFDSFKRQLPSDQNSELESQEKNN-------------LRKSIKSR 97

Query: 88  HVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147
           H++MIS                L  AGPAGL++GY I +  +YCIIQA GE+ + Y  L 
Sbjct: 98  HLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLT 157

Query: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207
           G +  Y S LVD +  FAV+ VY IQWL V PL+LVTA+MT+KYW   V+ D+FV + ++
Sbjct: 158 GNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-NVNADIFVAVVFI 216

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
            +I INLFG +RGYAEAEF FN+CKILM                    YIG  YW+NPG 
Sbjct: 217 FVIIINLFG-SRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIGTEYWHNPGP 275

Query: 268 FRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYV 327
           F        FKG+ +    AAFS+G  E L ++A+EQ NP ++IP+A KKV+YR L IY+
Sbjct: 276 F-----AHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNACKKVVYRILLIYM 330

Query: 328 GSIIIVGFLVPYNSPELLGSKSSQT-KASPYVIAVASHGIRIAPHFINAVILISVLSVAN 386
            + I++GFLVPYNS ELLGS SS    ASP+VIAV+SHG+++ PHFINAVILISV+SVAN
Sbjct: 331 LTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFINAVILISVISVAN 390

Query: 387 SSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSW 446
           SS YS  R+LL+LA+QG  PK   Y+DR GRPL   + +     I F A+S  E +VF+W
Sbjct: 391 SSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFVATSNAEEQVFTW 450

Query: 447 LLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILI 506
           LLAIS LSQ+F W ++CLSHIRFR AM  QGRS++E+GYK+Q G WGS  A  +    L+
Sbjct: 451 LLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWIAVLIAVFFLV 510

Query: 507 GQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHR 565
            QFWVA+ P++ +G  ++  FF+ YLAMPI+LL YFG+K + K W  +I A+ IDL SHR
Sbjct: 511 CQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFWIPAEKIDLDSHR 570

Query: 566 HIY-------------DEDVLKQEKNQYKENLKNGSL---WLKIYAFWC 598
           ++Y             D+DV + E ++  ENL +  L   + K+  FWC
Sbjct: 571 NVYLPPTSTGADKIDDDDDVTEYETSESSENLHSSRLNKSFKKMVNFWC 619

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  501 bits (1291), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 277/582 (47%), Positives = 362/582 (62%), Gaps = 39/582 (6%)

Query: 35  KLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISX 94
           KL    K F DSFK+    +   E+E  E NN             L ++I+ RH+IMIS 
Sbjct: 58  KLQNECKKFFDSFKRQLPADQNSELESQERNN-------------LTRSIKSRHLIMISL 104

Query: 95  XXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYP 154
                          L  AGPAGL++GY I +  +YCIIQA GE+ + Y  L G +  Y 
Sbjct: 105 GTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYS 164

Query: 155 SFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINL 214
           S LVD +  FAV+ VY IQWL V PL+LVTA+MTIKYW   V+ D+FV   ++ +I INL
Sbjct: 165 SILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWT-NVNADIFVAAVFIFVIIINL 223

Query: 215 FGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPG 274
           FG ++GYAEAEF FN+CKILM                    +IG  YW+NPG F      
Sbjct: 224 FG-SKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKFIGTKYWHNPGPF-----A 277

Query: 275 TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVG 334
             FKG+ +    AAFS+G  E L ++A+EQ NP K+IP+A KKV+YR LFIY+ + I++ 
Sbjct: 278 HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILFIYMLTTILIC 337

Query: 335 FLVPYNSPELLGSKSSQT-KASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSS 393
           FLVPYNS ELLGS SS    ASP+VIAVASHG+++ PHFINAVILISV+SVANSS YS+ 
Sbjct: 338 FLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSAP 397

Query: 394 RMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGL 453
           R+LL+LA+QG+ PK   Y+DR GRPL   + + +   I F A+S  E +VF+WLLAIS L
Sbjct: 398 RLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSL 457

Query: 454 SQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVAL 513
           SQ+F W ++ LSHIRFR AM  QGRS++E+GYK+Q G WGS  A  +    L+ QFWVA+
Sbjct: 458 SQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAI 517

Query: 514 WPLNSNGANITN-FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIY---- 568
            P++ +G    N FF+ YLAMPI+L  YFG+K + K W  +I A+ IDL SHR IY    
Sbjct: 518 APVSKHGKLDANVFFQNYLAMPIVLFAYFGHKIYTKSWKFWIPAEKIDLDSHRTIYVPPI 577

Query: 569 --------DEDVLKQEKNQYKENLKNGS----LWLKIYAFWC 598
                   D+D+ + E ++  EN  NGS     + ++  FWC
Sbjct: 578 LMGTNKIDDDDLKEYETSESSEN-PNGSGSRKFFKRMANFWC 618

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 254/559 (45%), Positives = 348/559 (62%), Gaps = 19/559 (3%)

Query: 54  NNQYEIEKNEI--NNIKSDQ---FNDKLNNQL-----------QKTIQPRHVIMISXXXX 97
           +  Y++  NE+  NN K++     ND L +             +  ++ RHVIM++    
Sbjct: 112 DTAYDMNSNEVDPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATG 171

Query: 98  XXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFL 157
                      +LH +GPAGL++GY +++   Y ++QA GEMA+ Y TL GGFN Y S  
Sbjct: 172 IGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLF 231

Query: 158 VDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGG 217
           +   + FA  W++ + WL + PLEL+T+S+T+KYW   ++PD+FV IFYL ++ ++ F G
Sbjct: 232 ISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVH-FIG 290

Query: 218 ARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRF 277
            R YAEAEFFFN CKILM                   GYIG  YW++PG F       RF
Sbjct: 291 LRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPFASDNGAARF 350

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
           K +   L+ A FS+G TE   ++ +EQ NPRKA+P AAK  +YR   IY+ ++I++GF V
Sbjct: 351 KEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNV 410

Query: 338 PYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLL 397
           PYNSP+L+G+ +S+  ASPYV+A   HG++I PHFINAVIL+SV+SVANS+ ++  R+L 
Sbjct: 411 PYNSPDLMGNANSK-DASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLA 469

Query: 398 TLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVF 457
           TLA+QG+APK  TY+DR GRPL  +   SL   IAF A+S KE EVF+WL AI+GLS++F
Sbjct: 470 TLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELF 529

Query: 458 TWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN 517
            W  I LSHIRFR AMK  G+S++E+GYK+  G+WGS Y      L+LI QFWVAL    
Sbjct: 530 AWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPG 589

Query: 518 SNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQE 576
           S G     +FF+ YLA  I + FY  Y  + KDW + I  KDID+   R IYD D L+QE
Sbjct: 590 SGGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIYDADFLRQE 649

Query: 577 KNQYKENLKNGSLWLKIYA 595
           K +  E  K  ++  KIYA
Sbjct: 650 KEESYEKYKQSNIGKKIYA 668

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  502 bits (1293), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 256/566 (45%), Positives = 355/566 (62%), Gaps = 11/566 (1%)

Query: 38  ENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXX 97
           + +K+++DSFK  ++        + E+N+I  +   +K   QL+KT++ RHV+M+S    
Sbjct: 105 KRIKNWIDSFKPPEECMES----ELELNSIDENGHREKPRAQLKKTMKSRHVVMMSLGTG 160

Query: 98  XXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFL 157
                     + L  +GPA L+IGY +++   Y +IQA GEM V Y TL G FN Y S  
Sbjct: 161 IGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEMGVAYPTLPGNFNTYISTF 220

Query: 158 VDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGG 217
           +     FA  W+  IQWL V PLEL+ ASMTIKYW   + PDVFV IFY+ +  I+ FG 
Sbjct: 221 LSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTSISPDVFVVIFYVFLNFIHFFGT 280

Query: 218 ARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRF 277
           A  Y E EF FNLCKILM                   GYIG  YW+ PGAF G    +RF
Sbjct: 281 A-AYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGKYWHTPGAFVGKNSASRF 339

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
           K +   LVTA FS+G TE   +T +EQ NPRK+ P+AAK  IYR L +Y+ ++I++GF V
Sbjct: 340 KDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTTIYRILIVYLLTMILLGFNV 399

Query: 338 PYNSPELLGSKSSQTKA---SPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSR 394
           PY++  L  + SS   +   SPYV+A + HG+++ PHFINAV+LI+++SVANS+ Y++ R
Sbjct: 400 PYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINAVVLIALISVANSATYAAPR 459

Query: 395 MLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLS 454
           M+ +LA+QG APK   Y+DR+GRP++G++  SLL  I F A+S KE EVF WL AI+GL+
Sbjct: 460 MMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAAASDKEQEVFVWLAAIAGLA 519

Query: 455 QVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALW 514
            +F W    LSHIRFR AMK+QG+ +NE+GYK+  G+WGSI  A    L+LI  FWV+L 
Sbjct: 520 TLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIGACFNVLVLIANFWVSLT 579

Query: 515 PLNSNGANIT--NFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDV 572
           P    G+N++  NFF++ LA+PI + F  GY   KKDW ++   + IDL   R IYD + 
Sbjct: 580 P-PGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPIESIDLDYCRKIYDPEQ 638

Query: 573 LKQEKNQYKENLKNGSLWLKIYAFWC 598
           LK+E  + +E ++N   W +  AFWC
Sbjct: 639 LKREDEENRERIRNAGFWARCRAFWC 664

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  494 bits (1271), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 251/524 (47%), Positives = 336/524 (64%), Gaps = 27/524 (5%)

Query: 44  VDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXX 103
           VDSFK+                 +++D    +   QL KT++PRH++MIS          
Sbjct: 85  VDSFKR---------------QKVRNDGEFAETETQLNKTMKPRHIVMISLGTGIGTGLL 129

Query: 104 XXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWN 163
                 L  +GPAGL+IGY + +  IYC++QA GE+ + Y  L G +  YP++L+D A  
Sbjct: 130 VGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVG 189

Query: 164 FAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAE 223
           FAV+ +Y +QWL V PL+LVTA+MTI+YW   V+PD+FV    +L+IAIN+FG A+GYAE
Sbjct: 190 FAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFG-AKGYAE 248

Query: 224 AEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVST 283
           AEFF N CK+LM                    YIGV YW  PGAF        FKG+ + 
Sbjct: 249 AEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAF-----ANGFKGVAAV 303

Query: 284 LVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPE 343
              AAFS+G  E L +TA+EQ+NPRKAIP A +KV+YR LF+Y+ + IIV FLVPYNSP 
Sbjct: 304 FCYAAFSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPA 363

Query: 344 LLGS--KSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAK 401
           LLGS    S + ASP+VIAVASHG+++ PH INA ILISV+SVANSS YS  R+LL+L++
Sbjct: 364 LLGSNNDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQ 423

Query: 402 QGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGT 461
           QGYAPK F Y+DR+GRP+  ++ +  +  IAF A+ P   EVF+WLLA+SGLSQ+F W +
Sbjct: 424 QGYAPKCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMS 483

Query: 462 ICLSHIRFRRAMKIQ---GRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNS 518
           I +SH+RFR A++ Q    R+ + + Y +Q G  GS+ A  +   IL+ QFWVA+ PL  
Sbjct: 484 ITISHLRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGH 543

Query: 519 NGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDL 561
           NG  ++  FF+ YLA P+LL  Y  YK W +DW L I A +IDL
Sbjct: 544 NGQLDVQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  491 bits (1264), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 258/600 (43%), Positives = 368/600 (61%), Gaps = 21/600 (3%)

Query: 8   ITKDGLHLSVNKNVIVTNENQINES-----HSKLIENLKDFVDSFKKIDD---NNNQYEI 59
           I  + LH  V  ++  T    I+ +     HSK +       DSFK+ +    + N  E 
Sbjct: 24  INSETLHEPVQSSLTPTTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEA 83

Query: 60  EKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
           E+  IN  K+          L+ T++ RH+ M++                L  AGPAG++
Sbjct: 84  ERIAINTAKAP---------LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIV 134

Query: 120 IGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCP 179
           IG+ + ++ IYC++ A GE+AV +  + GGF  Y +  +D ++ FA  + Y +QWL   P
Sbjct: 135 IGWGLTSTMIYCMVMALGELAVVF-PVSGGFTTYATRFIDESFGFASNFNYALQWLATLP 193

Query: 180 LELVTASMTIKYWNEKVD-PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXX 238
           LE+V+AS+T+ YW       D FV +F+L+I+ INLFG  RG+ EAEF F+  K+L    
Sbjct: 194 LEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFG-VRGFGEAEFVFSTIKVLTVIG 252

Query: 239 XXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLA 298
                           G++G  YW+NPGAF G   GT+FKG+ S  VTAAFSF  +E + 
Sbjct: 253 FIILGIVLVAGGGPEGGFVGGRYWHNPGAFVGDNAGTQFKGVCSVFVTAAFSFAGSELVG 312

Query: 299 ITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYV 358
           ITA+E +NPRK++P AAK+V++R +  Y+GS+I++G LVPY  P L+G+ S    ASP+V
Sbjct: 313 ITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFV 372

Query: 359 IAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRP 418
           IA+ +HGIR  P  IN VILI+VLSV NS+ ++ SR +  L++QG+ P+IF Y+DRKGRP
Sbjct: 373 IAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRP 432

Query: 419 LFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGR 478
           L GII  S    IAF A+S K+ EVF+WL+A+SGLS +FTWG ICL HIRFR A+K QGR
Sbjct: 433 LVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGR 492

Query: 479 SLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLL 538
           S NEL + S  G+ GS +   ++ L+ I QF+VAL+P  S   +   FF+ YL+ PI+L 
Sbjct: 493 STNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSK-PSAEVFFESYLSFPIVLA 551

Query: 539 FYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           FYFG+K +KK+W LFI+A+D+D+ + R   D ++LKQE  + K  L     W + Y FWC
Sbjct: 552 FYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEKAILATKGWWYRQYQFWC 611

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  489 bits (1258), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 273/566 (48%), Positives = 355/566 (62%), Gaps = 23/566 (4%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           T E +  +S S L    K+F DSFK+    +   E+E  E NN             L K+
Sbjct: 47  TAEPRRTDSKSILQRKCKEFFDSFKRQLPPDRNSELESQEKNN-------------LTKS 93

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           I+ RH++MIS                L  AGPAGL++GY I +  +YCIIQA GE+ + Y
Sbjct: 94  IKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCY 153

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
             L G +  YPS LVD +  FAV+ VY IQWL V PL+LVTA+MT+KYW   V+ D+FV 
Sbjct: 154 AGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS-VNADIFVA 212

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           + ++ +I INLFG +RGYAEAEF FN CKILM                    YIG  YW+
Sbjct: 213 VVFVFVIIINLFG-SRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRYIGAEYWH 271

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           NPG F        FKG+ +    AAFS+G  E L ++A+EQ NP K+IP+A KKV+YR L
Sbjct: 272 NPGPF-----AHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRIL 326

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS-PYVIAVASHGIRIAPHFINAVILISVL 382
            IY+ + I+V FLVPYNS ELLGS  S    + P+VIAVASHG+++ PHFINAVILISV+
Sbjct: 327 LIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINAVILISVI 386

Query: 383 SVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETE 442
           SVANSS YS  R+LL+LA+QG  PK   Y+DR GRPL     + +   I F A+S  E +
Sbjct: 387 SVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQ 446

Query: 443 VFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMF 502
           VF+WLLAIS LSQ+F W ++ LSHIRFR AM  QGRS+NE+GYK+Q G WGS  A  +  
Sbjct: 447 VFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAI 506

Query: 503 LILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDL 561
             L+ QFWVA+ P+N +G  N+  FF+ YLAMPI+L  YFG+K + K W+ +I A+ IDL
Sbjct: 507 FFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDL 566

Query: 562 ISHRHIYDEDVLKQ-EKNQYKENLKN 586
            SHR+I+    L + +K    ++LK 
Sbjct: 567 DSHRNIFVSPSLTEIDKVDDNDDLKE 592

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  483 bits (1244), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/571 (47%), Positives = 369/571 (64%), Gaps = 14/571 (2%)

Query: 9   TKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIK 68
           T   LH S N ++   + N++NE      E +K+     +      N +E E    ++ K
Sbjct: 24  TNSSLHTSRNLDIDFKSVNELNEGDKVKYEGIKN--GDTQVTSGITNSFESESLR-DDSK 80

Query: 69  SDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASC 128
             +  +K  NQL ++I+ RH++MIS                L  +GPAGL+IGY + +  
Sbjct: 81  PLENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIM 140

Query: 129 IYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMT 188
           +Y I+QA GE+ + Y  L G +  YPS LVD A  FA++ +Y +QWL V PL+LVTA+MT
Sbjct: 141 VYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMT 200

Query: 189 IKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXX 248
           I YW   ++P++FV I  ++++  N FG A+GY EAEF  N+ K+LM             
Sbjct: 201 IGYWT-NINPNIFVAIVLVIVVLTNCFG-AKGYVEAEFLCNIFKVLMMVGFVLLAILINT 258

Query: 249 XXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
               T GYIG  YW NPGAF        FKG+ S    AAFS+G  E LA+TA+EQ NP 
Sbjct: 259 GAIGTDGYIGTIYWKNPGAF-----ANGFKGVCSVFCYAAFSYGGIEVLALTAAEQENPI 313

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS-PYVIAVASHGIR 367
           KAIPSA KK +YR LF+Y+ + I++GFLVPY+SP+L+GS S     S P+VIA+ASHG++
Sbjct: 314 KAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSSPFVIAIASHGVK 373

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + PH INAVILIS++SVANS+FYSS+R+LL+L++QG  PKIF Y+D++GRP + I+ ASL
Sbjct: 374 VVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFASL 433

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
             +I F ASSP + EVF+WLLAISGLSQ+F W +ICLSHIRFRRAM  QG+SL+E+GYK+
Sbjct: 434 FGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYKA 493

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTW 546
             G WGS  A ++    LI QFWVA+ P+  +G  ++  FF+ YLA PI+L+ Y GYKT+
Sbjct: 494 PTGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYKTY 553

Query: 547 KKDWNLFIRAKDIDLISHRHIY--DEDVLKQ 575
            KDW L+I +  IDL   R IY  +E V+ +
Sbjct: 554 YKDWRLYIPSDKIDLSYGREIYVPEEQVIVE 584

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  482 bits (1241), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 257/569 (45%), Positives = 354/569 (62%), Gaps = 29/569 (5%)

Query: 15  LSVNKNVIVTNENQINESHSKLIENL---KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQ 71
           +S   NVI  + +  NE  +     L     F+DSFK+           K   ++   D+
Sbjct: 33  VSPETNVITASSSASNEGPATPQPQLGVVASFLDSFKR-----------KEHDDSTAGDE 81

Query: 72  FNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYC 131
                 N L K I+ RH+IMIS              + L  +GP GL+IGYI+ +  ++ 
Sbjct: 82  ------NDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFL 135

Query: 132 IIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKY 191
           IIQA GE+ + Y  ++G F  YP+ LVD A+ FA++++Y IQW+ V PL+LVTA+MTI++
Sbjct: 136 IIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQF 195

Query: 192 WNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXX 251
           WN  V+ DVFV   +++++ INL GGARGY EAEFF NLCKI+M                
Sbjct: 196 WNVGVNLDVFVLASFVVVVLINL-GGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGI 254

Query: 252 XT--SGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
                GYIG  YW NPG F        FKG+ S    AAFS+G  E L ++A+EQ NP K
Sbjct: 255 PNGPDGYIGGKYWRNPGLF-----ANGFKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLK 309

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIA 369
           +IPSA KKV+YR LFIY+ S+IIV FLVPY SP+L+GS  S + +SP+VIA+ASHG+ + 
Sbjct: 310 SIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVV 369

Query: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429
           PH INAVILISVLSVANS+ Y + R+LL+LA+ G APK   Y+D++GRP    +   L  
Sbjct: 370 PHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFG 429

Query: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489
            I F A+S K   VF+WLL+ISGL Q+F W +IC+SHIRFR AM++QG  L E+ YK+Q 
Sbjct: 430 MIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQT 489

Query: 490 GVWGSIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKK 548
           G WGS  A  +   +L+ QFWVA+ P+ ++G  + TNFF+ YLA P++L  Y G+K + K
Sbjct: 490 GYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYK 549

Query: 549 DWNLFIRAKDIDLISHRHIYDEDVLKQEK 577
            W L I A  I+L ++R++Y  +   ++K
Sbjct: 550 QWQLLIPADKIELDNNRNVYVPEEALEDK 578

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  480 bits (1236), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 245/603 (40%), Positives = 366/603 (60%), Gaps = 23/603 (3%)

Query: 17  VNKNVIVTNENQINESHSKLIENLKDFVDSF-----KKIDDNNNQYEIEKNEINNI---- 67
           +  N  V+ E QIN+ +   +ENL D          + ID    Q   ++  +  +    
Sbjct: 20  LGSNTPVSEETQIND-YKGTVENLSDSPVEVSNIQTEGIDGPPKQGFFQRGILGRVVDSY 78

Query: 68  -------KSDQFNDKLNNQ-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
                  + D   D ++N  L++ ++ RHV M+S                L NAGPA LL
Sbjct: 79  RRADIPGQDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLL 138

Query: 120 IGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCP 179
           IGY +++   Y ++QA GE+AV + T+ G FN Y S LV   + FA  W++ +QWL + P
Sbjct: 139 IGYGLVSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFP 198

Query: 180 LELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXX 239
           +EL+  +  +++W  +VD DVFV IF++ +  ++ F G   Y E EFF NL K+LM    
Sbjct: 199 MELIAMTFAVRFWTTRVDADVFVLIFFVFLFIVH-FIGVEAYGETEFFLNLFKVLMVIGF 257

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAI 299
                         SGYIG  YW++PGAF  HT   RFKG+   LV+A FS+G TE   +
Sbjct: 258 VIFAICVAAGGAGDSGYIGAKYWHDPGAFVSHTAEGRFKGVCYVLVSAYFSYGGTELFVL 317

Query: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS---KSSQTKASP 356
           + +EQ NPRK IP+A K  IYR +FIY+ ++++VGF VP N P L+GS   K      SP
Sbjct: 318 SVNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSP 377

Query: 357 YVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKG 416
           YV+A + H +R+ PHFINAV++++++S++NS+ Y++ R++ +LA+QGY PK F Y+DR+G
Sbjct: 378 YVLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRG 437

Query: 417 RPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQ 476
           RP   ++   ++  IAF +SS K   +FSWL AI+GLS++FTW +I LSH+RFR A+K+Q
Sbjct: 438 RPTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQ 497

Query: 477 GRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPI 535
           G+ +NELGYKS  GVWGS Y      L+   QFWVAL   NS G  + ++FF+ YLA+PI
Sbjct: 498 GKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPI 557

Query: 536 LLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA 595
            L FY G+  W +D+   I    +DL S+R  YD ++L+QE  ++K+ +K+ S+W+K+++
Sbjct: 558 WLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEHKQAMKSASIWIKLHS 617

Query: 596 FWC 598
           F+C
Sbjct: 618 FFC 620

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  478 bits (1231), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 252/598 (42%), Positives = 355/598 (59%), Gaps = 23/598 (3%)

Query: 5   SPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNN---NQYEIEK 61
            P   +D  H S       ++  Q   S S+     +DF D FK+++      N  E EK
Sbjct: 15  EPLEAQDAGHSSYETG---SSPGQTQASKSRW----QDFKDGFKRVELEELDPNLTEAEK 67

Query: 62  NEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIG 121
             I   +S          LQ+ ++ RH+ MI+                L   GPAG+LIG
Sbjct: 68  IAIITAQSP---------LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIG 118

Query: 122 YIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLE 181
           + ++   IYC++ + GE+AV +  + GGF  Y +  VD ++ FA+ + Y +QWL V PLE
Sbjct: 119 WGLIGLMIYCVVMSMGELAVTF-PVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLE 177

Query: 182 LVTASMTIKYWNEKVD-PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           +V AS+T+ +W       D FV +FY++I+ IN FG  RGY EAEF F+  K++      
Sbjct: 178 IVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFG-VRGYGEAEFVFSFIKVITVIGFI 236

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                         GYIG  YW+NPGAF G   G+RFKG+ S  VTAAFSF  TE + + 
Sbjct: 237 ILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFAGTELVGLA 296

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           ++E +NPRKA+P AAK+V +R L  Y+ S+ ++G LVP+ S  L+G+ S    ASP+V+A
Sbjct: 297 SAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLA 356

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           + +HGI+  P  IN VILISVLSV NS+ Y+ SR ++ LA+QG  P IF Y+DRKGRPL 
Sbjct: 357 IQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLV 416

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
            II   +   ++F A S KE +VF+WLLA+SGLS +F+WG IC+ HIRFRRA+  QGRS 
Sbjct: 417 AIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRST 476

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY 540
           +EL + S  G+ GS +   ++ L+LI QFWVA+WP+  +  N  +FF  YL+ P+LL FY
Sbjct: 477 DELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGS-PNAEDFFSAYLSFPVLLAFY 535

Query: 541 FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
             +K WK++W LF RAKDID+ + R   D + L+QE  + K  L     W ++Y FWC
Sbjct: 536 IFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPWWYRLYFFWC 593

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  474 bits (1221), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 246/580 (42%), Positives = 346/580 (59%), Gaps = 17/580 (2%)

Query: 24  TNENQINESH-SKLIENLKDFVDSFKKI---DDNNNQYEIEKNEINNIKSDQFNDKLNNQ 79
           T   +I +S  +      +DFVD FK++   D + N  + EK  I   +S          
Sbjct: 29  TGSGEITDSKPTSSGSRWQDFVDGFKRVELGDLDPNLTQAEKVAIATARS---------P 79

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           LQ+ ++ RH+ MI+              + L   GPA +LIG+ ++   IY ++ A GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-P 198
           AV +  + GGF  Y    VD ++ FA+ ++Y +QWL V PLE+V AS+T+ YW       
Sbjct: 140 AVTF-PVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYR 198

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
           D FV +FY++I+ IN+FG  +GY EAEF F++ K+                     GY+G
Sbjct: 199 DGFVALFYVVIVIINMFG-VKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVG 257

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YW+NPGAF G   G RFK + S  VTAAFSF  TE + + A+E  NPRKA+P AAK+V
Sbjct: 258 GKYWHNPGAFNGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQV 317

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
            +R    Y+ S+ ++G LVPY S  L+GS S    ASP+V+A+ +HGI   P  IN VIL
Sbjct: 318 FWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSVINVVIL 377

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
           ISVLSV NSS Y+ SR L  LA QG+ P+IF+Y+DRKGRPL GI+A      + F A S 
Sbjct: 378 ISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQSK 437

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
           KE +VF+WL+A+SGLS +FTWG IC+ H+RFRRA+  QGRS +EL + S VGVWGS +  
Sbjct: 438 KEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGV 497

Query: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
            ++ L+ I QFW+A+WP+     N ++FF+ YL++ ++L FY  +K + ++W    RAKD
Sbjct: 498 ILICLVFIAQFWIAVWPMGGT-PNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKD 556

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           ID+ + R   D D LKQE  + K  L     W ++Y  WC
Sbjct: 557 IDIDTGRRELDLDALKQEIAEEKLRLSTKPWWYRVYHLWC 596

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  474 bits (1220), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 242/554 (43%), Positives = 346/554 (62%), Gaps = 5/554 (0%)

Query: 47  FKKIDDNNNQYEIEKNEINNIKSDQFN-DKLNNQLQKTIQPRHVIMISXXXXXXXXXXXX 105
           +KKI D+  + E+ + + N  ++++       + LQ  ++ RH+ MIS            
Sbjct: 50  WKKIKDSFKRAEVPELDPNLTEAEKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVG 109

Query: 106 XXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFA 165
               L  AGPAG+LIG+II  S IYC++ +  E+A+ +  + GGF  Y +  +D ++ FA
Sbjct: 110 SGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAF-PVAGGFTTYATRFIDESYGFA 168

Query: 166 VAWVYCIQWLCVCPLELVTASMTIKYWN-EKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
             + Y +QW+   PLE+V AS+T+ YW+ +K   D FV +F+++I+ IN+FG  RGY EA
Sbjct: 169 NNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINMFG-VRGYGEA 227

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTL 284
           EF F++CKILM                  +GYIG  YW +PGAF G T G +FKG  S  
Sbjct: 228 EFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGAFAGDTSGRKFKGFCSVF 287

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           VTAAFSF  +E + + A+E SNPRK +P AAK+V +R    YV  ++++G LVPY  P L
Sbjct: 288 VTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRL 347

Query: 345 LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGY 404
           +G  S    ASP+VIA+ + GI   P  +N VILI+VLSV NS+ Y+ SR L  LA QG+
Sbjct: 348 IGGSSVDAAASPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGF 407

Query: 405 APKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICL 464
            PK F+Y+DR GRP+ GI   S    IAF A S KE EVF WL+A+SGLS +FTW TICL
Sbjct: 408 LPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICL 467

Query: 465 SHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANIT 524
            HIRFRRA+  QGRS NEL + S  GVWG+ +   +  ++L  QF+VAL+PL +   +  
Sbjct: 468 CHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAP-PSAN 526

Query: 525 NFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENL 584
           +FF+ YL++PI+L  + G+K WKK+W LFI+A+D+D+ + R   D D+L+Q+  + +  L
Sbjct: 527 DFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAAL 586

Query: 585 KNGSLWLKIYAFWC 598
               +W +IY F+C
Sbjct: 587 AAKPMWYRIYKFFC 600

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  468 bits (1205), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 240/521 (46%), Positives = 326/521 (62%), Gaps = 13/521 (2%)

Query: 51  DDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATL 110
           +D  N     K E  +  S+      N +L+++I+P HV MI+               ++
Sbjct: 47  EDITNDSTTGKTEKGHTGSE------NEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSI 100

Query: 111 HNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVY 170
            +AG  G L+GY I+ S + C +Q+ GE+ V + +L GGFN+Y    VD ++ F VAW++
Sbjct: 101 SDAGVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLF 160

Query: 171 CIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNL 230
           C+QW  V PLELVTASMTIKYWN  ++P +FV IFY LI+ I+ FG ARGYA+AEF FNL
Sbjct: 161 CLQWQIVLPLELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFG-ARGYADAEFLFNL 219

Query: 231 CKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFS 290
            K+LM                 TSGYIG+ Y   PGAF        FK I STLV A FS
Sbjct: 220 SKVLMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAFNTRN---TFKSICSTLVNACFS 276

Query: 291 FGQTEFLAITASEQS--NPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK 348
            G  EFLA++A+EQ+  N  K+I  A  +V+ R    Y+ SI ++G LVPYNSPEL+GS 
Sbjct: 277 CGGVEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSS 336

Query: 349 SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKI 408
           S    +SPYVIAVASHG+++ PH INAVILI+V+SVANS+ YSSSR L  LA+QG+AP  
Sbjct: 337 SEIIHSSPYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSY 396

Query: 409 FTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIR 468
           F  LD KGRP   ++ + +   ++F A    +  VF WLL+ISGLS +FTW  IC++H+R
Sbjct: 397 FAKLDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLR 456

Query: 469 FRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG-ANITNFF 527
           FR AMK Q  SL ELG+++  G++GS Y   +  L L+ QFWV+L+PL+ +G  +  NFF
Sbjct: 457 FRAAMKDQNHSLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFF 516

Query: 528 KEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIY 568
           + Y+A+P  L  Y G+K + + W   I A  ID+ + R IY
Sbjct: 517 QNYMAVPFALCLYVGHKIYTRSWQFIIPADKIDVDTSRDIY 557

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  468 bits (1204), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 252/581 (43%), Positives = 362/581 (62%), Gaps = 22/581 (3%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKK---IDDNNNQYEIEKNEINNIKSDQFNDKLNNQL 80
           TN    NE  S      +DF +SFK+   ++ + N  E EK  I            N+ L
Sbjct: 29  TNHEASNEESSG--SKWQDFKNSFKRMEVVELDPNLTEAEKIAIATA---------NSPL 77

Query: 81  QKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140
           ++ ++ RH+ MI+                L  AGPAG+LIG+ +  + IYC++ A GE+A
Sbjct: 78  KRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGELA 137

Query: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP-- 198
           V +  + GGF  Y +  +D ++ +A  + Y +QWL V PLE+V AS+T+ YW    DP  
Sbjct: 138 VTF-PVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWG--TDPKY 194

Query: 199 -DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYI 257
            D FV +FY++I++IN+FG  +GY EAEF F+  K++                    GYI
Sbjct: 195 RDGFVALFYVVIVSINMFG-VKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYI 253

Query: 258 GVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKK 317
           G + W+NPGAF G+T G RFKG+ S  VTAAFSF  +E + + ++E +NPRK++P AAK+
Sbjct: 254 GGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAKQ 313

Query: 318 VIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVI 377
           V +R    Y+ S+ ++G LVPYN   L+G+ S    ASP+V+A+ +HGI+  P  +N VI
Sbjct: 314 VFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNVVI 373

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           LI+VLSV NS+ +  SR L  LA+QG+ PKIF Y+DRKGRPL GI   S    ++F A+S
Sbjct: 374 LIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAAS 433

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
           PKE EVF WLLA+SGLS +FTW  IC+ H+RFRRA+  QGRS +EL + S  GVWGSIY 
Sbjct: 434 PKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSIYG 493

Query: 498 ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAK 557
             ++ LIL  QFW+AL+P+ S   +  +FF+ YL++P++L+ Y G+K +K++W LFIRA+
Sbjct: 494 TVLIMLILAAQFWIALFPIGSP-PDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRAE 552

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +ID+ + R   D + LK E  + K  L + SLW++ Y FWC
Sbjct: 553 NIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYYFWC 593

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  468 bits (1203), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 260/574 (45%), Positives = 360/574 (62%), Gaps = 36/574 (6%)

Query: 14  HLSVNKNVIVTNE--NQINESHSKLIE-----NLKDFVDSFKKIDDNNNQYEIEKNEINN 66
           H+S+ +    +NE  N+  E+H++  E     + K+F++ FK+   N    ++E  +   
Sbjct: 34  HISIEE---ASNETLNEKPEAHTQKCEYNPITHFKNFLNGFKRQKQNEEGADLEMQD--- 87

Query: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMA 126
                       QL KTI+ RH++MIS                L  AGP GL+IGY I +
Sbjct: 88  -----------TQLSKTIKARHLLMISLGTGIATGLLVGNGQVLSKAGPGGLVIGYFISS 136

Query: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186
             IYC+IQ+ GE+ + Y  L+G F  Y S L+D +  FA++ +Y  QWL V PL+LVTA+
Sbjct: 137 VMIYCMIQSAGELGICYRGLVGNFTRYSSLLIDPSLGFALSILYTFQWLTVLPLQLVTAA 196

Query: 187 MTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXX 246
           +TI++W + ++PD+FV I ++++I +NLFG ARGYAEAEFF NLCKILM           
Sbjct: 197 ITIEFWTD-LNPDIFVAIIFIVVIVVNLFG-ARGYAEAEFFCNLCKILMIIGFIILSIII 254

Query: 247 XXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSN 306
                   GYIG  YW NPGAF        FKG+ +    AAFS+G  E L ++  EQ N
Sbjct: 255 ISGGAGNDGYIGAKYWKNPGAF-----ANGFKGVCTVFTYAAFSYGGIEVLVLSIDEQEN 309

Query: 307 PRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS----KSSQTKASPYVIAVA 362
           P K +P+  KKV YR LFIY+ + I+V FLVPY SP+LLGS    ++S + ASP+VIAV 
Sbjct: 310 PIKVVPNCCKKVAYRILFIYLLTTILVCFLVPYTSPQLLGSLNKGENSGSHASPFVIAVE 369

Query: 363 SHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGI 422
           SHG+++ PHFINAVILISV+SVANSS YSS R+LL+L++QG  P+   Y+D++GRP+   
Sbjct: 370 SHGVKVVPHFINAVILISVISVANSSVYSSGRLLLSLSEQGTFPQFLNYIDQRGRPIRCF 429

Query: 423 IAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNE 482
           + +     I F ASS K  +VF+WLLAISGLSQ+F W  ICLSHIRFR AMK Q +S++E
Sbjct: 430 VISLTFGLIGFVASSEKRQDVFTWLLAISGLSQLFIWLAICLSHIRFRDAMKTQKKSMDE 489

Query: 483 LGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYF 541
           +GYK+Q G WGS  A  +    L+ QFWVA+ P++ NG  ++ +FF+ YLA PI+L+ YF
Sbjct: 490 VGYKAQTGYWGSWVAVLIGLFSLVTQFWVAIAPVDKNGKLDVMSFFQNYLAFPIVLVAYF 549

Query: 542 GYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQ 575
           G+K +  +W   I    IDL SHR IY  + + +
Sbjct: 550 GHKLYYGNWCPLIPLSKIDLDSHRKIYSPEEITE 583

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  462 bits (1189), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 248/597 (41%), Positives = 364/597 (60%), Gaps = 19/597 (3%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKN--EI 64
            IT D  +L+     I +N + ++          KDF DSFK+++      E++ N  E 
Sbjct: 19  GITIDSEYLTQEPITIPSNGSAVSTEKGSG-SKWKDFRDSFKRVE----PVEVDPNLTEA 73

Query: 65  NNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYII 124
             +        L +QL+     RH+ MI+                L   GPA LLIG+  
Sbjct: 74  EKVAFITAQTPLKHQLKN----RHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGS 129

Query: 125 MASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVT 184
           M + IY ++ A GE+AV +  + GGF  Y +  +D ++ FA  + Y +QWL   PLE+V+
Sbjct: 130 MGTMIYAMVMALGELAVVF-PISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVS 188

Query: 185 ASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXX 241
           AS+T+ YW    DP   D FV +F+L+I+ IN+FG  +GY EAEF F++ K++       
Sbjct: 189 ASITVNYWG--TDPKYRDGFVALFWLVIVCINMFG-VKGYGEAEFVFSIIKVITIIGFII 245

Query: 242 XXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITA 301
                        GYIG  Y+++PGAF G TPG +FKG+ S  VTAAFSF  +E + + A
Sbjct: 246 LGIILNCGGGPEKGYIGGKYFHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAA 305

Query: 302 SEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAV 361
           SE  +PRK++P AAK+V +R    Y+ S++++G LVPYN   L+G+ S    ASP+VIA+
Sbjct: 306 SESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAI 365

Query: 362 ASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFG 421
            +HGI+  P  +N VILI+VLSV NS+ ++ SR  + LA+QG+ P+IF Y+DRKGRPL G
Sbjct: 366 VTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVG 425

Query: 422 IIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLN 481
           II  S +  IAF A+S KE +VF+WLLA+SGLS +FTWG IC+ HIRFR+A+  QGRS++
Sbjct: 426 IIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVD 485

Query: 482 ELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYF 541
           EL +KS  GVWGS +   ++ ++ I QF+VAL+P+N +  +   FF+ YL+ P++L  Y 
Sbjct: 486 ELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGS-PSAEGFFEAYLSFPLVLAMYI 544

Query: 542 GYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           G+K +K++W L I A ++D+ S R   D ++LKQE  + K  L     W ++Y+FWC
Sbjct: 545 GHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAEEKAILATKPAWFRVYSFWC 601

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  457 bits (1175), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 244/575 (42%), Positives = 341/575 (59%), Gaps = 13/575 (2%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTI 84
           N NQ  E         + F+DSFK+++       + + E   I +       +  L+  +
Sbjct: 43  NYNQTGEEKGS---KWRQFIDSFKRVEVPELDPNLTEQERIAIITA------HTPLKHHL 93

Query: 85  QPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYL 144
           + RH+ MI+                L  AGPA L+IG+ I  S IY ++ A  EMAV Y 
Sbjct: 94  KSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAVLY- 152

Query: 145 TLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-PDVFVT 203
            + GGF  Y +  +D ++ FA  + Y +QWL V PLE+V+AS+T+ YW       D FV 
Sbjct: 153 PISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRDGFVA 212

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           +F+L+I+ INLFG  +GY EAEF F+  K++                  T GY+G  YW+
Sbjct: 213 LFWLVIVIINLFG-VKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAKYWH 271

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           +PGAF G T G +F+G  S  VTAAFSF  +E + I  SE  NPRKA+P AAK+V +R L
Sbjct: 272 DPGAFVGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQVFWRIL 331

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLS 383
             Y+ S++ +G LVP N   L+GS +    ASP+VIA+  HGIR  P  IN VILI+VLS
Sbjct: 332 LFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVILIAVLS 391

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
           V NS+ Y+ SR L+ LA+QG+ PK+ +Y+DR GRPL GI  +S    +AF A S KE +V
Sbjct: 392 VGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQSDKEGDV 451

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F+WLLAISGLS  FTWG ICL HIRFR A+K Q RS +EL + S +GV+GS +   ++ L
Sbjct: 452 FNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWGLFLIVL 511

Query: 504 ILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
           +L  QF+VA++P+     + TNFF  YL++P++L+ Y  +K W K+W +FI    +DL +
Sbjct: 512 MLAAQFYVAIFPVGDT-PSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLGQLDLDT 570

Query: 564 HRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            R   D D+L+QE  + +  L     W +IY FWC
Sbjct: 571 GRKQLDLDLLRQEVAEERATLAARPRWFRIYTFWC 605

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  456 bits (1174), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 249/578 (43%), Positives = 349/578 (60%), Gaps = 17/578 (2%)

Query: 26  ENQINES-HSKLIENLKDFVDSFKKIDD---NNNQYEIEKNEINNIKSDQFNDKLNNQLQ 81
           +NQI+ S ++       +F+DSFK+++    + N  ++EK  I   +S          LQ
Sbjct: 39  DNQIDSSNYASHRSAWGNFLDSFKRVEVEEVDPNLTDLEKIAIKTARS---------PLQ 89

Query: 82  KTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAV 141
             ++ RH+ MI+                L  AGPAG+LIG+ I  + I+ ++ A GE+AV
Sbjct: 90  HKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGELAV 149

Query: 142 NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-PDV 200
            +  + GGF  Y +  +D ++ FA  + Y +QWL V PLE+V AS+T+ YW   V   D 
Sbjct: 150 MF-PVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTDG 208

Query: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVS 260
           FV +F+L+++ IN+FG  RGY EAEF F++ K+                     GY+G  
Sbjct: 209 FVALFWLVVVIINMFG-VRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGAR 267

Query: 261 YWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320
           YW+NPGAF G T G +F G  S  VTAAFSF  +E + +  SE  NPRKA+PSAAK+V +
Sbjct: 268 YWHNPGAFVGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFW 327

Query: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380
           R L  Y+  ++++GFLVPYN P L+ S S    ASP+VIA+ +HGI   P  IN VILIS
Sbjct: 328 RILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILIS 387

Query: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440
           VLSV NS+ YS SR L+ L++QG+ PKI +Y+DRKGRPL GI  +S    IAF A+S K+
Sbjct: 388 VLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQ 447

Query: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500
            E+F+WLLAISGLS  FTW  IC+ HIRFR A+K QGR  +EL + S  GV GS +   +
Sbjct: 448 NEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFL 507

Query: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560
             L+LI QF++AL+P+  +  +   FF  YLA P++L FY  +K WKK+W   I  +D+D
Sbjct: 508 NILMLIAQFYIALFPIGGS-PSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVD 566

Query: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           + + R   D ++LKQE  + K  L     W ++Y FWC
Sbjct: 567 IDTGRRDTDVNLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  451 bits (1161), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 252/579 (43%), Positives = 351/579 (60%), Gaps = 22/579 (3%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDD---NNNQYEIEKNEINNIKSDQFNDKLNNQL 80
           T E+ I++S        ++F+DSFK+I+    + N  +IEK  I   +S          L
Sbjct: 44  TPESTIDKSR------WRNFLDSFKRIEVEEVDPNLTDIEKIAIKTARS---------PL 88

Query: 81  QKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140
           Q  ++ RH+ MI+                L  AGPAG+LIG+ I  + I+ ++ A GE+A
Sbjct: 89  QHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGELA 148

Query: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-PD 199
           V +  + GGF  Y +  +D ++ FA  + Y  QWL   PLE+V AS+T+ YW   V   D
Sbjct: 149 VVF-PVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGV 259
            FV +F+L+++ IN+FG  RGY EAEF F+L K++                    GY+G 
Sbjct: 208 GFVALFWLVVVIINMFG-VRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGG 266

Query: 260 SYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
            YW++PGAF GH+PG RFKG  S  VTAAFSF  +E + I ++E  NPRK++P AAK+V 
Sbjct: 267 RYWHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQAAKQVF 326

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILI 379
           +R L  Y+  +++VG LVPY  P LLGS      ASP+VIA+ +HGI   P  +N VILI
Sbjct: 327 WRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSVVNVVILI 386

Query: 380 SVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPK 439
           SVLSV NSS Y+ SR L+ L++QG+ PK   Y+DRKGRPL GI   S    IAF A+S K
Sbjct: 387 SVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFVAASNK 446

Query: 440 ETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT 499
           + ++F+WLLAISG+S   TWG+IC  HIRFR A+K+ GRS +EL +KS VG+ GS +   
Sbjct: 447 KEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGSYWGMC 506

Query: 500 VMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDI 559
           +  L+L+ QF+ AL+P+ S+  N  +FF  YLA PI+L FY  +K WK++W L I  KDI
Sbjct: 507 LAVLMLVAQFYNALFPIGSS-PNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLLIPLKDI 565

Query: 560 DLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           D+ + R   D ++LKQE  + K  L     W ++Y FWC
Sbjct: 566 DIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  451 bits (1160), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 255/556 (45%), Positives = 351/556 (63%), Gaps = 23/556 (4%)

Query: 14  HLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFN 73
            + V++  I + +  ++ S        +DF  SFK+ D             +++ SD   
Sbjct: 50  EIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKD-------------SDLDSDV-- 94

Query: 74  DKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCII 133
           +  + QL KTI+ RH++MIS                L  AGPAGL+IGY + +  IYCII
Sbjct: 95  EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCII 154

Query: 134 QACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWN 193
            A GE+ + Y  L+G F  YPS L+D +  FA++ +Y +QWL V PL+LVTA++TI +W 
Sbjct: 155 HAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT 214

Query: 194 EKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXT 253
           + V+PD+FV   ++++I +NLFG ARGYAE EFF N CKILM                  
Sbjct: 215 D-VNPDIFVLCVFIVVIIVNLFG-ARGYAETEFFCNCCKILMITGFIILSIVIITGGAGK 272

Query: 254 SGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPS 313
            GYIG  YW +PG F        FKG+ +    AAFS+G  E + ++  EQ +P  A+P+
Sbjct: 273 DGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPN 327

Query: 314 AAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFI 373
           A KKV+YR L IY+ + I+V FLVPY+SP LLGS  S + ASP+VIA+ SHG+++ PHFI
Sbjct: 328 ACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHGVKVVPHFI 387

Query: 374 NAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAF 433
           NAVILISV+SVANSS YSSSR+LL+L++QG  P+   ++D  GRP+   I + L   I F
Sbjct: 388 NAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIISILFGMIGF 447

Query: 434 CASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWG 493
            A+S K  +VF+WLLAISGLSQ+F W ++ LSHIR R AMK QG+SL+E+GYK+Q G WG
Sbjct: 448 VAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWG 507

Query: 494 SIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPILLLFYFGYKTWKKDWNL 552
           S  A  + F  L+ QFWVA+ P+  +G  ++ NFF+ YLA PI+L+ Y G+K + K+W L
Sbjct: 508 SWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRL 567

Query: 553 FIRAKDIDLISHRHIY 568
           +I A  IDL SHR IY
Sbjct: 568 WIPADKIDLDSHRRIY 583

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  446 bits (1147), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 225/493 (45%), Positives = 317/493 (64%), Gaps = 6/493 (1%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            L+++I+PRHV MIS               ++  AG  G LIGY+I+   + C +Q+ GE
Sbjct: 24  SLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGE 83

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           + V + +L GGFN+Y    +D +  F V+W++C+QW+ V PLELVTASMTIKYWN  + P
Sbjct: 84  LVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLSP 143

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
            +FV+ FY+LI  +N FG   GYAEAEF FN  K+++                  SG IG
Sbjct: 144 SLFVSAFYILICIVNFFGSG-GYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIG 202

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQS--NPRKAIPSAAK 316
             Y   PGAF  +T    FK    TLV AAFS G  EFLA++A+EQ+  N  K+I  A +
Sbjct: 203 FQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIRRACR 260

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAV 376
           +V  R    Y+ SI +VG LVPY+SP L+GS S  T  SPYV A+A HG+RI PH INAV
Sbjct: 261 QVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHIINAV 320

Query: 377 ILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCAS 436
           ILI+V+SVANS+ YSSSR L +LA+Q +AP+ F  L++ G+P+  ++ ++++  I+F A 
Sbjct: 321 ILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISFIAE 380

Query: 437 SPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIY 496
              +  VF WLL+ISGLS +FTW TIC++HIRFR A+K+QG+SL+ LGY+S  GV GS  
Sbjct: 381 YRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGSYI 440

Query: 497 AATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIR 555
           A  +  +++I QFWV+L+PL +NG  +   FF+ Y+A+P+ +L Y G+K +  DW  +IR
Sbjct: 441 ATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPWIR 500

Query: 556 AKDIDLISHRHIY 568
              +D+ + R +Y
Sbjct: 501 THCVDINTDRDVY 513

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  446 bits (1148), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 244/573 (42%), Positives = 346/573 (60%), Gaps = 17/573 (2%)

Query: 29  INESHSKLIENLK--DFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQP 86
           +++S +  +E  +   F DSFK+ D  +    +   E   I +       N  L++T++ 
Sbjct: 29  VSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAILTA------NAPLKRTLKS 82

Query: 87  RHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTL 146
           RH+ MI+                L  AGPAG+LIG+ +  + IYC++ A GE+AV +  +
Sbjct: 83  RHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTF-PI 141

Query: 147 IGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-PDVFVTIF 205
            GGF  Y S  VD ++ FA   +Y +QWL V PLE+V AS+T+ YW       D FV +F
Sbjct: 142 AGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALF 201

Query: 206 YLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNP 265
           Y++I+AIN FG  +GY EAEF F+  K++                    GYIG   W+NP
Sbjct: 202 YVVIVAINFFG-VKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNP 260

Query: 266 GAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFI 325
           GAF        FKG+ S  VTAAFSF  +E + + A+E +NPRK++PSAAK+V +R    
Sbjct: 261 GAF-----ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLF 315

Query: 326 YVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVA 385
           Y+ ++++VG LVPY S  L+G  S    ASP+VI++ + GI+  P  IN VILI+VLSV 
Sbjct: 316 YILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVG 375

Query: 386 NSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFS 445
           NS+ ++ SR +  LA QG  PKIF Y+DR GRPL GII   +   ++F A+SPKE EVF 
Sbjct: 376 NSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFD 435

Query: 446 WLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLIL 505
           WLLA+SGLS +FTWG I L HIR RRA+  Q R+  EL + +  GVWGS+Y   ++ LIL
Sbjct: 436 WLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILIL 495

Query: 506 IGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHR 565
           + QFW+AL+P+     + + FF+ YL+ PIL+ FY G+K WKK+W LFIRAK+ID+ + R
Sbjct: 496 MAQFWIALFPIGDK-PSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGR 554

Query: 566 HIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
              D + LKQE  + K  + +   + ++Y FWC
Sbjct: 555 RETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  444 bits (1142), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 217/548 (39%), Positives = 339/548 (61%), Gaps = 3/548 (0%)

Query: 52  DNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLH 111
           D+    + +   +++ +++ ++   +++L K +  RH++ ++              A+L+
Sbjct: 60  DSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLN 119

Query: 112 NAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYC 171
             GPA L++ ++I+++C++ I+ A GE+A  +  ++GGFN Y +  V+ ++ FAV   Y 
Sbjct: 120 TGGPASLIVAWVIVSTCLFTIVNALGELAAVF-PVVGGFNVYITRFVEPSFGFAVNINYL 178

Query: 172 IQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLC 231
            QW  + PLELV AS+TI+YWN  ++ D +V IFY  I   N+    + + E EF  ++ 
Sbjct: 179 AQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLD-VKSFGETEFVLSMI 237

Query: 232 KILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSF 291
           KIL                  +  YIG  YWN+PGAF G TPG RFKG+ +  VTAAFS+
Sbjct: 238 KILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSY 297

Query: 292 GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSS 350
             TE +A++A+E  NPR  +P A+K+  +     Y+  + I+G LVPYN   LL G+ S 
Sbjct: 298 SGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSV 357

Query: 351 QTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFT 410
              ASP VIA+ + GI+  P  +NA+ILI++LSVANS+ Y+ SR ++ +A+ G  PK   
Sbjct: 358 DAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLN 417

Query: 411 YLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFR 470
           Y+D++GRPL+ I A  +   ++F A+S K+ EVF+WL A+SGLS +F W +I LSHIRFR
Sbjct: 418 YIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFR 477

Query: 471 RAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEY 530
           +AMK Q RSLNEL + S  GV+GS Y   V+FL+LI  FW +L+P+ S+GA+  +FF+ Y
Sbjct: 478 QAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGY 537

Query: 531 LAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLW 590
           L++PI ++ Y G+K +KKDW L+++ KD+DL + R   D D+LKQE    +E +     +
Sbjct: 538 LSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQMAQKPFY 597

Query: 591 LKIYAFWC 598
           ++    WC
Sbjct: 598 IRFLNVWC 605

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 245/598 (40%), Positives = 361/598 (60%), Gaps = 20/598 (3%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKK---IDDNNNQYEIEKNE 63
            IT D   L+     I +N + ++   +      +DF DSFK+   I+ + N  E EK  
Sbjct: 19  GITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVA 78

Query: 64  INNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYI 123
           I   ++          L+  ++ RH+ MI+                L   GPA LLIG+ 
Sbjct: 79  IITAQT---------PLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183
              + IY ++ A GE+AV +  + GGF  Y +  +D ++ +A  + Y +QWL V PLE+V
Sbjct: 130 STGTMIYAMVMALGELAVIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIV 188

Query: 184 TASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           +AS+T+ +W    DP   D FV +F+L I+ IN+FG  +GY EAEF F+  K++      
Sbjct: 189 SASITVNFWG--TDPKYRDGFVALFWLAIVIINMFG-VKGYGEAEFVFSFIKVITVVGFI 245

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                       T GYIG  YW++PGAF G TPG +FKG+ S  VTAAFSF  +E + + 
Sbjct: 246 ILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLA 305

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           ASE   PRK++P AAK+V +R    Y+ S++++G LVPYN   L+G+ S    ASP+VIA
Sbjct: 306 ASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIA 365

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           + +HGI+  P  +N VILI+VLSV NS+ Y+ SR ++ LA+Q + P+IF+Y+DRKGRPL 
Sbjct: 366 IKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLV 425

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
           GI   S    IAF A+S KE EVF+WLLA+SGLS +FTWG IC+ HIRFR+A+  QGR L
Sbjct: 426 GIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGL 485

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY 540
           +EL +KS  GVWGS +   ++ ++ I QF+VA++P+  +  +   FF+ YL+ P++++ Y
Sbjct: 486 DELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVG-DSPSAEGFFEAYLSFPLVMVMY 544

Query: 541 FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            G+K +K++W LFI A+ +D+ + R   D D+LKQE  + K  +     W +I+ FWC
Sbjct: 545 IGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNFWC 602

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 242/598 (40%), Positives = 360/598 (60%), Gaps = 20/598 (3%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDD---NNNQYEIEKNE 63
            IT D   L+     I +N +      +      +DF DSF++++    + N  E EK  
Sbjct: 19  GITIDSEFLTQEPITIPSNGSATTNDEAGSGSKWQDFKDSFRRVEPVEVDPNLTEAEKVA 78

Query: 64  INNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYI 123
               ++          L+  ++ RH+ MI+                L   GPA LLIG+ 
Sbjct: 79  FVTAQT---------PLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183
              + IY ++ A GE+AV +  + GGF  Y +  +D ++ +A  + Y +QWL V PLE+V
Sbjct: 130 STGTMIYSMVMALGELAVIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIV 188

Query: 184 TASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           +AS+T+ +W    DP   D FV +F+L+I+ IN+FG  +GY EAEF F+  K++      
Sbjct: 189 SASITVNFWG--TDPKYRDGFVALFWLVIVIINMFG-VKGYGEAEFVFSFIKVITVVGFI 245

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                         GYIG  YW++PGAF G TPG +FKG+ S  VT+AFSF  +E + + 
Sbjct: 246 ILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPGAKFKGLCSVFVTSAFSFAGSELVGLA 305

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           ASE  +PRK++P AAK+V +R    Y+ S+++VG LVPYN P L+G+ S    ASP+VIA
Sbjct: 306 ASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIA 365

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           + +HGI+  P  +N VILI+VLSV NS+ Y+ SR ++ LA+Q + P+IF Y+DRKGRPL 
Sbjct: 366 IKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLV 425

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
           GI   S    IAF A+S KE +VF+WLLA+SGLS +FTWG IC+ HIRFR+A+  QGR L
Sbjct: 426 GIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDL 485

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY 540
           +EL +KS  GVWGS +   ++ ++ I QF+VAL+P+ ++  +   FF+ YL+ P+++  Y
Sbjct: 486 DELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGAS-PSAEGFFEAYLSFPLVVAMY 544

Query: 541 FGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            G+K +K++W LFI A+D+D+ + R   D ++LKQE  + K  +     W +I+ FWC
Sbjct: 545 LGHKIYKRNWKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWNFWC 602

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  442 bits (1137), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 231/492 (46%), Positives = 317/492 (64%), Gaps = 6/492 (1%)

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           L+++I+PRHV MIS               ++  AG  G LIGY I+   + C +Q+ GE+
Sbjct: 41  LRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCMQSVGEL 100

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPD 199
            V + +L GGFN+Y    +D +  F+V+W++C+QW+ V PLELVT SMTIKYWN  + P 
Sbjct: 101 VVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWNASLSPS 160

Query: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGV 259
           +FV++FY LI  +N FG   GYAEAEF FN  K+++                 TSG IG 
Sbjct: 161 LFVSVFYALICVVNSFGSG-GYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTSGTIGF 219

Query: 260 SYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQS--NPRKAIPSAAKK 317
            Y  +PG F  +      K    TLV AAFS G  EFLA++A+EQ+  N  K+I  A  +
Sbjct: 220 RYLIDPGMFNKNY--NIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRACNQ 277

Query: 318 VIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVI 377
           V  R    Y+ SI +VG LVP+NSP L+GS S+   +SPYV AVA +GI + PH INAVI
Sbjct: 278 VSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGITVVPHIINAVI 337

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           LI+V+SVANS+ YSSSR L +LA+Q +APK FT L++ G+P+  +  ++L   I+F A  
Sbjct: 338 LIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFVAEY 397

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
             +  +F WLL+ISGLS +FTW TIC++HIRFR A+K +G+SL  LGYKS  GV GS  A
Sbjct: 398 RDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIA 457

Query: 498 ATVMFLILIGQFWVALWPLNSNG-ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRA 556
             +  +IL+ QFWV+L+PL SNG  NI  FF+ Y+A+P+ LLFY G+K + K+W+L IRA
Sbjct: 458 TVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLLIRA 517

Query: 557 KDIDLISHRHIY 568
            ++D+ + R IY
Sbjct: 518 SNVDITTDRDIY 529

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  442 bits (1136), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 239/559 (42%), Positives = 345/559 (61%), Gaps = 10/559 (1%)

Query: 41  KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXX 100
           + F DSFKK +D     E++ N     +  Q   K    LQ T++ R   MI+       
Sbjct: 70  QKFKDSFKKAED----VELDPNLTEAERIAQATAK--APLQHTLKGRQQTMIAIGGAIGS 123

Query: 101 XXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDT 160
                    L   GPAGL+IG+ + ++ IY ++ A GE+AV +  + GGF  Y +  VD 
Sbjct: 124 GLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVF-PVAGGFTTYATRFVDE 182

Query: 161 AWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-PDVFVTIFYLLIIAINLFGGAR 219
           ++ +A  + Y +QWL V PLE+V+AS+T+ YW       D FV +F+L+I+ IN+FG  +
Sbjct: 183 SFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFG-VK 241

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
           G+ EAEF F++ K+                     G++G  YW++PGAF GH  G +FKG
Sbjct: 242 GFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKG 301

Query: 280 IVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339
           + S  VTAAFSF  +E + ITA+E +NPRK+IP AAK+V++R +  Y+G++ ++G LVPY
Sbjct: 302 VCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPY 361

Query: 340 NSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
           N   L+G+ S    ASP+VIA+ +HGI+  P  IN VILI+VLSV NS+ ++ SR +  L
Sbjct: 362 NDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAAL 421

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           + QG+ PK+F Y+DR GRPL GI   S    +AF A+S KE EVF+WLLA+SGLS +FTW
Sbjct: 422 SDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTW 481

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
           G ICL HIRFR A+K QGR  NEL + S  GV GS +   ++ L+ I QF+VAL+P    
Sbjct: 482 GGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGK 541

Query: 520 GANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
             +   FF+ YL+ PI++  YFG+K +K++W LFI  +D+D+ + R   D ++LKQE  +
Sbjct: 542 -PDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIME 600

Query: 580 YKENLKNGSLWLKIYAFWC 598
            K  L +   +++ YAFWC
Sbjct: 601 EKAILASKPWYIRAYAFWC 619

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  440 bits (1132), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 242/599 (40%), Positives = 354/599 (59%), Gaps = 15/599 (2%)

Query: 6   PSI--TKDGLHLSVNKNVI---VTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE 60
           PS+   K+  ++S  +NV+    + E+  N S+ K     KDF DSFK++D  +    + 
Sbjct: 11  PSVIDEKNKNYISNQENVVESGASQEDYSNSSYPKSGSKWKDFKDSFKRMDSVDLDPNLT 70

Query: 61  KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLI 120
             +   I + Q      + LQ+ ++ RH+ MI+                L  AGPAG+LI
Sbjct: 71  DAQKIAILTSQ------SPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILI 124

Query: 121 GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPL 180
           G+ +MA+ I C+  + GEMAV +  + GG+  Y +  +D ++ FA    Y +Q L V PL
Sbjct: 125 GWGLMATMILCMCLSLGEMAVTF-PVSGGYTTYATRFIDESYGFANNINYMMQALVVLPL 183

Query: 181 ELVTASMTIKYWNEKVD-PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXX 239
           E+V AS+T+ YW  K      FV +F+L I++IN+FG  +GY EAEF F+L K++     
Sbjct: 184 EIVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFG-VKGYGEAEFVFSLIKVVTVIGF 242

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAI 299
                        T  YIG  +W+NPGAF G T G +FKGI S  VTAAFSF  TE + +
Sbjct: 243 IILGVILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQKFKGICSVFVTAAFSFANTELVGL 302

Query: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVI 359
            A+E  +PRK++P AAK+V +R    Y+ S+++VG LVPY  P LLGS      ASP+V+
Sbjct: 303 AAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVL 362

Query: 360 AVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPL 419
           A+ +HGI+  P  IN VIL +VLSV NSS +S SR L  L++QG+ P +F Y+DRKGRPL
Sbjct: 363 ALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPL 422

Query: 420 FGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRS 479
             II +S    + F A S +  E+F W+L++SGLS +F W TI L HIRFR+A+  Q RS
Sbjct: 423 VSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRS 482

Query: 480 LNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLF 539
           ++EL + S +G+WGS Y+  ++ ++LI QFW+AL+P      + +NFFK YL+MPI +  
Sbjct: 483 IDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFP-GHQKPSASNFFKAYLSMPIAVAM 541

Query: 540 YFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           Y G+K + K+W L I  K +D+ + R   D ++ KQE  +    +       ++Y FWC
Sbjct: 542 YLGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQNAIMAKKPFIYRVYNFWC 600

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  439 bits (1129), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 241/564 (42%), Positives = 343/564 (60%), Gaps = 20/564 (3%)

Query: 41  KDFVDSFKKIDD---NNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXX 97
           + F DSFK +D+    ++  +IEK     I     +  L + L+     RH+ MI+    
Sbjct: 48  RKFKDSFKPLDEAVVTDDMSDIEK-----IAHRTAHAPLKHHLKN----RHLQMIAIGGA 98

Query: 98  XXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFL 157
                       L  AGPAG+LIG+ +  + IYC++ A GE++V +  + GGF  Y +  
Sbjct: 99  IGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVF-PISGGFTTYATRF 157

Query: 158 VDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP---DVFVTIFYLLIIAINL 214
           +D ++ FA  + Y +QWLCV PLE+V AS+T+ YW    DP   D FV +F+++I+ INL
Sbjct: 158 IDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWG--TDPKYRDGFVALFWVVIVIINL 215

Query: 215 FGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPG 274
           FG  +GY EAEF F++ K+L                    GYIG  Y+++PGAF G T G
Sbjct: 216 FG-VKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAG 274

Query: 275 TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVG 334
            RF+G+ S  VTAAFSF  +E + I A+E + PRK++P AAK+V +R    Y+ S+++VG
Sbjct: 275 ARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVG 334

Query: 335 FLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSR 394
            LVPY    L+G+ S    ASP+VIA+ SHGIR  P  +N VILI+VLSV NS+ Y  SR
Sbjct: 335 LLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSR 394

Query: 395 MLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLS 454
            L  LA+Q + PKIF Y+DR GRPLFGI   S    +AF A S KE EVF+WLLA+SGLS
Sbjct: 395 TLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLS 454

Query: 455 QVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALW 514
            +FTWG IC  HIRFR A+  QGRS +EL +K+  G++GS++   ++ L+ + QF+VAL+
Sbjct: 455 SLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALF 514

Query: 515 PLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLK 574
           P      +   FF+ YL+ P++L FYFG+K + ++W L I    +D+ + R   D DVL+
Sbjct: 515 PPGGK-PSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLR 573

Query: 575 QEKNQYKENLKNGSLWLKIYAFWC 598
           QE  + K+ +     W + Y+FWC
Sbjct: 574 QEIAEEKQMMSTRPWWYRWYSFWC 597

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 241/609 (39%), Positives = 349/609 (57%), Gaps = 32/609 (5%)

Query: 7   SITKDGLHLSVNK---NVIVTNENQ-----------INESHSKLIENLKDFVDSFKKIDD 52
           SI ++   L  +K   NV+V N +Q             E+HS+       F +SFK+ ++
Sbjct: 2   SIIEEKTRLPASKGGDNVVVENISQEPVSYDQSQGSSTEAHSRW----GRFKESFKRAEE 57

Query: 53  NNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHN 112
                 + + E   IK+ Q      + L+  ++ RH+ MI+                L  
Sbjct: 58  MELDPNLTEAERIAIKTAQ------SPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRT 111

Query: 113 AGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCI 172
           AGPAG+LIG+ +  + IY ++ A GE+AV +  + GGF  Y +  VD ++ FA  ++Y +
Sbjct: 112 AGPAGILIGWGLTGTMIYSMVMAVGELAVVF-PVAGGFTTYATRFVDESFGFAANFIYML 170

Query: 173 QWLCVCPLELVTASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFN 229
           QWL V PLE+V AS+T+ YW    DP   D FV +FY++I+ IN+FG  +GY EAEF F+
Sbjct: 171 QWLVVLPLEIVAASITVNYWG--TDPKYRDGFVALFYVVIVIINMFG-VKGYGEAEFIFS 227

Query: 230 LCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAF 289
             K++                     YIG  YW NPGAF G T G +F+G  +  VTAAF
Sbjct: 228 FIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAFVGDTAGQQFQGFCTVFVTAAF 287

Query: 290 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKS 349
           SF  +E + +  SE   PRK++P AAK+V +R    Y+  ++++G LVP +SP L+G+ S
Sbjct: 288 SFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASS 347

Query: 350 SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIF 409
               ASP+VIA+ +HGI+  P  +N VILI+VLSV NS+ YS SR L  LA QG+ P I 
Sbjct: 348 VDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSIC 407

Query: 410 TYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRF 469
            Y+DR GRPL GI  ++    IAF A S KE +VF+WL+A+SGLS +FTW  ICL HIR+
Sbjct: 408 GYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRY 467

Query: 470 RRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKE 529
           R A+  QGRS +EL +++  GVWGS +   +  L+ I QF+V L+P  +   N  +FF  
Sbjct: 468 RGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTK-PNAYDFFLA 526

Query: 530 YLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSL 589
           YL+  I +  Y  +K WK++W LFI  KD+D+ + R   D DVL++E  + +  L     
Sbjct: 527 YLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVDLDVLREELAEERAALAARPF 586

Query: 590 WLKIYAFWC 598
           W + + FWC
Sbjct: 587 WYRSWKFWC 595

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  434 bits (1117), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 246/580 (42%), Positives = 344/580 (59%), Gaps = 16/580 (2%)

Query: 23  VTNENQINESHSKLIENLKDFVDSFKKIDDNN---NQYEIEKNEINNIKSDQFNDKLNNQ 79
           +++ N  NES   +      FVDSFK+I+      N  + EK  I   +S          
Sbjct: 36  LSSNNNDNESRGSIRCKWTRFVDSFKRIELEELDPNLTDAEKIAIATARS---------P 86

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           L+ T++ RH+ MI+                L  AGPAG+LIG+ +  + IY ++ A GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-P 198
           AV +  + GGF  Y +  +D ++ FA+ + Y +QWL   PLE+V+AS+T+ YW       
Sbjct: 147 AVVF-PVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYR 205

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
           D FV +F++  + INLFG  +GY EAEF F + K++                    GYIG
Sbjct: 206 DGFVALFWVFTVIINLFG-VKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIG 264

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YW++PGAF G T G +FKG  +  +TA+FSFG +E + +  SE  NPRK++P AAK+V
Sbjct: 265 AKYWHHPGAFVGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAAKQV 324

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
            +R    YV  ++++G LVPYN   L+G+ S    ASP+VIAV + GIR  P  IN VIL
Sbjct: 325 FWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINVVIL 384

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
           ISVLSV NSS Y  SR L  LA+QG+ PKI  Y+DR GRPL  I  AS    IAF A S 
Sbjct: 385 ISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESS 444

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
            E EVF+WLLA+SGLS +F+W  IC+ HIRFRRA+  QGRS +EL + S VG+ GS +  
Sbjct: 445 HEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGI 504

Query: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
            +  L+LI QF+V L+P  ++  N  +FF  YL+ PI+L FY  +K WKK+W L+I+A+D
Sbjct: 505 FICVLMLIAQFYVGLFPAGAS-PNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAED 563

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +D+ + R   D D+LKQE    + +L    +W + + FWC
Sbjct: 564 MDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCWKFWC 603

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  433 bits (1114), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 248/609 (40%), Positives = 356/609 (58%), Gaps = 22/609 (3%)

Query: 1   MSSLSPSITKDG--LHLSVNKNVIVTNENQINESHSKLIENLKD-----FVDSFKKIDDN 53
           MSS       DG   HL V    I       + S +   E+ K      FVDSF++    
Sbjct: 1   MSSSYEKDISDGKDAHLRVESEFISQEPLSHDLSSTGSEEHKKGKVWTRFVDSFRE---- 56

Query: 54  NNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNA 113
             + E++ N ++ +    F    N+ LQ  ++ RH+ MI+                L  A
Sbjct: 57  RERLEVDPN-MSELDQIAFRTA-NSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTA 114

Query: 114 GPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQ 173
           GPAG+LIG+ +  + IY ++ A GE+AV +  + GGF  Y +  +D ++ FA    Y +Q
Sbjct: 115 GPAGILIGWGLTGTMIYSMVMALGELAVLF-PVSGGFTTYATRFIDESYGFANNINYMLQ 173

Query: 174 WLCVCPLELVTASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFNL 230
           WL V PLE+V AS+T+ YW    +P   D FV +F+L I  INLFG  +GY EAEF F++
Sbjct: 174 WLVVLPLEIVAASITVNYWG--TNPRYRDGFVALFWLAIFIINLFG-VKGYGEAEFIFSI 230

Query: 231 CKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNP-GAFRGHTPGTRFKGIVSTLVTAAF 289
            K++                    GYIG  YW++P GAF G + G RFKG+ S  VTAAF
Sbjct: 231 IKVITVVGFIILGIILNCGGGPVKGYIGGRYWHHPYGAFVGDSAGARFKGVCSVFVTAAF 290

Query: 290 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKS 349
           SF  +E + + ++E +NPRK++P AAK+V +R    Y+ ++ +VG LVPY    L+G+ S
Sbjct: 291 SFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASS 350

Query: 350 SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIF 409
               ASP+VIA+ +HGIR  P  +N VILI+VLSV NS+ Y+ SR L  LA+Q + PK F
Sbjct: 351 VDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFF 410

Query: 410 TYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRF 469
            Y+DR GRPL+ I+  S    +AF A S KE EVF+WLLA+SGLS +FTWG ICL HIRF
Sbjct: 411 GYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRF 470

Query: 470 RRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKE 529
           R+A+  QGR  +EL + S  GV+GS +   ++ L+ I QF+VAL+P  +   N   FF+ 
Sbjct: 471 RKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAK-PNAKAFFEA 529

Query: 530 YLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSL 589
           YL+ PI++  Y G+K +KK+W +FI+A+D+D+ + R   D D+L+QE  + +  L     
Sbjct: 530 YLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLATKPW 589

Query: 590 WLKIYAFWC 598
           W + + FWC
Sbjct: 590 WYRWWVFWC 598

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  428 bits (1101), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 228/576 (39%), Positives = 342/576 (59%), Gaps = 7/576 (1%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           T  +++  + S+  ++  D  DS +K  D  +  E +  E  +  S +  D+ + +  K 
Sbjct: 20  TQPSRLRSARSRY-DSADDRADSKQK--DLMSGSETKALENLDSTSQEVEDQ-DARYNKD 75

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           +  RH++ ++              A L   GP  L+I ++I+++C++ I+ A GE++  +
Sbjct: 76  LSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTF 135

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
             ++GGFN Y S  V+ ++ FAV   Y  QW  + PLELV AS+TI+YWN  ++ D +V 
Sbjct: 136 -PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVA 194

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IFY +I+  NL    + + E EF  ++ KIL                    GYIG  YW+
Sbjct: 195 IFYTIILLANLLD-VKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWS 253

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           NPGAF GHT G RF G+ S  VTAAFS+  TE +A++A+E  NPR  +P A K+  +   
Sbjct: 254 NPGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLIT 313

Query: 324 FIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVL 382
             Y+  + +VG LV  + P LL GS S    ASP VIA+ + GI+  P  +NA+ILI+VL
Sbjct: 314 VCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVL 373

Query: 383 SVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETE 442
           SVANS+ Y+ SR + ++A+ G  PK+FTY+DRKGRPL+ I+A  +   ++F A+S K+ E
Sbjct: 374 SVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEE 433

Query: 443 VFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMF 502
           VF+WL A+SGLS +F W  I +SHIRFRR MK +GR+L+EL + S  GVWGS Y   V+F
Sbjct: 434 VFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIF 493

Query: 503 LILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562
           ++L+  FW +L+P    GAN  +FF+ YL+ PILL  YFG+K + + W L    K+IDL 
Sbjct: 494 IVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLD 553

Query: 563 SHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           S R   D +++K EK   ++ ++  SL+ +    WC
Sbjct: 554 SGRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  428 bits (1101), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 232/602 (38%), Positives = 345/602 (57%), Gaps = 26/602 (4%)

Query: 10  KDGLHLSVNKNVIVTNENQINESHSKLIENLKD---FVDSFKKIDD---NNNQYEIEKNE 63
           +   ++S  +   V+ +  ++E  S   E  K    FVD+F++ +    + N  E EK  
Sbjct: 16  EKSFYVSGKEQARVSTDLAVDEPISVQPEPRKGWNGFVDTFRRAEMPVIDPNLSEAEKLA 75

Query: 64  INNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYI 123
           I    +          L + ++ RH+ MI+                L  AGPAG+LIG+ 
Sbjct: 76  IRTAAA---------PLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWG 126

Query: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183
           + A+ I  +  + GE+AV +  + GG+  Y +  +D +W FA  + Y +Q + V PLE+V
Sbjct: 127 LTATMILIMCLSLGELAVTF-PVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIV 185

Query: 184 TASMTIKYWNEKVDPD---VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
            AS+T+ YW+   DP     FV +F+++I++INLFG  RG+ EAE  F+L K++      
Sbjct: 186 AASVTVGYWD--TDPKYKLAFVALFWVVIVSINLFG-VRGFGEAESIFSLIKVITIIGFI 242

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                           IG  YWN+PG F G+ P  +FKG+ S  VTAAFSF  +E + + 
Sbjct: 243 IMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGVCSVFVTAAFSFAGSELIGLA 302

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           A+E   PRK+IP AAK+V +R    Y+ S++IVG LVP N+  LL  +      SP+VIA
Sbjct: 303 AAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIA 362

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           +  H IR+ P  IN VIL +V+SV NSS YSSSR +  LA+ G+ PKIF Y+DRKGRPLF
Sbjct: 363 MDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLF 422

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
            I   SL   + F A + +E E+F WLLAISGLS  FTW TI L+H+RFR A+K QGR+ 
Sbjct: 423 AICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTT 482

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITN----FFKEYLAMPIL 536
           NEL + S  G  GS YA  ++ ++L+ QFWVAL+P + +G +       FFK+YL+  + 
Sbjct: 483 NELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVA 542

Query: 537 LLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAF 596
           ++ Y  +K W ++W  FI+AK++D+ + R   D ++ K+E  Q +  L      ++++ F
Sbjct: 543 IVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEELAQERALLAQKPFIIRVFNF 602

Query: 597 WC 598
           WC
Sbjct: 603 WC 604

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  425 bits (1092), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/524 (41%), Positives = 329/524 (62%), Gaps = 5/524 (0%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           N  L K +  RH++ ++                L + GPA L++G++I+++C++ +I + 
Sbjct: 40  NTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSL 99

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GE+A  +  ++GGFN Y +  VD +  FAV   Y  QWL + PLELV AS+TIKYWN+K+
Sbjct: 100 GELAAAF-PIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKI 158

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
           + D +V IFY+ I+  N+    + + E EF  ++ KIL                  + GY
Sbjct: 159 NSDAWVAIFYVTIVLANMLE-VKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 257 IGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           +G  YWNNPGAF G T  ++FKG+ S  VTAAFSF   E +A++A+E  NPRK IP AAK
Sbjct: 218 LGFKYWNNPGAFVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAK 277

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSS-QTKASPYVIAVASHGIRIAPHFINA 375
           +  +     YV  + +VG LVPYN   LL + +S    ASP VIA+ + GI+  P  +NA
Sbjct: 278 RTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNA 337

Query: 376 VILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCA 435
           +ILI+++SVANS+ Y+ SR ++++A  G  PK+ + +D+KGRP+  +I   +   ++F A
Sbjct: 338 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIA 397

Query: 436 SSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSI 495
           +S K+ EVF+WL A+SGLS +F W  I  S IRFRRAM++Q RSL+EL Y SQ G+WG+ 
Sbjct: 398 ASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAW 457

Query: 496 YAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW-KKDWNLFI 554
           Y   V+FL+++  FW +++PL S  A+  +FF+ +L++PILL+ YFG+K +  ++W L I
Sbjct: 458 YGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQI 517

Query: 555 RAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            A+++D+ S R I DE+ LKQE+ + +E   N S  +K +  WC
Sbjct: 518 GAEEMDIDSGRKIIDEEGLKQEREE-EEKAMNSSFLIKFWHVWC 560

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  426 bits (1094), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/529 (41%), Positives = 319/529 (60%), Gaps = 3/529 (0%)

Query: 71  QFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIY 130
           Q  D  N  L K +  RH++ ++              A L   GPA L+I ++I+++C++
Sbjct: 77  QQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLF 136

Query: 131 CIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIK 190
            +I + GE++  +  ++GGFN Y    V+ ++ FAV   Y  QWL + PLELV AS+TIK
Sbjct: 137 TVINSLGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 191 YWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXX 250
           YWN+K++ D +V IFY  I   N+    + + E EF  ++ KIL                
Sbjct: 196 YWNDKINSDAWVAIFYATIAMANMLD-VKSFGETEFVLSMIKILAIIGFTILGIVLSCGG 254

Query: 251 XXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
               GYIG  YWN+PGAF GH  GT+FKG+ S  VTAAFS+   E  A++A+E  NPR+ 
Sbjct: 255 GPHGGYIGGKYWNDPGAFVGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIA 369
           IP AAK+  +     YV  + ++G LVP N P LL GS S    +SP VIA+ +  I+  
Sbjct: 315 IPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGL 374

Query: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429
           P  +NA+ILI+V+SVANS+ Y+ SR ++ +A  G  PK    +D++GRP+  I+      
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFG 434

Query: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489
            ++F A+S K+ EVF+WL A+SGLS +F W  I LSHIRFR+AMK Q RSL+EL + SQ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQT 494

Query: 490 GVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKD 549
           GVWGSIY   V+FL+LI  FW +++P+ S+GAN  +FF+ YL+ PIL++ YFG+K + +D
Sbjct: 495 GVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRD 554

Query: 550 WNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           W L ++ +D+DL + R   D ++ +QE    +E L   S   +    WC
Sbjct: 555 WRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRFLRVWC 603

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  422 bits (1086), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/538 (39%), Positives = 332/538 (61%), Gaps = 8/538 (1%)

Query: 60  EKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
           +    N+I +        N+L+++I+P HV M+S               ++  AG  G L
Sbjct: 17  DPTRTNSIDTTADVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTL 76

Query: 120 IGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCP 179
           +GY+I+   + C +Q  GE+ V + ++ GGF +Y    +D +  F ++W++ + W  V P
Sbjct: 77  VGYLIIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLP 136

Query: 180 LELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXX 239
           LE+  ASMTI +WNE ++P + V + Y L+  +N FG AR YA+A+  FN  K+LM    
Sbjct: 137 LEICVASMTINFWNENINPSIVVALCYSLVCGVNFFG-ARCYADADCIFNCLKVLMILGF 195

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAI 299
                        TSGY+G  Y+++PG FR       FK I +TL+TA FS G TEF+A+
Sbjct: 196 IILGIFVNTGVVGTSGYLGFKYFHSPGFFRNDE--GLFKSIAATLITACFSTGGTEFVAL 253

Query: 300 TASEQSN---PRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASP 356
           + +EQ+    PR +I  A+ +V+ R   I+  S++I+G LVP+NSP L+GS S  T ASP
Sbjct: 254 SCAEQNTEDMPR-SIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASP 312

Query: 357 YVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKG 416
           YV+A+ ++G+RI PH +NA+IL+S++SVAN++ YSSSR L +LA+QG+A K F  LD  G
Sbjct: 313 YVVALTTNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESG 372

Query: 417 RPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQ 476
           +P   +  ++     +F A    +  VF WLL+ISGLS +FTW   C+SH+RFR+AMK Q
Sbjct: 373 KPFRCLCVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQ 432

Query: 477 GRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA-NITNFFKEYLAMPI 535
            ++L++LGY+S  GV+GS  +  +  +ILI QFWV+L+PL SNG  N+ +F + Y+A+PI
Sbjct: 433 DQALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPI 492

Query: 536 LLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKI 593
            ++ Y G+K +  +W  FIRA +ID+ + R IY  D +  +K+ + E L +G +  K+
Sbjct: 493 TIVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIYCVDEVTGKKSVFVELLDSGDMCSKL 550

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  424 bits (1089), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 223/564 (39%), Positives = 336/564 (59%), Gaps = 9/564 (1%)

Query: 38  ENLKDFVDSFKKIDDN--NNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXX 95
           +N  DF +      D+  N+Q+       ++IK D     +N  L      RH+I ++  
Sbjct: 46  KNRYDFKEETTSFSDDRFNSQHSYNPGSPDDIKEDIHTSNMNQDLNV----RHLITLAVG 101

Query: 96  XXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPS 155
                       A+L+  GPA L+IG+ I+++ ++ +I + GE+A  Y  ++GGFN Y +
Sbjct: 102 GAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGELAAAY-PVVGGFNVYMT 160

Query: 156 FLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLF 215
             VD ++ F+V   Y +QWL + PLELV AS+TI+YW++ ++ D +V IFY LI+  NL 
Sbjct: 161 RFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDTINSDAWVAIFYTLILIANLL 220

Query: 216 GGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT 275
              + + E EF  +L KIL                    GYIG  YW++PGAF G + GT
Sbjct: 221 D-VKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGKYWHDPGAFVGDSAGT 279

Query: 276 RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGF 335
           +FKG+ S  VTAAFS+   E +A++A+E  NPRK IP+AAK+  +   F Y+  + +VG 
Sbjct: 280 QFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGC 339

Query: 336 LVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSR 394
           LV YN   LL GS S    ASP VIA+ + GI+  P  +NA+ILI++LSVANS+ Y+ SR
Sbjct: 340 LVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSR 399

Query: 395 MLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLS 454
            ++++A  G  PK  + +D++GRPL  I        ++F A+S K+ EVF+WL A+SGLS
Sbjct: 400 CMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLS 459

Query: 455 QVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALW 514
            +F W  I ++HIRFR+AM +Q RSL+E+ Y SQ G++GS Y   ++FL+LI  FW +L+
Sbjct: 460 TIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLF 519

Query: 515 PLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLK 574
           PL  +GA+   FF+ YL+ PIL+  Y G+K + K+W +    ++IDL++ R   D D+LK
Sbjct: 520 PLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLEEIDLLTGRKEVDIDILK 579

Query: 575 QEKNQYKENLKNGSLWLKIYAFWC 598
           +E    +E L+  S   +    WC
Sbjct: 580 EELKIEREALRQSSFMKRFLLIWC 603

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  422 bits (1085), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/601 (37%), Positives = 347/601 (57%), Gaps = 27/601 (4%)

Query: 1   MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE 60
           +  LSP +  D  H      V V + N+            ++FVD F+++        +E
Sbjct: 25  VEELSPDVESDQNHDYYKDKVHVNDPNK---------SRFQNFVDGFREL-------RME 68

Query: 61  KNEIN-NIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
             + N            ++ L++ ++ RH+ MI+                L   GPA ++
Sbjct: 69  DVDPNLTAAERAAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVV 128

Query: 120 IGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCP 179
           I +I+  S +Y ++QA GE+AV  L + G + +Y S  ++ ++ FA+A+ Y I  L   P
Sbjct: 129 IAWIMTGSMVYSVVQALGELAVA-LPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMP 187

Query: 180 LELVTASMTIKYWN-EKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL-MXX 237
           LEL+ AS+T+ YW+ +    D FV +FY++I+ INLFG  +GY EAEF F++ K+  +  
Sbjct: 188 LELIAASITVNYWDVDSKYADAFVALFYIVIVGINLFG-VKGYGEAEFVFSVIKVTAIVG 246

Query: 238 XXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFL 297
                            GYIG  YW NPG F        FKG  +  VT+AFSF  +E  
Sbjct: 247 FIILGIVLVCGGGPSDEGYIGARYWYNPGGF-----AHGFKGFAAIFVTSAFSFAGSEMF 301

Query: 298 AITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPY 357
           A+ A+E  NPRK +P AAK+V +R    YV S+ ++G LVPY    L  + S    ASP+
Sbjct: 302 ALAAAETENPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPF 361

Query: 358 VIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGR 417
           VIA+A  GI+  P  +N VILI+VLSV N   Y++SR +L+LA  G+ P+ F Y+DRKGR
Sbjct: 362 VIAIARAGIKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGR 421

Query: 418 PLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQG 477
           PL GI+  ++   ++F ++S    EVF W+LAISGL+  F WG+IC+ H+RFRRA+ +QG
Sbjct: 422 PLVGILLCAIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQG 481

Query: 478 RSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILL 537
           RS +EL YK+Q G+WGS+Y   ++F++L  QFWVAL+P+  +  N  +FF  YL++P+++
Sbjct: 482 RSTDELSYKAQTGIWGSLYGIGLIFIVLCFQFWVALFPIGGS-PNANHFFSAYLSLPVVI 540

Query: 538 LFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFW 597
            FY  +K + + W   I++ DID+ + R   D ++LKQE  + ++ +++  +W +IY FW
Sbjct: 541 FFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFW 600

Query: 598 C 598
           C
Sbjct: 601 C 601

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  421 bits (1082), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/541 (40%), Positives = 324/541 (59%), Gaps = 14/541 (2%)

Query: 59  IEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGL 118
           IE+ +INN             L K +  RH++ ++              A L   GPA L
Sbjct: 76  IEQEDINN-----------TNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASL 124

Query: 119 LIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVC 178
           +I ++I+++C++ +I + GE++  +  ++GGFN Y    V+ ++ FAV   Y  QWL + 
Sbjct: 125 VIDWVIISTCLFTVINSLGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLL 183

Query: 179 PLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXX 238
           PLELV AS+TIKYWN+K++ D +V IFY  I   N+    + + E EF  ++ KIL    
Sbjct: 184 PLELVAASITIKYWNDKINSDAWVAIFYATIALANMLD-VKSFGETEFVLSMIKILSIIG 242

Query: 239 XXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLA 298
                           GYIG  YW++PGAF GH+ GT+FKG+ S  VTAAFS+   E  A
Sbjct: 243 FTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTA 302

Query: 299 ITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPY 357
           ++A+E  NPR+ IP AAK+  +     YV  + ++G LVP N P LL GS S    +SP 
Sbjct: 303 VSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPL 362

Query: 358 VIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGR 417
           VIA+ + GI+  P  +NA+ILI+V+SVANS+ Y+ SR ++ +A  G  PK    +D++GR
Sbjct: 363 VIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR 422

Query: 418 PLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQG 477
           P+  I+       ++F A+S K+ EVF+WL A+SGLS +F W  I LSHIRFR+AMK+Q 
Sbjct: 423 PMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQE 482

Query: 478 RSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILL 537
           RSL+EL + SQ GV GS Y   V+FL+LI  FW +L+PL S+GAN  +FF+ YL+ PIL+
Sbjct: 483 RSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILI 542

Query: 538 LFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFW 597
           + YFG+K + ++W L ++ +DIDL + R   D  + ++E    +E L   S   +   FW
Sbjct: 543 VCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFW 602

Query: 598 C 598
           C
Sbjct: 603 C 603

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  420 bits (1080), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 236/559 (42%), Positives = 333/559 (59%), Gaps = 15/559 (2%)

Query: 41  KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXX 100
           + F DSF++ +  +    +   E   I +       N  L++T++ RH+ MI        
Sbjct: 43  ERFKDSFREAETVDLDPSLTPAEKMAILTA------NAPLKRTLKSRHLQMIGIGGAIGT 96

Query: 101 XXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDT 160
                   +L  AGPAG+LIG+ +  + IYC++ A GE+AV +  + GG+  Y S  VD 
Sbjct: 97  GLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTF-PVAGGYTTYASRFVDE 155

Query: 161 AWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD-PDVFVTIFYLLIIAINLFGGAR 219
           ++ FA   VY + WL   PLE+V AS+T+ YW       D FV +FY++I+ INLFG  +
Sbjct: 156 SFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFG-VK 214

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
           GY EAEF F+  K++                    GYIG   W+NPGAF        FKG
Sbjct: 215 GYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAF-----ANGFKG 269

Query: 280 IVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339
           + S  VTAAFSF  +E + + A+E +NPRK+IPSAAK+V +R    Y+ ++++VG LVPY
Sbjct: 270 VCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPY 329

Query: 340 NSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTL 399
            S  L+G  S    ASP+VI++ + GI+  P  IN VILI+VLSV N + +  SR +  L
Sbjct: 330 TSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAAL 389

Query: 400 AKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTW 459
           A QG  PKIF Y+DR GRPL GI+   +   ++F A+SPKE EVF WLLA+SGLS +FTW
Sbjct: 390 ANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTW 449

Query: 460 GTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSN 519
           G I L HIR RRA+  Q R+  EL + +   VWGS+Y+  ++ LILI QFW+AL+P+   
Sbjct: 450 GGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGK 509

Query: 520 GANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
             +   FF+ YL+ PI ++FY G+K WKK+W LFI+A DID+ S R   D + LKQE  +
Sbjct: 510 -PSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAE 568

Query: 580 YKENLKNGSLWLKIYAFWC 598
            K  + +   + ++Y FWC
Sbjct: 569 EKAFIASKPFYYRMYKFWC 587

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  419 bits (1078), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 227/599 (37%), Positives = 358/599 (59%), Gaps = 27/599 (4%)

Query: 10  KDGLHLSVNKNVIVTNENQINESHSKLIEN-----LKDFVDSFK--KIDD-NNNQYEIEK 61
           K   +L   +++  ++EN+  + + +  ++     + +FVD F+  K+DD + N    E+
Sbjct: 15  KKDQNLYFTQDIETSSENEGYDKYERESKSSSKSWIHNFVDGFREYKLDDVDPNLSSTER 74

Query: 62  NEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIG 121
             I   +S          L++ ++ RH+ MI+                L   GPA +++ 
Sbjct: 75  AAIATARS---------PLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILA 125

Query: 122 YIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLE 181
           +I+  S +Y ++QA GE+ V  L + G + +Y S  +D ++ FA+A+ Y +  L   PLE
Sbjct: 126 WILTGSMVYSVVQAIGELCVA-LPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLE 184

Query: 182 LVTASMTIKYWN-EKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL-MXXXX 239
           +V AS+T+ YWN +    D FV +FY+ ++ IN F G +GY EAEF F++ K+L +    
Sbjct: 185 IVAASITVDYWNVDHKYADGFVALFYVTVLLIN-FLGVKGYGEAEFVFSIIKVLAIVGFI 243

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAI 299
                         +GYIG  YW+NPG F        FKG  +  VT+AFSF  +E  A+
Sbjct: 244 ILGIVLVCGGGSNNTGYIGTKYWHNPGGF-----AHGFKGFAAIFVTSAFSFSGSEMFAL 298

Query: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVI 359
            A+E  NPR+ +P AAK+V +R    Y+ S+ ++G LVPY +  L  S S    ASP+VI
Sbjct: 299 GAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVI 358

Query: 360 AVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPL 419
           A+   GI   P  IN VIL++VLSV N+  ++SSR  L+LA  GY PK F Y+DRKGRPL
Sbjct: 359 AIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPL 418

Query: 420 FGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRS 479
            G+I + +   ++F +SS  +  VF W+LA+SGL   FTWG+IC+ H+RFR+ ++ QGRS
Sbjct: 419 AGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRS 478

Query: 480 LNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLF 539
            +EL +K+Q G+WGSIY  T++ ++L  QFWVAL+PL S   +  +FF++YL++P++++F
Sbjct: 479 TDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPL-SKSPSAYHFFEQYLSLPVVIVF 537

Query: 540 YFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           Y G+K + ++W L I AK++DL + R   D ++LKQE  +  E++++  +W +IY FWC
Sbjct: 538 YMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSRPIWYRIYRFWC 596

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  419 bits (1076), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 228/578 (39%), Positives = 342/578 (59%), Gaps = 6/578 (1%)

Query: 9   TKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIK 68
           T  G  LS   N I  N + I E  S  ++     + +       N       N+ N + 
Sbjct: 21  TPQGSSLSGGNNSIEMNSSFITEKRSNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLS 80

Query: 69  SDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASC 128
            +  +    + L K +  RH++ ++              A+L+  GPA L+IG++I+++ 
Sbjct: 81  KEDID---GSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTA 137

Query: 129 IYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMT 188
           ++ +I + GE+A  Y  ++GGF+ Y +  +D +  F++   Y +QWL + PLELV AS+T
Sbjct: 138 LFTVINSLGELAAAY-PVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASIT 196

Query: 189 IKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXX 248
           I+YWN+K++ D +V+IFY +I  +N+    + + E EF  +  KIL              
Sbjct: 197 IRYWNDKINSDAWVSIFYTVIGLLNMLD-VKSFGETEFVLSFIKILAIIGFTILGIVLSC 255

Query: 249 XXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
                 GYIG  YW++PGAF GHT G++FKG+ S  VTAAFS+   E +A++A+E  +PR
Sbjct: 256 GGGPVGGYIGGKYWHDPGAFVGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPR 315

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIR 367
           K IP AAK+  +     YV  + ++G LVPY+ P LL GS S    +SP VIA+ + GI+
Sbjct: 316 KTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIK 375

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
             P  +NA+ILI+VLSVANS+ Y+ SR ++++A  G  PK    +D+KGRP+   +    
Sbjct: 376 GLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLF 435

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
              I+F A+S K+ EVF+WL A+SGLS +F W  I +SHIRFRRAM IQGRSL E+ Y S
Sbjct: 436 FGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLS 495

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWK 547
           QVGV+GS Y   ++FL+LI  FW +L+P+ S+ AN T FF+ YL++PILL  Y G+K + 
Sbjct: 496 QVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYF 555

Query: 548 KDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLK 585
           K+W LF    +IDL S +   D ++L++EK   +  LK
Sbjct: 556 KNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALK 593

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  417 bits (1071), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/576 (39%), Positives = 338/576 (58%), Gaps = 13/576 (2%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN-QLQKT 83
           +E  I E  S    +L D   + KK D   N  E+    +N+  S   N  + N  L K 
Sbjct: 23  DEKSILEGKSSTQSSLLDL--TLKKCD---NGIEV----VNDATSTVSNASVTNVNLNKN 73

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           +  RH++ ++              A L + GPA L+I ++I+++C++ +I A GEMA  +
Sbjct: 74  LSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAF 133

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
             ++GGFN Y +  VD +  FAV   Y  QWL + PLELV ASMTIKYWN+ ++ D +V 
Sbjct: 134 -PVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVA 192

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IFY +I   N+    + + E EF  ++ KIL                    GY+G  YW+
Sbjct: 193 IFYAVIAFANMLE-VKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWH 251

Query: 264 NPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           NPG+F GHT GT+FKG+ S  VTAAFS+   E  A++A+E  +PR+ IP AAK+  +   
Sbjct: 252 NPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLIT 311

Query: 324 FIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVL 382
             Y+  + ++G LVPY+ P LL GS S    +SP VIA+ + GI+  P  +NA+ILIS++
Sbjct: 312 ASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISII 371

Query: 383 SVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETE 442
           SVANS+ Y+ SR ++ +A  G  P++  ++D+KGRP+  I+       ++F A+S K+ E
Sbjct: 372 SVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAE 431

Query: 443 VFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMF 502
           VF+WL A+SGLS +F W  I +SHIRFR+AMK Q +SL+EL Y SQ GVWGS Y   V+F
Sbjct: 432 VFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLF 491

Query: 503 LILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562
           L+LI  FW +L+PL  +GA+  +FF+ YL+ PIL+  Y G+K   +   + +  +D+D+ 
Sbjct: 492 LVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDID 551

Query: 563 SHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           + R   D  + +QE  + +E+L   S + +    WC
Sbjct: 552 TGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 220/544 (40%), Positives = 323/544 (59%), Gaps = 9/544 (1%)

Query: 62  NEINNIKSDQFNDKL------NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGP 115
           N+I + +  + ND +      N  L K +  RH++ ++                L   GP
Sbjct: 62  NDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGP 121

Query: 116 AGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWL 175
           A L+I ++I+ +C++ +I + GE++  +  ++GGFN Y    V+ ++ FAV   Y  QWL
Sbjct: 122 ASLVIDWVIIGTCLFTVINSLGELSAAF-PVVGGFNVYGMRFVEPSFAFAVNLNYLAQWL 180

Query: 176 CVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILM 235
            + PLELV AS+TIKYWN+K++ D +V IFY  I   N+    + + E EF  ++ KIL 
Sbjct: 181 VLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLD-VKSFGETEFVLSMIKILS 239

Query: 236 XXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTE 295
                              GYIG  YW NPGAF GH  GT+FKG+ S  VTAAFS+   E
Sbjct: 240 IIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGTKFKGLCSVFVTAAFSYSGIE 299

Query: 296 FLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKA 354
             A++A+E  NPR+ IP AAK+  +     YV  + ++G LVP N P LL GS S    +
Sbjct: 300 MTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAAS 359

Query: 355 SPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDR 414
           SP VIA+ +  I+  P  +NA+ILI+V+SVANS+ Y+ SR ++ +A  G  PK    +D+
Sbjct: 360 SPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDK 419

Query: 415 KGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMK 474
           +GRP+  I+       ++F A+S KE EVF+WL A+SGLS +F W  I LSHIRFR+AMK
Sbjct: 420 RGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMK 479

Query: 475 IQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMP 534
           +Q RSL+EL + SQ GV GS Y   V+FL+LI  FW +L+P+ S+GA+  +FF+ YL+ P
Sbjct: 480 VQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFP 539

Query: 535 ILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIY 594
           IL++ YFG+K + ++W L ++ +DIDL + R   D  + ++E    +ENL   S   +  
Sbjct: 540 ILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKKSFITRFL 599

Query: 595 AFWC 598
            FWC
Sbjct: 600 HFWC 603

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  415 bits (1066), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/527 (40%), Positives = 323/527 (61%), Gaps = 3/527 (0%)

Query: 73  NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCI 132
            D  N  L K +  RH++ ++              A+L   GPA L+IG++I+++C++ +
Sbjct: 81  EDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTV 140

Query: 133 IQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW 192
           I + GE+A  +  ++GGFN Y +  ++ ++ FA+   Y  QWL + PLELV AS+TI+YW
Sbjct: 141 INSLGELAAAF-PVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYW 199

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
           N+K++ D +V IFY  I   N+    + + E EF  ++ KIL                  
Sbjct: 200 NDKINSDAWVAIFYTAIALANMLD-VKSFGETEFILSMVKILAIIGFGILGIVLTCGGGP 258

Query: 253 TSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIP 312
             GYIG  YW+NPGAF GH+ G++FKG+ S  VTAAFS+   E  A++A+E  NP++ IP
Sbjct: 259 HGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIP 318

Query: 313 SAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPH 371
            AAK+  +     YVG + ++G LVPYN P LL GS S    ASP VIA+ + GI+  P 
Sbjct: 319 KAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPS 378

Query: 372 FINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATI 431
            +NA+ILI+++SVANS+ Y+ SR ++++A  G  PK  + +D++GRPL  I+       +
Sbjct: 379 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLL 438

Query: 432 AFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGV 491
           +F A+S K+ EVF+WL A+SGLS +F W  I LS IRFR AMK QGRSL+E+ + SQ G 
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGT 498

Query: 492 WGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWN 551
           WG+ Y   V+FL+L+  FW +L+P+ S+ A+  +FF+ YL++PIL+  Y G+K WK+DW 
Sbjct: 499 WGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWR 558

Query: 552 LFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           L +   ++DL S R + D +  ++E    +E L N S + +    WC
Sbjct: 559 LLVPLMEMDLDSGRRVLDAETREEELRVEREYLANASFFTRFLHIWC 605

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  414 bits (1063), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 210/542 (38%), Positives = 330/542 (60%), Gaps = 4/542 (0%)

Query: 58  EIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAG 117
           E +  ++N+++   +N K +++L K +  RH++ ++               +L   GPA 
Sbjct: 43  EKDYADMNDVEKAIYNTK-DSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPAS 101

Query: 118 LLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCV 177
           L+I + I+++C++ I+ + GE++  +  ++GGFN Y +  V+ ++ FAV + Y  QW  +
Sbjct: 102 LVIAWTIISTCLFTIVNSLGELSATF-PVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAIL 160

Query: 178 CPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXX 237
            PLEL  AS+TI+YWN+ ++PD +V+IFY+ I   N+    + + E EF  ++ KIL   
Sbjct: 161 LPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLD-VKSFGETEFVLSMVKILAII 219

Query: 238 XXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFL 297
                          + G+IG  YWN+PGAF G TP  RFKG+ +  +TAAFS+   E +
Sbjct: 220 GFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELV 279

Query: 298 AITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASP 356
            ++A+E  NPR  +P AAK+  +     Y+  + ++G LVP N P LL G+ S    ASP
Sbjct: 280 GVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASP 339

Query: 357 YVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKG 416
            VIA+ + GI+  P  +NA+ILI++LSVANS+ Y+ SR ++++A+ G  P+   ++D+KG
Sbjct: 340 LVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKG 399

Query: 417 RPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQ 476
           RPL+ I    L+  ++F A+S K  EVF+WL A+SGLS +F W  I L+H+RFR AMK Q
Sbjct: 400 RPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQ 459

Query: 477 GRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPIL 536
            RSL EL Y S  G WGS Y   V+ L+LI  FW +L+P   NGA+ T+FF+ YL++PI 
Sbjct: 460 NRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIF 519

Query: 537 LLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAF 596
           +  Y G+K WK++  L+I+  ++D+ S R   D   LKQEK    E +K    +++++ F
Sbjct: 520 IACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNF 579

Query: 597 WC 598
           WC
Sbjct: 580 WC 581

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 220/580 (37%), Positives = 351/580 (60%), Gaps = 9/580 (1%)

Query: 26  ENQINESHSKLIENLK-----DFVDSFKKIDDNNNQYEIEKNEINNIKSDQFND-KLNNQ 79
           E  I++S +KL  + K     + V+S  K + +      +  ++++++   FN  K +  
Sbjct: 11  ETSISKSWTKLFSSFKRMEEVEVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLN 70

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           L + +  RH++ ++              + L+  GPA L+I + I+++C++ I+ A GE+
Sbjct: 71  LNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGEL 130

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPD 199
           A  +  ++GGFN Y + LVD +  FAV   Y  QW  + PLELV AS+TI+YWN  V+ D
Sbjct: 131 AAVF-PVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSD 189

Query: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGV 259
            +V +FY+ I   +L    + + E EF  ++ KIL                   +GYIG 
Sbjct: 190 AWVAVFYVCIFLASLLD-VKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGA 248

Query: 260 SYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
            YWN+PG+F G +PG++FKG+ S  VTAAFS+  TE + ++A+E +NPR  +P A+K+  
Sbjct: 249 KYWNDPGSFVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTF 308

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSS-QTKASPYVIAVASHGIRIAPHFINAVIL 378
           +     Y+  + I+G LV ++ P+LL + SS    ASP VIA+ + GI+  P  +NA+IL
Sbjct: 309 WLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAIIL 368

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
           I+++SVANSS Y+ SR ++++A+ G  P+IFTY+D +GRP+  II   +   ++F A+S 
Sbjct: 369 IAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASN 428

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
           K+ E+F WL A+SGLS +F W  I +SHIRFRRA+  QG SL+EL Y S  GV GS Y  
Sbjct: 429 KQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGC 488

Query: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
            V+ L+LI  FW +L+P  S+GA+  +FFK YL++PI L  + G+K +K++W+  IR+  
Sbjct: 489 VVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNK 548

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           ID+ + R + D++ L++EK ++ E +   S   K++  WC
Sbjct: 549 IDVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKLWNLWC 588

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  411 bits (1056), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 220/555 (39%), Positives = 323/555 (58%), Gaps = 9/555 (1%)

Query: 47  FKKID--DNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXX 104
           FKK D    N  + +E  E  +  SD  + + N    K +  RH++ ++           
Sbjct: 39  FKKADAASGNESWALENVESTSGTSDAEDSRYN----KDLSVRHLLTLAVGGAIGTGLFV 94

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164
              + L   GP  L+I ++I+++C++ I+ A GE++  +  ++GGFN Y S  V+ ++ F
Sbjct: 95  NSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTF-PVVGGFNVYISRFVEPSFGF 153

Query: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
           AV   Y  QW  + PLELV AS+TI+YWN  ++ D +V IFY +I   NL    + + E 
Sbjct: 154 AVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTIIFLANLLD-VKSFGET 212

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTL 284
           EF  ++ KIL                    GYIG  YW+NPGAF G+T   RF G+ S  
Sbjct: 213 EFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVF 272

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           VTAAFS+  TE +A++A+E  NPR  +P A K+  +     Y+  + +VG LVP + P L
Sbjct: 273 VTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRL 332

Query: 345 L-GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQG 403
           L GS S    ASP VIA+ + GI+  P  +NA+ILI+VLSVANS+ Y+ SR + ++A+ G
Sbjct: 333 LHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIG 392

Query: 404 YAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTIC 463
             PK F+Y+DRKGRPL+ I+A  +   ++F A+S K+  VF+WL A+SGLS +F W  I 
Sbjct: 393 NLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAIN 452

Query: 464 LSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANI 523
           +SHIRFR  MK +GRSL+EL + S  GVWGS Y   ++F++L+  FW AL+P     A+ 
Sbjct: 453 VSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASA 512

Query: 524 TNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKEN 583
            +FF+ YL+ PILL+ Y G+K + K W L     +ID+ S R   D +VLK EK   ++ 
Sbjct: 513 ESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQA 572

Query: 584 LKNGSLWLKIYAFWC 598
           ++  S   +    WC
Sbjct: 573 MREKSYLTRFLHLWC 587

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  411 bits (1056), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 218/571 (38%), Positives = 341/571 (59%), Gaps = 7/571 (1%)

Query: 33  HSKLIENLK--DFVDSFKKIDDNNNQYEIEK-NEINNIKSDQFNDKLNN-QLQKTIQPRH 88
           +++L+ + K  D  ++ + + D++ + + ++  E+ +++    +   N+ QL K +  RH
Sbjct: 58  YTRLLNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRH 117

Query: 89  VIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIG 148
           ++ ++              A+L+  GP  +LI + ++++C++ I+ + GE+A  +  ++G
Sbjct: 118 LLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAF-PVVG 176

Query: 149 GFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLL 208
           GFN Y +  V+ ++ FAV   Y  QW  + PLEL  AS+TIKYWN K++ D +V IFY+ 
Sbjct: 177 GFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVC 236

Query: 209 IIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF 268
           I   N+    + + E EF  ++ KIL                    G+IG  YW++PGAF
Sbjct: 237 IALANMLD-VKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF 295

Query: 269 RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVG 328
            G TPG +FKG+ S  VTAAFS+  TE + ++A+E  NPR  IP A+K+  +     Y+ 
Sbjct: 296 VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLL 355

Query: 329 SIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANS 387
            + I G LVP N P LL G  S    ASP VIA+ + GIR  P  +NA+ILI+++SVANS
Sbjct: 356 VLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANS 415

Query: 388 SFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWL 447
           S Y+ SR ++++A+ G  PK+F Y+DRKGRPL  I+A  +   ++F A+S K+  +F+WL
Sbjct: 416 SVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWL 475

Query: 448 LAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG 507
            A+SGLS +F W  I +SHIRFRRAM  Q RSL+EL Y S  GV GS Y A V+  +L+ 
Sbjct: 476 SALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVL 535

Query: 508 QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHI 567
            FW +L+P  S+G +  +FF+ YL+ PI L+ Y  +K +K+DW LFI A  ID+ S R  
Sbjct: 536 SFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRA 595

Query: 568 YDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            D + LK++K + +        +++ + FWC
Sbjct: 596 LDIEELKEQKLREQAETAKKPFYVRWWIFWC 626

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  405 bits (1041), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 214/552 (38%), Positives = 327/552 (59%), Gaps = 7/552 (1%)

Query: 51  DDNNNQYEIEKNEINNIKSDQFN---DKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXX 107
           D    +   EKN I    S+QF+   + +N  L K +  RH+I ++              
Sbjct: 61  DSKTKEGGSEKN-IETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSG 119

Query: 108 ATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVA 167
           A L + GPA L+I ++I+++C++ +I A GE+A  Y  ++GGFN Y +  VD +  FA+ 
Sbjct: 120 AALASGGPASLVIDWVIISTCLFTVINALGELAAAY-PVVGGFNVYITRFVDPSVAFAIN 178

Query: 168 WVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFF 227
             Y  QWL + PLELV AS+TIKYWN+ ++ D +V IFY +I   N+    + + E EF 
Sbjct: 179 LNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLD-VKSFGETEFV 237

Query: 228 FNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTA 287
            ++ KIL                    G++G  YW++PG+F G  PGT+FKG+ S  VTA
Sbjct: 238 LSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQFKGLCSVFVTA 297

Query: 288 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-G 346
           AFS+   E  A++A+E  +PRK IP A K+  +     YV  + I+G LVP++ P LL G
Sbjct: 298 AFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNG 357

Query: 347 SKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAP 406
           S S    ASP VI++ + GI+     +NA+ILIS++SVANS+ Y+ SR ++++A  G  P
Sbjct: 358 SSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLP 417

Query: 407 KIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSH 466
           K+ + +D++GRP+  I++      ++F A+S K+ EVF+WL A+SGLS +F W  I  SH
Sbjct: 418 KVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSH 477

Query: 467 IRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNF 526
           IRFR AMK+Q ++L+EL Y SQ GV GS Y   V+FL+L+  FW +L+PL S  A++T+F
Sbjct: 478 IRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSF 537

Query: 527 FKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKN 586
           F+ YL++PIL+  Y G+K + ++  + ++ +D+DL + R   D    + E    K  L  
Sbjct: 538 FEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQ 597

Query: 587 GSLWLKIYAFWC 598
            S   + +  WC
Sbjct: 598 KSFIKRFWHVWC 609

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  404 bits (1037), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/555 (39%), Positives = 327/555 (58%), Gaps = 20/555 (3%)

Query: 45  DSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXX 104
           D F++ +D       E+ +INN             L K +  RH++ ++           
Sbjct: 68  DRFRRNEDT------EQEDINN-----------TNLSKDLSVRHLLTLAVGGAIGTGLYV 110

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164
              A L   GPA L+I ++I+++C++ +I + GE++  +  ++GGFN Y    ++ ++ F
Sbjct: 111 NTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAF-PVVGGFNVYSMRFIEPSFAF 169

Query: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
           AV   Y  QWL + PLELV AS+TIKYWN+K++ D +V IFY  I   N+    + + E 
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLD-VKSFGET 228

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTL 284
           EF  ++ KIL                    GYIG  YW++PGAF GH+ GT+FKG+ S  
Sbjct: 229 EFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVF 288

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           VTAAFS+   E  A++A+E  NPR+ IP AAK+  +     YV  + ++G LVP N P L
Sbjct: 289 VTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRL 348

Query: 345 L-GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQG 403
           L GS S    +SP VIA+ + GI+  P  +NA+ILI+V+SVANS+ Y+ SR ++ +A  G
Sbjct: 349 LNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIG 408

Query: 404 YAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTIC 463
             PK    +D++GRP+  I+       ++F A+S K+ EVF+WL A+SGLS +F W  I 
Sbjct: 409 NLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAIN 468

Query: 464 LSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANI 523
           LSHIRFR+AMK+Q RSL+EL + SQ GV GS Y   V+FL+LI  FW +L+PL  +GA+ 
Sbjct: 469 LSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASA 528

Query: 524 TNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKEN 583
            +FF+ YL+ PIL++ Y G+K + ++W L ++ +D+DL + R   D  + ++E    +E 
Sbjct: 529 ESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERET 588

Query: 584 LKNGSLWLKIYAFWC 598
           L   S   +   FWC
Sbjct: 589 LAKRSFVTRFLHFWC 603

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  402 bits (1033), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/605 (37%), Positives = 346/605 (57%), Gaps = 26/605 (4%)

Query: 3   SLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFV--DSFKKIDDNNNQYEIE 60
           SLS       +    +KN  +T    I ES +K I++  +F+  D+   I     +  I 
Sbjct: 5   SLSTQDVSSDIKYKSSKNEFIT----IIESDNKNIDD--NFIPHDTLSTISRKEKKPPIY 58

Query: 61  KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLI 120
           +  I++ K  +        L+K+++ RH+IMI+                L   GP  ++I
Sbjct: 59  RRIIDSFKPPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVII 118

Query: 121 GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPL 180
           G+ +  S I   I   GE+ V +  ++G F +Y +  +D + +F V+ +Y +QW  V PL
Sbjct: 119 GWAVAGSQIVGTIHGLGEITVRF-PVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPL 177

Query: 181 ELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           E++ +++T++YWN+ +DP VFV IFY +I++INLFG ARG+ EAEF F+  KI+      
Sbjct: 178 EIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFG-ARGFGEAEFIFSTVKIITICGFI 236

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                          YIG  YW+NPG+         FKG++S LV A++S G TE   + 
Sbjct: 237 ILCIVLIAGGGPDHEYIGAKYWHNPGSL-----AHGFKGVLSVLVVASYSLGGTEMTCL- 290

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           AS +++P K +PSA K+V +R LF ++ S+ +VGFLVPY +P LLG  S     SP+VIA
Sbjct: 291 ASGETDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDN--SPFVIA 347

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           +  H I++ P  +NAVIL+S+LSV NS  ++SSR L ++A Q   P  F Y+DR GRPL 
Sbjct: 348 IKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLT 407

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
           GII  SL   +AF   S   TEVF WL+AI+GL+    W +I + H+RFR AMK Q R+L
Sbjct: 408 GIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTL 467

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL---NSNGANITNFFKEYLAMPILL 537
           +EL + S VG+WGS+Y+  V  LIL+ QF++ALWP+     +G     FF+ YL   IL+
Sbjct: 468 DELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILI 527

Query: 538 LFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKI 593
           + + G+K + +     W  +I  KDIDL + R   D +++KQE ++ K  L +   +++ 
Sbjct: 528 VLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMYLASKPWYVRQ 587

Query: 594 YAFWC 598
           +  WC
Sbjct: 588 FHVWC 592

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  401 bits (1031), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 213/521 (40%), Positives = 316/521 (60%), Gaps = 3/521 (0%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           Q+ K +  RH++ ++              A L + GPA L+I ++I+++C++ ++ + GE
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           +A  +  ++GGFN Y +  +D ++ FAV   Y  QWL + PLELV AS+TI+YWN+K++ 
Sbjct: 155 LAAAF-PVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINS 213

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
           D +V IFY  I   N+    + + E EF  ++ KIL                    GYIG
Sbjct: 214 DAWVAIFYAAIAFANMLD-VKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIG 272

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YW++PGAF G T GT+FKG+ S  VTAAFS+   E  A++A+E  NPR+ IP AAK+ 
Sbjct: 273 GKYWHDPGAFVGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKRT 332

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPHFINAVI 377
            +     YV  + ++G LVPYN+P+LL GS S    +SP VIA+ + GIR  P  +NA+I
Sbjct: 333 FWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNAII 392

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           LI+++SVANS+ Y+ SR ++++A+    P+    +DRKGRPL   +       ++F A+S
Sbjct: 393 LIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAAS 452

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
            K+ EVF+WL A+SGLS +F W  I LSHIRFR+AM  QG SL+EL Y S  GV GS Y 
Sbjct: 453 DKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYG 512

Query: 498 ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAK 557
             V+FL+L+  FW +L+PL   GA+ T+FF+ YL+ PIL++ Y G+K + +   L I   
Sbjct: 513 VIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVA 572

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           D+DL+S R + D +V ++E    KE L   S + +    WC
Sbjct: 573 DMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLHLWC 613

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  398 bits (1023), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 222/549 (40%), Positives = 330/549 (60%), Gaps = 20/549 (3%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDD---NNNQYEIEKNE 63
            IT D   L+     I +N +  +   +      +DF DSFK+++    + N  E EK  
Sbjct: 19  GITIDSEFLTQEPITIPSNGSAASAEEAGSGSKWQDFKDSFKRVEPIAVDPNLTEAEKVA 78

Query: 64  INNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYI 123
           I   ++          L+  ++ RH+ MI+                L   GPA LLIG+ 
Sbjct: 79  IVTAQT---------PLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183
              + IY ++ A GE+AV +  + GGF  Y +  +D ++ +A  + Y +QWL V PLE+V
Sbjct: 130 STGTMIYAMVMALGELAVIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIV 188

Query: 184 TASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           +AS+T+ +W    DP   D FV +F+++I+ IN+FG  +GY EAEF F+  K++      
Sbjct: 189 SASITVNFWG--TDPKYRDGFVALFWVVIVIINMFG-VKGYGEAEFVFSFIKVITVVGFI 245

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAIT 300
                         GYIG  YW++PGAF G TPG +FKG+ S  VT+AFSF  +E + + 
Sbjct: 246 ILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTSAFSFAGSELVGLA 305

Query: 301 ASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIA 360
           ASE   PRK++P AAK+V +R    Y+ S++++G LVPYN   L+G+ S    ASP+VIA
Sbjct: 306 ASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIA 365

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           + +HGI+  P  +N VILI+VLSV NS+ Y+ SR ++ LA+Q + P+IF Y+DRKGRPL 
Sbjct: 366 IKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLV 425

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
           GI   S    IAF A+S KE +VF+WLLA+SGLS +FTWG IC+ HIRFR+A+  QGR L
Sbjct: 426 GIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDL 485

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFY 540
           +EL +KS  GVWGS +   ++ ++ I QF+VAL+P+  +  +   FF+ YL+ P+++  Y
Sbjct: 486 DELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGS-PSAEGFFEAYLSFPLVMAMY 544

Query: 541 FGYKTWKKD 549
            G+K +K++
Sbjct: 545 IGHKIYKRN 553

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  399 bits (1024), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 215/528 (40%), Positives = 312/528 (59%), Gaps = 4/528 (0%)

Query: 73  NDKLNN-QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYC 131
            D +NN  L K +  RH++ ++              A L + GPA L+I +II+++C++ 
Sbjct: 67  EDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFT 126

Query: 132 IIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKY 191
           +I A GEMA  +  ++GGFN Y +  +D +  FAV   Y  QWL + PLELV ASMTIKY
Sbjct: 127 VINALGEMAAAF-PVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKY 185

Query: 192 WNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXX 251
           WNE ++ D +V IFY +I   N+    + + E EF  ++ KIL                 
Sbjct: 186 WNETINSDAWVAIFYCVIALANMLE-VKSFGETEFVLSMIKILAIIGFTILGIVLACGGG 244

Query: 252 XTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311
              G+IG  YWN+PG+F GH  GT+FKG+ S  VTAAFS+   E  A++A+E  +PR  I
Sbjct: 245 PHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTI 304

Query: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAP 370
           P AAK+  +     YV  + ++G LVPY+ P LL G+ S    +SP VIA+ + GI+  P
Sbjct: 305 PKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLP 364

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
             +NA+ILIS++SVANS+ Y+ SR ++ +A  G  P+I   +D KGRP+  II       
Sbjct: 365 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGL 424

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           ++F A+S ++ +VF+WL A+SGLS +F W  I LSHIRFR++M  Q RSL+EL + SQ G
Sbjct: 425 LSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTG 484

Query: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW 550
           VWGS Y   V+FL+L+  FW +L+PL    A+  +FF+ YL+ PILL  YFG+K + +  
Sbjct: 485 VWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKR 544

Query: 551 NLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
              +   D+DL + R   D DV ++E  + +E L   S +      WC
Sbjct: 545 EFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  396 bits (1017), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/603 (37%), Positives = 339/603 (56%), Gaps = 29/603 (4%)

Query: 14  HLSVNKNVIVTNENQINES--HSKLIENLKDFVDSFKKIDDNNNQ---------YEIEKN 62
             SV    I+ + ++  E    S   +N K F+D + +                  I + 
Sbjct: 9   EFSVTHEYILPSSSKSMEGIGRSSSYKNDKTFIDVYSRRSSTEGPPVAKGTKPPRNIFQR 68

Query: 63  EINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGY 122
            I++ K  +      + L+KT++ RH+IMI+                L   GP  ++IG+
Sbjct: 69  AIDSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGW 128

Query: 123 IIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLEL 182
            I  S I   I   GE+ V +  ++G F NY +  +D + +F V+ +Y IQW  V PLE+
Sbjct: 129 AIAGSQIIGTIHGLGEITVRF-PVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEI 187

Query: 183 VTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXX 242
           ++++MT++YWNE +DP V+V IFY+ I++INLFG  RG+ EAEF F+  K++        
Sbjct: 188 ISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFG-VRGFGEAEFIFSTIKVITISGFILL 246

Query: 243 XXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITAS 302
                        Y+G  YW+NPG          F G++S +V A++S G TE   + AS
Sbjct: 247 CIILIAGGGPDHVYVGSRYWHNPGCL-----ANGFPGVLSVMVVASYSLGGTEMTCL-AS 300

Query: 303 EQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVA 362
            +++P K +PSA K+V +R LF ++ S+ +VGFLVPY +  LLG   S    SP+VIA+ 
Sbjct: 301 GETDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGG--SSVDNSPFVIAIK 357

Query: 363 SHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGI 422
            H I++ P  +NAVILIS+LSV NS  ++SSR L ++A Q   P  F Y+DR GRPL GI
Sbjct: 358 IHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGI 417

Query: 423 IAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNE 482
           I  SL   +AF   S   +EVF WL+AI+GL+    W +I +SHIRFR AMK QGRSLNE
Sbjct: 418 ITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNE 477

Query: 483 LGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN---SNGANITNFFKEYLAMPILLLF 539
           L + S VG+WGS+Y+A +  LIL+ QF+++LWP+    ++      FF+ YL   I++  
Sbjct: 478 LEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCI 537

Query: 540 YFGYKT--WKKDWNL--FIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA 595
           + G+K   W++   +  F    +IDL   R   D DVLKQE ++ K  LK+   +++ Y 
Sbjct: 538 WIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLKSRPWYIRFYH 597

Query: 596 FWC 598
           +WC
Sbjct: 598 YWC 600

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  397 bits (1019), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/613 (37%), Positives = 347/613 (56%), Gaps = 36/613 (5%)

Query: 19  KNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE----KNEINNIKSDQ--F 72
           KN+  T++ ++       +++  DF D     D N  Q +I     KNE  N+  D+  F
Sbjct: 49  KNLSTTSQQELKNGEIYSLQSNLDFQDGTNHFD-NETQIDIVSPDYKNENINVDEDKLPF 107

Query: 73  NDKLNN--------------------------QLQKTIQPRHVIMISXXXXXXXXXXXXX 106
           +D + +                           + K +  RH++ ++             
Sbjct: 108 SDDIRDVKDRSDFSSSFVSSARDKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNS 167

Query: 107 XATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAV 166
            ++L+  GPA L+IG++I+++ ++ +I + GE+A  +  ++GGF+ Y    VD ++ FAV
Sbjct: 168 GSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAF-PVVGGFSVYMDKFVDPSFAFAV 226

Query: 167 AWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEF 226
              Y +QWL + PLELV AS+TI+YWN  ++ D +V+IFY+ I   N+    + + E EF
Sbjct: 227 NLNYLLQWLVLLPLELVAASITIRYWNSSINSDAWVSIFYVAIGLANMLD-VKSFGETEF 285

Query: 227 FFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVT 286
             +L KIL                  +  YIG  YW++PGAF G T G++FKG+ S  VT
Sbjct: 286 VLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAFVGTTSGSKFKGLCSVFVT 345

Query: 287 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL- 345
           AAFSF   E  A++A+E  NPR+ IP AAK+  +     YV  + +VG LVPYN P L+ 
Sbjct: 346 AAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMN 405

Query: 346 GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYA 405
           GS S    +SP VIA+ +  I   P  +NA+ILI++LSVANSS Y+ SR +++++K    
Sbjct: 406 GSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETL 465

Query: 406 PKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLS 465
           PK+F  +DR+GRP+  I        ++F A+S K+ EVF+WL A+SGLS +F W  I L 
Sbjct: 466 PKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLC 525

Query: 466 HIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITN 525
           HIRFR+ M +Q  SL+EL + SQ G+WGSIY   ++FL+L+  FW +L+P+ S+ AN T+
Sbjct: 526 HIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATS 585

Query: 526 FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLK 585
           FF+ YL+ PILL  Y  +K + K+W  +I A  +DL S R   D +V+++E    KE+L 
Sbjct: 586 FFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLA 645

Query: 586 NGSLWLKIYAFWC 598
             S + +    WC
Sbjct: 646 QRSFFYRFLHVWC 658

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  392 bits (1006), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 203/486 (41%), Positives = 301/486 (61%), Gaps = 3/486 (0%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
              L K +  RH++ ++               +L+  GPA L+IG++I++S ++ +I A 
Sbjct: 75  GENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINAL 134

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GE+A  +  ++GGFN Y +  VD ++ FAV   Y I W+   PLELV AS+TI+YWN ++
Sbjct: 135 GELAATF-PIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREI 193

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
           + D +VTIF++ I  +N+    + ++EAEF  ++ KIL                  T GY
Sbjct: 194 NSDAWVTIFFVFIALLNMMD-VKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGY 252

Query: 257 IGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           IG  YWN+PGAF G + G+RFKG+ S  V AAFS+   E  A++A+E  NPRK IP A K
Sbjct: 253 IGGKYWNDPGAFHGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATK 312

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIAPHFINA 375
           +  +   F Y+  + ++G LVPYN   LL GS S    ASP VIA+ + GI+  P  +NA
Sbjct: 313 RTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNA 372

Query: 376 VILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCA 435
           +ILI++LSVANS  Y  SR+++++A     PK+F+ +D++GRPL+ I A   +  ++F A
Sbjct: 373 IILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIA 432

Query: 436 SSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSI 495
           +S K+ EVF+WL AI GLS +F W  I L+HIRFR A+K Q RSL+EL Y SQ G+WGS 
Sbjct: 433 ASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSW 492

Query: 496 YAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIR 555
           Y   ++ L+LI  FWV+L+P+  + A+   FF+ YL+ PIL+  Y G+K + K+W   I 
Sbjct: 493 YGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIP 552

Query: 556 AKDIDL 561
            ++ID+
Sbjct: 553 LEEIDI 558

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  392 bits (1008), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/549 (38%), Positives = 325/549 (59%), Gaps = 3/549 (0%)

Query: 51  DDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATL 110
           ++ +    IE N     +S    + +N  L K +  RH++ ++              A L
Sbjct: 49  NEKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAAL 108

Query: 111 HNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVY 170
            + GPA L+I ++I+++C++ +I + GE+A  +  ++GGFN Y +  VD ++ FAV   Y
Sbjct: 109 ASGGPASLVIDWVIISTCLFTVINSLGELAAAF-PVVGGFNVYITRFVDPSFAFAVNLNY 167

Query: 171 CIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNL 230
             QWL + PLELV AS+TIKYWN  ++ D +V IFY +I   N+    + + E EF  ++
Sbjct: 168 LAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLD-VKSFGETEFVLSM 226

Query: 231 CKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFS 290
            KIL                    GY+G  YW+NPGAF GHT GT+FKG+ S  VTAAFS
Sbjct: 227 VKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFS 286

Query: 291 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKS 349
           +   E  A++A+E  +PRK IP AAK+  +     YV  + +VG LVPY+ P L+ G+ S
Sbjct: 287 YSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSS 346

Query: 350 SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIF 409
               ASP VIA+ + GI+     +NA+ILIS++SVANS+ Y+ SR ++++A  G  PK  
Sbjct: 347 VDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKL 406

Query: 410 TYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRF 469
             +D++GRP+   +       ++F A+S K+ EVF+WL A+SGLS +F W  I +SHIRF
Sbjct: 407 GKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRF 466

Query: 470 RRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKE 529
           R+AM  Q RSL+E+ Y SQ GVWGS+Y   V+FL+L+  FW +L+PL  + A++ +FF+ 
Sbjct: 467 RQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEG 526

Query: 530 YLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSL 589
           YL++PIL++ Y G+K + K+W+  +  +++DL + R   D  + + E    +  +   S 
Sbjct: 527 YLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSF 586

Query: 590 WLKIYAFWC 598
             + +  WC
Sbjct: 587 IKRFWHVWC 595

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  392 bits (1007), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/598 (37%), Positives = 342/598 (57%), Gaps = 21/598 (3%)

Query: 8   ITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNI 67
           + +D   +S   N++  +   +    S  I + +  +D  KK D N N   I +  I++ 
Sbjct: 1   MKEDEYDMSKMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKN---IVRRMIDSF 57

Query: 68  KSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMAS 127
           K        ++ L++ ++ RH+IMI+                L   GP  ++IG+ I  S
Sbjct: 58  KPPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGS 117

Query: 128 CIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASM 187
            +   I   GE+ + +  ++G F NY + L+D + +F V+ +Y  QW  V P+EL+ ++M
Sbjct: 118 QMVGTIHGLGEITMRF-PVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAM 176

Query: 188 TIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXX 247
           T+++W  KVDP V+V IFY++++++NLFG  + + EAEF F+L K++             
Sbjct: 177 TVQFWTTKVDPVVWVAIFYVIVVSVNLFG-VKVFGEAEFAFSLVKVITIIGFIILSIILI 235

Query: 248 XXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
                   +IG  YW++PGA         FKG+ S  VTA++S G +E + + ++E ++P
Sbjct: 236 CGGGPDHRFIGTEYWHHPGAL-----ANGFKGVASVFVTASYSLGGSEMVCLCSAE-TDP 289

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIR 367
            K +P A K+V +R +F ++ S+ +VGFLVPY +  LLG   S    SP+VIA+   GIR
Sbjct: 290 -KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGG--SSVNNSPFVIAIKLSGIR 346

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + P  INAVILIS+LSV NS  ++SSR L ++A QG  P++F Y+DR GRPL GII  SL
Sbjct: 347 VLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSL 406

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
              +AF   S     VF WL+AI+GL+    W +I +SHIRFR AMK Q RSL+EL +KS
Sbjct: 407 FGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKS 466

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPL---NSNGANITNFFKEYLAMPILLLFYFGYK 544
            VGV+GSIY+ATV  LILI QF+++LWP+    S+     +FFK YL   +L+  +  +K
Sbjct: 467 SVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHK 526

Query: 545 TWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            + K     W  F    +IDL + R   D +++KQE  + +  L +   +++ Y FWC
Sbjct: 527 IYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRFYNFWC 584

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  392 bits (1007), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/610 (36%), Positives = 340/610 (55%), Gaps = 26/610 (4%)

Query: 3   SLSPSITKDGLHLSVNKNVIVTNENQINE--SHSKLIENLKDFVDSFKKIDDNNNQYEIE 60
           ++  S T +G       N  +  E +  +    S ++   K   D ++     N  Y+  
Sbjct: 2   TIQTSFTDEGARRRSEINEFIDFEKKPVDIKKTSSVVATTKHAHDEYEDNFPGNGFYQPP 61

Query: 61  KNEINNIKSDQFNDKLN-----NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGP 115
           +N       D F   L+     N L+++++ RH+IMI+                +   GP
Sbjct: 62  RNIFQRCI-DSFKPPLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGP 120

Query: 116 AGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWL 175
             ++IG+ I  S I   I   GE+ V +  ++G F NY +  +D + +F ++ +Y IQW 
Sbjct: 121 LAVVIGWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYSTRFLDPSLSFVISTIYVIQWF 179

Query: 176 CVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILM 235
            V PLE+++++MT++YWN+ +DP V+V IFY  I++INLFG ARG+ EAEF F+  K+L 
Sbjct: 180 FVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFG-ARGFGEAEFVFSSVKVLT 238

Query: 236 XXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTE 295
                               ++G  YW++PG          F G++S LV A++S G TE
Sbjct: 239 ICGFIILCIVLICGGGPDHDFVGAKYWHDPGCL-----AHGFPGVLSVLVVASYSLGGTE 293

Query: 296 FLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS 355
            + + AS +++P K +PSA K+  +R LF ++ S+ ++GFLVPY +  LLG   S    S
Sbjct: 294 MVCL-ASGETDP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGG--SSVNNS 349

Query: 356 PYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRK 415
           P+VIA+  H I++ P  +NAVILIS+LSV NS  ++SSR L ++A QG  P+ F Y+DR 
Sbjct: 350 PFVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRA 409

Query: 416 GRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKI 475
           GRPL GII  SL   +AF   S   +EVF WL+AI+GL+    W +I +SHIRFR AMK 
Sbjct: 410 GRPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKA 469

Query: 476 QGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL---NSNGANITNFFKEYLA 532
           QGRSL+EL + S VG+WGS Y+A +  LIL+ QF+ ALWP+    ++      FF+ YL 
Sbjct: 470 QGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLC 529

Query: 533 MPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGS 588
             I+++ + G+K + +     W   +    IDL + R   D ++LKQE  +   +L+   
Sbjct: 530 ALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASP 589

Query: 589 LWLKIYAFWC 598
            +++ Y FWC
Sbjct: 590 WYVRWYHFWC 599

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  391 bits (1004), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/578 (38%), Positives = 330/578 (57%), Gaps = 31/578 (5%)

Query: 38  ENLKDFVDSFKKIDD---NNNQYEIEKNEINNIKSDQFNDKLN-----NQLQKTIQPRHV 89
            + + F    K  DD    ++ Y+  +N       D F   L+     + L++T++ RH+
Sbjct: 36  SSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCI-DSFKPPLDGSFHTHNLKRTLKARHL 94

Query: 90  IMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGG 149
           IMI+                L + GP  L+IG+ I  + I   I   GE+ V +  ++G 
Sbjct: 95  IMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRF-PVVGA 153

Query: 150 FNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLI 209
           F NY +  +D + +F ++ +Y IQW  V PLE++ ++MTI+YWN+ +DP V+V IFY +I
Sbjct: 154 FANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVI 213

Query: 210 IAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFR 269
           ++INLFG ARG+ EAEF F+  K++                     ++G  YW++PG   
Sbjct: 214 VSINLFG-ARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLS 272

Query: 270 GHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGS 329
                  F G++S LV A++S G TE + + AS ++NPR+ +PSA K+  +R LF ++ S
Sbjct: 273 -----HGFPGVLSVLVVASYSLGGTEMVCL-ASGETNPRE-LPSAIKQTFWRILFFFLIS 325

Query: 330 IIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSF 389
           + ++GFLVPY +P LLG   S    SP+VIA+  H I+  P  +NAVILIS++SV NS  
Sbjct: 326 LTLIGFLVPYTNPNLLGG--SSVNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCI 383

Query: 390 YSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLA 449
           ++SSR L ++A QG  PK F Y+DR GRPL GI+  SL   +AF   S    EVF WL+A
Sbjct: 384 FASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMA 443

Query: 450 ISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQF 509
           I+GL+    W +I +SHIRFR AMK QG+SL+EL + S VG+WGS Y+A +  LILI QF
Sbjct: 444 IAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQF 503

Query: 510 WVALWPLN---SNGANITNFFKEYL-AMPILLLF-----YFGYKTWKKDWNLFIRAKDID 560
           + ALWP+     +      FF+ YL A+ +  LF     ++ YKT K  W   +    ID
Sbjct: 504 YCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGK--WWAIMDLDKID 561

Query: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           L + R   D DVLKQE  +   +L+    +++ Y FWC
Sbjct: 562 LETDRKNIDIDVLKQEIAERNRHLQASPWYVRWYHFWC 599

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  391 bits (1004), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/597 (37%), Positives = 341/597 (57%), Gaps = 27/597 (4%)

Query: 11  DGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSD 70
           +G+   ++KN  VT     N++     E+ +   D + K ++ N    I +  I++ K  
Sbjct: 12  NGVSAKLSKNEFVTTIFSDNKNIDDKYEHAESLTD-YTKTENRN----IFQRVIDSFKPP 66

Query: 71  QFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIY 130
                  + L+++++ RH+IMI+                L N GP  L++G+ I  S I 
Sbjct: 67  ANGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIV 126

Query: 131 CIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIK 190
             I   GE+ V +  ++G F NY +  +D + +F ++ +Y +QW  V PLE++++++T++
Sbjct: 127 GTIHGLGEITVRF-PVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQ 185

Query: 191 YWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXX 250
           YWN+ +DP VFV IFY  I++INLFG  RG+ EAEF F+  K++                
Sbjct: 186 YWNDTIDPVVFVAIFYCAIVSINLFG-VRGFGEAEFVFSTIKVITVTGFIILCIILICGG 244

Query: 251 XXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
             T  +IG  YW++PG          F+G +S L+TA++S G TE   + AS +++P K 
Sbjct: 245 GPTHEFIGAKYWHDPGCL-----ANGFRGFLSVLITASYSLGGTEMTCL-ASGETDP-KE 297

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           +PSA K+V +R LF ++ S+ +VGFLVPY +  LLG   S    SP+VIA+  H I++ P
Sbjct: 298 LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGG--SSVDNSPFVIAIKLHNIKVLP 355

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
             +NAVILIS+LSV NS  ++SSR L ++A QG  P  F Y+DR GRPL GI+  SL   
Sbjct: 356 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGL 415

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           +AF   S   +EVF WL+AI+GL+    W +I + HIRFR AMK Q ++++EL + S VG
Sbjct: 416 LAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVG 475

Query: 491 VWGSIYAATVMFLILIGQFWVALWPL---NSNGANITNFFKEYLAMPILLLF------YF 541
           VWGS+Y+A +  LILI QF+V+LWP+     +      FF+ YL   + L+F      YF
Sbjct: 476 VWGSVYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKLYF 535

Query: 542 GYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            YKT  K W   I  KDIDL + R   D D++K+E  + K+ L     ++++   WC
Sbjct: 536 RYKT--KKWWEIIPLKDIDLDTGRKNIDIDIVKEEIKERKQYLATKPWYIRLMHHWC 590

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  385 bits (988), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/557 (38%), Positives = 325/557 (58%), Gaps = 21/557 (3%)

Query: 52  DNNNQYE---IEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXA 108
           D++ QY    I +  +++ K         + L++T++PRH+IMI+               
Sbjct: 47  DDDGQYNNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGK 106

Query: 109 TLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAW 168
            +   GP G+++G+ I  S I   +   GE+ V +  ++G F NY +  +D + +F V+ 
Sbjct: 107 AIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRF-PVVGAFANYGTRFLDPSISFVVST 165

Query: 169 VYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFF 228
           +Y +QW  V PLE++ A+MT++YWN  +DP ++V IFY +I++INLFG ARG+ EAEF F
Sbjct: 166 IYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFG-ARGFGEAEFAF 224

Query: 229 NLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAA 288
           +  K +                     +IG  YW++PG          F G++S LV A+
Sbjct: 225 STVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCL-----AHGFPGVLSVLVVAS 279

Query: 289 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK 348
           +S G  E +   AS +++P K +PSA K+V +R +F ++ S+ +VGFLVPY +  LLG  
Sbjct: 280 YSLGGIE-MTCLASGETDP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGS 337

Query: 349 SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKI 408
           S     SP+VIA+  H I++ P  +NAVILISVLSV NS  ++SSR L ++A QG  P  
Sbjct: 338 SVDN--SPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWW 395

Query: 409 FTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIR 468
           F Y+DR GRPL GI+A SL   +AF   S   +EVF+WL+AI+GL+    W +I LSH+R
Sbjct: 396 FGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVR 455

Query: 469 FRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN---SNGANITN 525
           FR AMK QG+SL+EL + S VG+WGS+Y+A +  LILI QF+ +LWP+    S+      
Sbjct: 456 FRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKI 515

Query: 526 FFKEYLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYK 581
           FF+ YL   I++  +  +K + +     W      KDIDL + R   D +++KQE  + K
Sbjct: 516 FFQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKK 575

Query: 582 ENLKNGSLWLKIYAFWC 598
           + L +   +++ + FWC
Sbjct: 576 KYLDSRPWYVRQFHFWC 592

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  384 bits (985), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/558 (38%), Positives = 322/558 (57%), Gaps = 21/558 (3%)

Query: 51  DDNNNQYE---IEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXX 107
           DD++ ++    I +  +++ K         + L++T++PRH+IMI+              
Sbjct: 47  DDDDGEHSNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSG 106

Query: 108 ATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVA 167
             +   GP G+++G+ I  S I   I   GE+ V +  ++G F NY +  +D + +F V+
Sbjct: 107 KAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFLDPSISFVVS 165

Query: 168 WVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFF 227
            +Y +QW  V PLE++ A+MT++YWN  +DP ++V IFY +I+ INLFG ARG+ EAEF 
Sbjct: 166 TIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFG-ARGFGEAEFA 224

Query: 228 FNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTA 287
           F+  K +                     +IG  YW++PG          F G+++ LV A
Sbjct: 225 FSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCL-----ANGFPGVLAVLVVA 279

Query: 288 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS 347
           ++S G  E +   AS +++P K +P A K+V +R LF ++ S+ +VGFLVPY +  LLG 
Sbjct: 280 SYSLGGIE-MTCLASGETDP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGG 337

Query: 348 KSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPK 407
            S     SP+VIA+  H I++ P  +NAVILISVLSV NS  ++SSR L ++A QG  P 
Sbjct: 338 SSVDN--SPFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPW 395

Query: 408 IFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHI 467
            F Y+DR GRPL GI+A SL   +AF   S    +VF+WL+AI+GL+    W +I LSHI
Sbjct: 396 WFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHI 455

Query: 468 RFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL---NSNGANIT 524
           RFR AMK QG+SL+EL + S VG+WGS Y+A +  LILI QF+ +LWP+   +S      
Sbjct: 456 RFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAK 515

Query: 525 NFFKEYLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQY 580
            FF+ YL   I+L  +  +K + K     W      KDIDL + R   D +++KQE  + 
Sbjct: 516 LFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQEIMER 575

Query: 581 KENLKNGSLWLKIYAFWC 598
           K +L +   +++ + FWC
Sbjct: 576 KMHLDSRPWYVRQFHFWC 593

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  383 bits (983), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/587 (37%), Positives = 323/587 (55%), Gaps = 31/587 (5%)

Query: 32  SHSKLIENLKDFVDSFKKIDDNNNQYE--------IEKNEINNIKSDQFNDKLN-----N 78
           S  +  E +      F K D     Y         + K  I     D F   ++     +
Sbjct: 2   STKEFKEEIHTSTSEFTKYDSQKPYYSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFDTS 61

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            L++T++ RH+IMI+                L   GP  ++IG+ I  S I   I   GE
Sbjct: 62  NLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGE 121

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           + V +  ++G F +Y +  +D + +F V+ +Y IQW  V PLE++ +++TI+YWN  +DP
Sbjct: 122 ITVRF-PVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDP 180

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
            V+V IFY +I++INLFG ARG+ EAEF F+  K +                     +IG
Sbjct: 181 VVWVAIFYGVIVSINLFG-ARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIG 239

Query: 259 VSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
             YW++PGA         F G++S LV A++S G TE   + AS +++P K +PSA K+V
Sbjct: 240 AKYWHDPGAL-----AHGFPGVLSVLVVASYSLGGTEMTCL-ASGETDP-KELPSAIKQV 292

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
            +R LF ++ S+ +VGFLVPY +  LLG  S     SP+VIA+  H I+  P  +NAVIL
Sbjct: 293 FWRILFFFLASLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHHIKALPSIVNAVIL 350

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
           IS+LSV NS  ++SSR L ++A QG  P+ F Y+DR GRPL GI+  SL   +AF   S 
Sbjct: 351 ISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSS 410

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
             +EVF WL+AI+GL+    W +I LSHIRFR AMK Q ++L+EL + S VG+WGS Y+A
Sbjct: 411 SVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSA 470

Query: 499 TVMFLILIGQFWVALWPL---NSNGANITNFFKEYLAMPILLLFYFGYKTWKK----DWN 551
            +  LILI QF+++LWP+     +      FF+ YL   I+LL +  +K + +     W 
Sbjct: 471 LINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWW 530

Query: 552 LFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
                KDIDL + R   D DV+K E  + K  LK     ++ Y FWC
Sbjct: 531 DVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  382 bits (980), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/553 (39%), Positives = 318/553 (57%), Gaps = 18/553 (3%)

Query: 53  NNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHN 112
            + +  I +  +++ KS        + L++T++PRH+IMI+                +  
Sbjct: 51  QHGKRNIFQRCVDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAE 110

Query: 113 AGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCI 172
            GP G++IG+ I  S I   I   GE+ V +  ++G F NY +  +D + +F V+ +Y +
Sbjct: 111 GGPLGVVIGWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFLDPSISFVVSTIYVL 169

Query: 173 QWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCK 232
           QW  V PLE++ A+MT++YWN  +DP ++V IFY +I++INLFG  RG+ EAEF F+  K
Sbjct: 170 QWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFG-VRGFGEAEFAFSTIK 228

Query: 233 ILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFG 292
            +                     +IG  YW++PG          F G++S LV A++S G
Sbjct: 229 AITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCL-----ANGFPGVLSVLVVASYSLG 283

Query: 293 QTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQT 352
             E +   AS +++P K +PSA K+V +R LF ++ S+ +VGFLVPY +  LLG  S   
Sbjct: 284 GIE-MTCLASGETDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDN 341

Query: 353 KASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYL 412
             SP+VIA+  H I+  P  +NAVILISVLSV NS  ++SSR L ++A QG  P  F Y+
Sbjct: 342 --SPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYI 399

Query: 413 DRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRA 472
           DR GRPL GI+A SL   +AF   S   +EVF+WL+AI+GL+    W +I LSHIRFR A
Sbjct: 400 DRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLA 459

Query: 473 MKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN---SNGANITNFFKE 529
           MK QG+SL+EL + S VG+WGS Y+A +  LILI QF+ +LWP+    S       FF+ 
Sbjct: 460 MKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQN 519

Query: 530 YLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLK 585
           YL   I+L  +  +K + K     W      KDIDL + R   D +++KQE  + K  L 
Sbjct: 520 YLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLD 579

Query: 586 NGSLWLKIYAFWC 598
           +   +++ + FWC
Sbjct: 580 SRPWYVRQFHFWC 592

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/588 (35%), Positives = 342/588 (58%), Gaps = 22/588 (3%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN 77
               +  + +++  ++S  + + KD   SFK  + +    +++ +++   +  Q   +L 
Sbjct: 12  ESEALSVSASKVQGAYSSAVRSWKD---SFKPSELSQIPEDLDYHDLTEREKIQL--RLA 66

Query: 78  NQ-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           NQ  QK +  RH+ MI+              A L  +GPA LLIGY+++ + ++C+IQ+ 
Sbjct: 67  NQPYQKVLHQRHLSMIAIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGTSMFCVIQSA 125

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
            E+A  +  + G + ++ S  VD +  F VA  Y + WL + P EL+  S+TI YWN  +
Sbjct: 126 AELACQF-PVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSSI 184

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXX-XTSG 255
           +P V+V+IF + ++ INLFG  R +AE EF  ++ K+L                     G
Sbjct: 185 NPAVWVSIFLVFVLWINLFG-VRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGG 243

Query: 256 YIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           YIG  YW++PG F        FK +  T V AAFSFG TE + +T +E  N   +I  AA
Sbjct: 244 YIGTKYWHDPGPFAKPV----FKNLCQTFVAAAFSFGGTEMVLLTGTESKNV-SSIARAA 298

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQT-KASPYVIAVA---SHGIRIAPH 371
           K   YR    YV +++++G LVPYN P LL + SS+   ASP+VIA++   S G +++ H
Sbjct: 299 KGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAKVS-H 357

Query: 372 FINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATI 431
           F+NAVIL++V+SV NS+ Y+SSR++  L   G  PKIF Y+DRKGRPL GI  ++    +
Sbjct: 358 FMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFGLL 417

Query: 432 AFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGV 491
            F  ++ K++EVF+WL A+  ++   TW +ICL+ +R+R AM+ + RSL+ + YKS +G+
Sbjct: 418 GFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSILGI 477

Query: 492 WGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW- 550
           WG +    V FL++ G+ +V+ +P N+  ++   FFK  L++PI+++ + G+K  + DW 
Sbjct: 478 WGGVVGCIVNFLLVAGEVYVSAFPANAK-SSAEGFFKYTLSIPIMIVVFLGHKIHRNDWG 536

Query: 551 NLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           N +++ KD+DL +   I D ++ + +K   K  L +  L+ ++Y FWC
Sbjct: 537 NWYVKRKDMDLDTGCSIEDFELFQAQKEAEKRALASRPLYYRVYRFWC 584

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/559 (38%), Positives = 323/559 (57%), Gaps = 25/559 (4%)

Query: 52  DNNNQYE---IEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXA 108
           D+N+QY    I +  +++ K         + L++T++PRH+IMI+               
Sbjct: 47  DDNHQYSNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGK 106

Query: 109 TLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAW 168
            +   GP G+++G+ I  S I   I   GE+ V +  ++G F NY +  +D + +F V+ 
Sbjct: 107 AIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFLDPSISFVVST 165

Query: 169 VYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFF 228
           +Y +QW  V PLE++ A+MT++YWN  +DP V+V IFY++I++INLFG  RG+ EAEF F
Sbjct: 166 IYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFG-VRGFGEAEFAF 224

Query: 229 NLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAA 288
           +  K +                     Y+G  YW +PG          F GI+S LV A+
Sbjct: 225 STIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCL-----ANGFPGILSVLVVAS 279

Query: 289 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK 348
           +S G  E +   AS +++P K +PSA K+V +R LF ++ S+ +VGFLVPY +  LLG  
Sbjct: 280 YSLGGIE-MTCLASGETDP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGS 337

Query: 349 SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKI 408
           S     SP+VIA+  H I++ P  +N VILISVLSV NS  ++SSR L ++A QG  P  
Sbjct: 338 SVDN--SPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWW 395

Query: 409 FTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIR 468
           F Y+DR GRPL GI+A SL   +AF   S    +VF+WL+AI+GL+    W +I +SHIR
Sbjct: 396 FGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIR 455

Query: 469 FRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL-----NSNGANI 523
           FR AMK QG+ L+EL + S VG+WGS Y+A +  LIL+ QF+ +LWP+     +S+ A I
Sbjct: 456 FRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKI 515

Query: 524 TNFFKEYLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
             FF+ YL   I+L  +  +K + K     W      KDIDL + R   D +++KQE  +
Sbjct: 516 --FFQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAE 573

Query: 580 YKENLKNGSLWLKIYAFWC 598
            K  L +   +++ + +WC
Sbjct: 574 KKMYLDSCPWYVRHFHYWC 592

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  372 bits (954), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/588 (36%), Positives = 350/588 (59%), Gaps = 29/588 (4%)

Query: 25  NENQINESHSKLIENLKD------FVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78
           N +  N+S S  I ++KD      F +SFK++D + N+++ EK   N++  D+   +L +
Sbjct: 8   NSSLRNDSVSTSISSIKDTSLLRNFKNSFKRVDQDQNKFDDEK--YNSV--DEGQKRLVD 63

Query: 79  Q-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
           Q L+KT+Q RH+ MI+               +L  +GP  LLIGYII+   ++C++Q+  
Sbjct: 64  QPLRKTLQQRHLTMIAIGGTLGTGLFIGLGESLA-SGPGSLLIGYIIVGIAVFCVVQSAA 122

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           E++  Y  + G +    +  ++ ++ F VA  YC+ WL   P ELV ++M I+YWN+ V+
Sbjct: 123 ELSCQY-PVSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIRYWNDSVN 181

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GY 256
             V++ IF++ ++ +NLFG   GYAE EF+ ++ KI+                   S GY
Sbjct: 182 SCVWIAIFWVFVMCLNLFG-VEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGGPNSTGY 240

Query: 257 IGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           IG  YW++PG+F        FK + +T V+AA+SFG  E + +T++E S    +I  AAK
Sbjct: 241 IGTKYWHDPGSFAHPV----FKSLCNTFVSAAYSFGGCEIVVLTSAE-SRKISSIARAAK 295

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQ-TKASPYVIAVA---SHGIRIAPHF 372
              +R    Y+ +I+I+G LVPY   +L+ + SS+   ASP+VIA++   + G R++ HF
Sbjct: 296 GTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGTRVS-HF 354

Query: 373 INAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIA 432
           +N VIL+S +SV+NS  Y+SSR++  L      P I  Y+DR+GRPL GI    L   + 
Sbjct: 355 MNTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGLFGLLG 414

Query: 433 FCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVW 492
           F  ++  E  +F+WL +++ ++   TW +IC   +RFR A+K QGRS +E+ YKS +G++
Sbjct: 415 FLVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKSMLGIY 474

Query: 493 GSIYAATVMFLILIGQFWVALWPLN-SNGANITNFFKEYLAMPILLLFYFGYKTWKKDW- 550
           G    A +  +++IG+ +++++PLN S  ANI  FF+  L++PI+L+ +FG+K + K W 
Sbjct: 475 GGYVGAILNIVLIIGEVYISIFPLNESPSANI--FFQNCLSIPIMLVSFFGHKIYCKGWK 532

Query: 551 NLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           + F+RAKDIDL +   I D ++ K E  + KE + +  L+ +IY FWC
Sbjct: 533 DWFVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  371 bits (953), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 199/555 (35%), Positives = 317/555 (57%), Gaps = 18/555 (3%)

Query: 51  DDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATL 110
           +   N+  + +  I++ K         + L++T++ RH+IMI+                L
Sbjct: 39  ESRTNKRGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKAL 98

Query: 111 HNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVY 170
              GP  +LIG+ +  + +   I   GE+ V +  ++G F NY +  +D + +F V+ +Y
Sbjct: 99  ATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRF-PVVGAFANYSTRFLDPSVSFVVSSIY 157

Query: 171 CIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNL 230
            +QW  V PLE++ +++T+++W   VDP V+V +FY LII+INLFG  R + + +F F++
Sbjct: 158 VLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFG-VRWFGKPKFVFSV 216

Query: 231 CKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFS 290
            K++                  T  +IG  YW++PGA         FKG+ + +VTA++S
Sbjct: 217 IKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGAL-----ANGFKGVAAVMVTASYS 271

Query: 291 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSS 350
            G +E   + AS +++P K IP A K++ +R +F ++ S+ +VGFLVPY + +LLG   S
Sbjct: 272 LGGSEMTCL-ASGETDP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGG--S 327

Query: 351 QTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFT 410
               SP+VIA+  H IR+ PH IN VIL+S+LSV NS  ++SSR L ++A QG  P+IF 
Sbjct: 328 NVNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFG 387

Query: 411 YLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFR 470
           Y+DR GRPL GI+  SL   +AF   S     VF+WL+A++GL+    W +I +SHIRFR
Sbjct: 388 YVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFR 447

Query: 471 RAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN---SNGANITNFF 527
            AMK QG+SL+EL + S VG+WGS+Y+  +  ++L+ QF+V+LWP+            FF
Sbjct: 448 LAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFF 507

Query: 528 KEYLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKEN 583
           + YL   ILL  +  +K + +     W   +   +IDL S R   D +V+K E    K+ 
Sbjct: 508 QNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKY 567

Query: 584 LKNGSLWLKIYAFWC 598
           +     +++ Y +WC
Sbjct: 568 ISEQRWYIRYYHYWC 582

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  371 bits (952), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/558 (34%), Positives = 324/558 (58%), Gaps = 24/558 (4%)

Query: 53  NNNQYEIEKNEINNIKSDQFNDKLN-----NQLQKTIQPRHVIMISXXXXXXXXXXXXXX 107
           N +  E ++N +  +  D F   ++     + +++ ++ RH+IMI+              
Sbjct: 47  NGSTEERKRNVVQRVI-DSFKPPVDGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSG 105

Query: 108 ATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVA 167
             L   GP  L+IG+ +  + +   I   GE+ V  L ++G F +Y +  +D + +F ++
Sbjct: 106 KALATGGPLALIIGWTLAGTQMIGTIHGLGELTVR-LPVVGAFADYSTRFLDPSVSFVIS 164

Query: 168 WVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFF 227
            +Y +QW  V PLE++ + +T+++W + VDP ++V +FY +I++INL G  RG+ EAEF 
Sbjct: 165 SIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVSINLLG-VRGFGEAEFI 223

Query: 228 FNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTA 287
           F+  K++                  T  Y+G  YW++PG          FKG+ + +VTA
Sbjct: 224 FSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPL-----ANGFKGVAAVMVTA 278

Query: 288 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS 347
           ++S G +E   + AS +++P K +P A K++ +R LF ++ S+ +VGFLVPY +  LLG 
Sbjct: 279 SYSLGGSEMTCL-ASGETDP-KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGG 336

Query: 348 KSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPK 407
            S++   SP+V+A+  H +++ PH +N VIL+S+LSV NS  ++SSR L ++A QG  P 
Sbjct: 337 SSAEN--SPFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPH 394

Query: 408 IFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHI 467
           IF Y+DR GRPL GI+A S+   +AF       + VFSWL+AI+GL+    W +I +SH+
Sbjct: 395 IFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHV 454

Query: 468 RFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN---SNGANIT 524
           RFR AMK Q +SL+EL + S VGVWGS+YA  + FL L+ QF++ALWP+     + +   
Sbjct: 455 RFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAE 514

Query: 525 NFFKEYLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQY 580
            FFK YL   IL+  +  +K + +     W    +  ++DL + R   D +++K+E  + 
Sbjct: 515 AFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAER 574

Query: 581 KENLKNGSLWLKIYAFWC 598
           K+ L+N + + + Y +WC
Sbjct: 575 KKFLRNKAWYTRYYYYWC 592

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  370 bits (950), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/587 (34%), Positives = 336/587 (57%), Gaps = 19/587 (3%)

Query: 19  KNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78
           KN   T     ++ H      ++D+ DSFK+ D       +E N++   +  Q   KL +
Sbjct: 10  KNDTDTLSVSASKEHGAYSSAVRDWRDSFKRQDLLEMPDALEYNDLTEREKTQL--KLAS 67

Query: 79  Q-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
           Q  +K +  RH+ MIS              A L  +GPA LLIGY+++ + ++C+IQ+  
Sbjct: 68  QPYKKVLSQRHLTMISIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGASMFCVIQSAS 126

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           E+A  +  + G ++++ +  VD +  F V   Y + WL + P EL+  S+TI YWN  ++
Sbjct: 127 ELACQF-PVTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGCSLTISYWNSTIN 185

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSG-Y 256
           P V+V IF + ++ INLFG  R +AE EF  ++ K+L                   SG Y
Sbjct: 186 PAVWVAIFLVFVLWINLFG-VRLFAETEFVLSIIKVLAIVIFIIIGIVLIAGGGQDSGGY 244

Query: 257 IGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           IG  YW++PG F        FK + +T V+AAFS+G +E + +T +E  N   +I  AAK
Sbjct: 245 IGTRYWHDPGPFAKPV----FKNLCNTFVSAAFSYGGSEMVLLTGTESKNI-SSIARAAK 299

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQT-KASPYVIAVA---SHGIRIAPHF 372
              YR    Y+ +++++G LVPYN P LL + SS+   ASP+VIA+    S G +++ +F
Sbjct: 300 GTFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSEDISASPFVIALGNTGSMGSKVS-NF 358

Query: 373 INAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIA 432
           +NA+IL+SV+SV NS+ Y+SSR++  L   G+ P I  Y+D KGRPL GI        + 
Sbjct: 359 MNAIILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGIAITGAFGLLG 418

Query: 433 FCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVW 492
           F  ++ K++EVF+WL A+  ++   TW  ICL+ +RFR AMK + RS   + Y+S +G++
Sbjct: 419 FLVATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRSMLGIY 478

Query: 493 GSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-N 551
           G I    V FL++ G+ +V+ WP++   ++   FF+  L++PI+++ + G+K ++ DW N
Sbjct: 479 GGIAGCIVNFLLIAGEIYVSAWPVDGK-SSAEGFFEYDLSIPIMIIVFLGHKIYRNDWKN 537

Query: 552 LFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            +++ +D+DL +   I + ++ + +K   KE+L    L+ +IY FWC
Sbjct: 538 WYVKRRDMDLDTGCSIENLELFQSQKESEKEDLACKPLYYRIYRFWC 584

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  370 bits (950), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 202/562 (35%), Positives = 333/562 (59%), Gaps = 22/562 (3%)

Query: 49  KIDDNNNQYEI----EKNEINNI-KSDQFNDKLNNQ-LQKTIQPRHVIMISXXXXXXXXX 102
           +I ++  ++E+    E  EIN++ + ++   +L +Q  QK +  RH+ MI+         
Sbjct: 33  RIKNSFKRHELTLISEDQEINDVPEQERIQRRLASQPYQKVLDQRHLTMIAIGGTLGTGL 92

Query: 103 XXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAW 162
                 +L  +GP  LLIG++++ + ++C++Q+  E++  Y  + G +  + S  VD + 
Sbjct: 93  FIGLGYSLA-SGPGALLIGFLLVGTSMFCVVQSAAELSCQY-PVSGSYATHVSRFVDESV 150

Query: 163 NFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYA 222
            F V+  Y + WL   P EL+  S+TI YWN+ V+P V+V IFY+ I+ +NLFG  RG+A
Sbjct: 151 GFTVSTNYALAWLISFPSELIGCSITITYWNQSVNPAVWVAIFYIFIMGLNLFG-VRGFA 209

Query: 223 EAEFFFNLCKILMXXXXXXXXXXXXXXXX-XTSGYIGVSYWNNPGAFRGHTPGTRFKGIV 281
           E EFF ++ K+L                   +SGYIG  YW+ PG+F        FK + 
Sbjct: 210 ETEFFLSIIKVLAIIIFIIIGIVLIAGGGPDSSGYIGTKYWHQPGSFAQPV----FKNLC 265

Query: 282 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNS 341
           +T V+AAFSFG +E + +T++E  N   +I  AAK   +R    Y+ +++I+G LVPY  
Sbjct: 266 NTFVSAAFSFGGSELVLLTSTEARNV-SSIARAAKGTFWRIAVFYITTVVIIGCLVPYTD 324

Query: 342 PELL-GSKSSQTKASPYVIAVA---SHGIRIAPHFINAVILISVLSVANSSFYSSSRMLL 397
             LL GS S    ASP+VIA++   S G ++A +F+N +ILI+VLSV NS  Y+SSR++ 
Sbjct: 325 ERLLNGSSSEDVSASPFVIALSNSGSMGGKVA-NFMNVIILIAVLSVCNSCVYASSRIIQ 383

Query: 398 TLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVF 457
            L   G  PK  +++D+KGRPL GI  + +   + F  +  KE EVF+WL A+  +S  F
Sbjct: 384 ALGAAGQLPKACSFIDKKGRPLVGIAISGVFGLLGFLVACDKEGEVFTWLFALCSISSFF 443

Query: 458 TWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN 517
           TW  ICLS +RFR A++ QGR  +++ YKS +GV+G I    + FL++ G+ +VA  P+ 
Sbjct: 444 TWFCICLSQVRFRMALRAQGRPKSDIAYKSMLGVYGGIVGCVLNFLLIAGEIYVASSPVG 503

Query: 518 SNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDEDVLKQE 576
              ++   FF+  L++PI+++ YFG++ ++ DW N +I+ ++IDL +   I + ++ +Q+
Sbjct: 504 GE-SSARGFFEYCLSIPIMIVVYFGHRFYRNDWGNWYIKRRNIDLDTGCSIENVELFRQQ 562

Query: 577 KNQYKENLKNGSLWLKIYAFWC 598
           + Q +E + +   + +IY FWC
Sbjct: 563 REQEQEKISSRPFYYRIYRFWC 584

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  367 bits (941), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/556 (36%), Positives = 317/556 (57%), Gaps = 18/556 (3%)

Query: 50  IDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXAT 109
           ++    +  I +  +++ K        ++ L+K+++ RH+IMI+                
Sbjct: 43  VNHRGTKRNIIQRMVDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKA 102

Query: 110 LHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWV 169
           L   GP  L+IG+ +  + +   I   GE+ V +  ++G F +Y +  ++ + +F V  +
Sbjct: 103 LAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVVLI 161

Query: 170 YCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFN 229
           Y +QW  V PLE++ A+MT++YW   V P  +V IFY  I  +NL G  RG+ EAEF F+
Sbjct: 162 YVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLG-VRGFGEAEFIFS 220

Query: 230 LCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAF 289
           L K+L                     ++G  YW++PG          FKG+ +  V A++
Sbjct: 221 LIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPL-----ANGFKGVAAVFVIASY 275

Query: 290 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKS 349
           S G TE +A  AS +++P K +PSA K+V +R +F ++ S+ +VGFLVPY +  L+G  S
Sbjct: 276 SLGGTE-MACLASGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS 333

Query: 350 SQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIF 409
                SP+VIA+  HGI+  P  +NAVIL+S+LSV NS  ++SSR L ++A QG  P+IF
Sbjct: 334 VDN--SPFVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIF 391

Query: 410 TYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRF 469
            Y+DR GRPL GI+       +AF   S    +VF+WL+AI+GL+    W +I +SHIRF
Sbjct: 392 GYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRF 451

Query: 470 RRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL---NSNGANITNF 526
           R AMK QG SL+EL + S VGV+GS+Y+AT+  LIL+ QF+V+LWP+   +S      NF
Sbjct: 452 RMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENF 511

Query: 527 FKEYLAMPILLLFYFGYKTWKK----DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKE 582
           F+ YL   ILLL + G+K + +     W  F   +DIDL++   + D ++ K E ++ + 
Sbjct: 512 FQNYLCSLILLLLFAGHKIYYRISTGKWWGFKALRDIDLLTDMRVTDTELSKHELHEKRV 571

Query: 583 NLKNGSLWLKIYAFWC 598
            L    L +++Y  WC
Sbjct: 572 KLAQKPLIVRLYHQWC 587

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  358 bits (920), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/591 (35%), Positives = 339/591 (57%), Gaps = 24/591 (4%)

Query: 22  IVTNENQINESHSKLIENLKDFVDS-FKKIDDNNNQYEIEKNEINNIKSDQFND-KLNNQ 79
           +  +  Q++E+ ++ +   +D   S F ++ D+  + E+ + E  ++ +    D +  N 
Sbjct: 8   LAKDPTQVSENFTQSLYTDEDGSRSLFTRVKDSFKRQELVETEGIDLDTYSMTDYQRTNY 67

Query: 80  L------QKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCII 133
           L      QK +  RH+ MI+               +L + GP  LLIG+++    I+C++
Sbjct: 68  LLAKQPYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSLAS-GPGNLLIGFLLTGLAIFCVV 126

Query: 134 QACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWN 193
           Q   E++  Y  + G F ++ S  VD +W F V   YC+ W    P EL+  +MTI YW+
Sbjct: 127 QCAAELSCQY-PVSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWD 185

Query: 194 EKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXT 253
             V+P V+V IF+L I+A+NLFG  RG+AE E+  ++ KIL                   
Sbjct: 186 SSVNPVVWVIIFWLFIMALNLFG-VRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPN 244

Query: 254 S-GYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIP 312
           S GYIG  YW++PG+F+       FK + +T V+AAFSFG TE + +TA+E S   ++I 
Sbjct: 245 SNGYIGTKYWHDPGSFKAPV----FKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESIS 299

Query: 313 SAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQT-KASPYVIAVASHGI---RI 368
            AAK   +R +  YV +++++G LVPY    LLG  +S+   ASP+VIA+A+ G    R+
Sbjct: 300 RAAKGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERV 359

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
           + +F+NAVILI+VLSV NS  Y++SR++ +L   G  P I  Y+DRKGRPLFGI+   L 
Sbjct: 360 S-NFMNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLF 418

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             + F  +S K +EVF WL A+  +S +F W +IC S++R+R A+K Q RS +E+ YKS 
Sbjct: 419 GFLPFIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSM 478

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           +G+WG+     +  L+++G+ +V+L+PL  +  +   FFK  L++PI++  Y G+K++  
Sbjct: 479 LGIWGAYLGLLLSALLIVGEIYVSLFPLGES-PSAEAFFKYCLSIPIMIAVYIGHKSYTG 537

Query: 549 DWNLF-IRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +W  F I    IDL +     D +++K E    +  L +  L+ +I+ FWC
Sbjct: 538 NWKSFVIPLSGIDLDTGLSHSDVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  358 bits (918), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/570 (37%), Positives = 324/570 (56%), Gaps = 28/570 (4%)

Query: 40  LKDFVDSFKK----IDDNNNQYEIEKNEINNIKSDQFNDKLNNQ-LQKTIQPRHVIMISX 94
           LK F DSFKK    + +N +  ++E  E       + N  L +Q  ++T+  RH+ MIS 
Sbjct: 34  LKRFRDSFKKHEPILPENVDLSQMEDYE-------RTNYLLAHQPYKRTLSQRHLTMISI 86

Query: 95  XXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYP 154
                         +L  +GP  LLIG+ I+   I+C++Q   E++  Y  + G F  + 
Sbjct: 87  GGTLGTGLFIGLGYSL-TSGPGNLLIGFTIIGISIFCVVQCAAELSCQY-PVSGSFATHV 144

Query: 155 SFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINL 214
           S  +D++  F V+  Y + WL   P EL+  ++T++YWN+ V+P V++ IFY+ I+ +NL
Sbjct: 145 SRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYWNDSVNPAVWIAIFYVFIMCLNL 204

Query: 215 FGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GYIGVSYWNNPGAFRGHTP 273
           FG  RG+AE EF+ +L KI                    S GYIG  YW++PGAF     
Sbjct: 205 FG-VRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGAKYWHDPGAFVKPV- 262

Query: 274 GTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIV 333
              FKG+ +T V+AAFSFG  E + +TA+E S   ++I  AAK   +R    Y+ +++I+
Sbjct: 263 ---FKGLCNTFVSAAFSFGGAELVVLTANE-SRKIESISRAAKGTFWRIAVFYITTVVII 318

Query: 334 GFLVPYNSPELLGSKSS-QTKASPYVIAVA---SHGIRIAPHFINAVILISVLSVANSSF 389
           G LVP     LLG+ S     ASP+VIA++   S G +++ HF+NAVILI+VLSV NS  
Sbjct: 319 GCLVPSTDERLLGAASDVDVTASPFVIALSNTGSFGDKVS-HFMNAVILIAVLSVCNSCV 377

Query: 390 YSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLA 449
           Y++SR++ +L      P    Y+DRKGRPL GI    +   + F  +S KE EVF+WL A
Sbjct: 378 YAASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFGLLGFLVASSKEGEVFTWLFA 437

Query: 450 ISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQF 509
           +  +S  FTW  IC S +RFR A++ QGRS +E+ YKS +G WG +    +  L++ G+ 
Sbjct: 438 LCSISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGCVLNILLIAGEI 497

Query: 510 WVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIY 568
           +V+L+PL  +  N   FF+  L++PI++  YF ++ ++ +W +  I  K IDL + R   
Sbjct: 498 YVSLFPLGGS-PNAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTKKIDLDTGRKAE 556

Query: 569 DEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           D +++K E    K  + +  L+ +IY FWC
Sbjct: 557 DLELMKHEILTEKARIASKPLYYRIYRFWC 586

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  356 bits (913), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/527 (37%), Positives = 311/527 (59%), Gaps = 14/527 (2%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           N  LQKT+  RH++MI+               +L ++GP  LLIG++I+   ++C++Q+ 
Sbjct: 82  NQPLQKTLSQRHLMMIAIGGTLGTGLFIGIGYSL-SSGPGSLLIGFLIVGLMMFCVVQSA 140

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
            E+A  Y  + G +  + S  ++ +  F VA  Y + WL   P EL+  +MT++YWN+ V
Sbjct: 141 AELACQY-PVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNKSV 199

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-G 255
           +P V+V IFY+ I+++N+FG  R Y EAEF+ +L K++                   S G
Sbjct: 200 NPAVWVAIFYVFIMSLNMFG-VRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTG 258

Query: 256 YIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           YIG  YW++PG+F        FKG+ +T V+AAFSFG  E + +TASE S   +++  AA
Sbjct: 259 YIGTKYWHDPGSFAKPV----FKGLCNTFVSAAFSFGGAELVVLTASE-SRKVESVSRAA 313

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQT-KASPYVIAVASHGI--RIAPHF 372
           K   +R    Y+ ++I++G LVPY + +LLG  + +   ASP+VIA++  G     A HF
Sbjct: 314 KGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASHF 373

Query: 373 INAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIA 432
           +N VILI+VLSV NS+ Y+SSR++  L   G  PKI  Y+D+KGRPL GI    +   + 
Sbjct: 374 MNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLLG 433

Query: 433 FCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVW 492
           F  +S  E +VF+WL A+  +S  FTW  IC S +RFR A++ QGRS +E+ +KS +G++
Sbjct: 434 FLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSMLGIY 493

Query: 493 GSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW-KKDWN 551
           G      +  L++ G+ +V+++PL  +  +   FF+  L++PI++  Y G+K +  K   
Sbjct: 494 GGFLGCLLNALLIAGEIYVSIFPLGGD-PSAKQFFQYCLSIPIMIAVYIGHKLFANKSKR 552

Query: 552 LFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           + I A++IDL + R I D +  K E  + KE L +  L+ +IY FWC
Sbjct: 553 VLIPAQEIDLETGRKIKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC 599

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  352 bits (902), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/490 (38%), Positives = 293/490 (59%), Gaps = 15/490 (3%)

Query: 48  KKIDDNNNQYE--IEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXX 105
            ++  N   Y+  +    I++ K  +      + L+++++ RH+IMI+            
Sbjct: 43  DQVQPNKKAYKRNLFHRCIDSFKPPENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVG 102

Query: 106 XXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFA 165
               L   GP  ++IG++I  + +   I   GE+ V +  ++G F +Y +  +D + +F 
Sbjct: 103 SGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLDPSLSFV 161

Query: 166 VAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAE 225
           V+ +Y +QW  V PLE++ ++MTI++WN  +DP V+V IFY+ I+AINLFG  RG+ EAE
Sbjct: 162 VSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIFYVTIVAINLFG-VRGFGEAE 220

Query: 226 FFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLV 285
           F F+  K++                  T  Y+G  YW++PGA         FKG+ S  V
Sbjct: 221 FLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPGAL-----AHGFKGVASVFV 275

Query: 286 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL 345
           TA++S G +E +A  AS +++P K +PSA K+V +R +F ++ S+ +VGFLVPY +  LL
Sbjct: 276 TASYSLGGSE-MACLASGETDP-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLL 333

Query: 346 GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYA 405
           G   S    SP+VIA   + I++ P  INAVIL+S++SV NS  ++SSR L ++A QG  
Sbjct: 334 GG--SSVNNSPFVIACNLYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLI 391

Query: 406 PKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLS 465
           P+IF Y+DR GRPL GII  SL   +AF   S   +EVF+WL+AI+GL+    W +I +S
Sbjct: 392 PQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVS 451

Query: 466 HIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN--SNGANI 523
           HIRFR AMK Q ++L+EL + S VG+WGS+Y+A V  LILI QF+++LWP+   ++ A+ 
Sbjct: 452 HIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVNVLILIAQFYISLWPVGGWTDSASR 511

Query: 524 TNFFKEYLAM 533
              F   L M
Sbjct: 512 VKLFFPKLPM 521

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  352 bits (902), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/595 (34%), Positives = 334/595 (56%), Gaps = 23/595 (3%)

Query: 16  SVNKNVIVTNENQINESHSKLIENLKD------FVDSFKKIDDNNNQYEIEKNEINNIKS 69
           S  + V V  E    ES +    N  +      F DSF ++D+     E++ ++    K 
Sbjct: 21  SSKEFVKVEEEAFTEESSASYTRNYSEGTFFERFKDSFTRVDNIEPYSELDGDKYT--KD 78

Query: 70  DQFNDKLNNQ-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASC 128
           +Q    L  Q  +K++  RH+ MI+               +L  +GPA LLIG++I+ + 
Sbjct: 79  EQIQMTLAAQPYKKSLHQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPASLLIGFLIVGTS 137

Query: 129 IYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMT 188
           ++C++Q+  E++  Y  + G +  + S  +D +  F V+  Y + WL   P EL+  SMT
Sbjct: 138 MFCVVQSAAELSCQY-PVSGSYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMT 196

Query: 189 IKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXX 248
           I YWN+ ++P V++ IFY+ I+ +NLFG  +G+AE EF+ +L K++              
Sbjct: 197 ISYWNDSINPCVWIAIFYVFIMILNLFG-VKGFAETEFWLSLIKVIAIIIFIIVGIVLIC 255

Query: 249 XXX-XTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
                +SGYIG  YW++PG+F        FKG+ +T V+AAFSFG +E + +TA+E  N 
Sbjct: 256 GGGPESSGYIGTKYWHDPGSFAPPV----FKGLCNTFVSAAFSFGGSELVLLTAAESKNI 311

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQ-TKASPYVIAVASHGI 366
             AI  AAK   +R    Y+ +++I+G LVPYN   LLG  S +   ASP+V+A+ S   
Sbjct: 312 -SAISRAAKGTFWRIAVFYIATVVIIGCLVPYNDRRLLGGASDEDVSASPFVLALGSSTD 370

Query: 367 --RIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIA 424
             R   +F+N VILI+V+SVANS  Y+SSR++  L   G  P I  Y+D+ GRPL GI  
Sbjct: 371 LGRKLSNFMNFVILIAVVSVANSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAI 430

Query: 425 ASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELG 484
             +   + F  +S  E  VF+WL A+  +S  FTW  IC S +RFR A+K Q RS +++ 
Sbjct: 431 CGVFGLLGFLVASSNERTVFTWLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIA 490

Query: 485 YKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544
           +KS +G++G I  + +  L+++G+ +V+  PL    ++   FF+  L++P++LL +  ++
Sbjct: 491 FKSMLGIYGGILGSILNILLIMGEIYVSASPLGEP-SSAEAFFENCLSIPLMLLVFIAHR 549

Query: 545 TWKKDWNLFIRAKD-IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            ++K+W  + ++ D IDL +     D ++ K ++ Q K  +++  L+ KIY FWC
Sbjct: 550 FYRKNWRDWYKSLDEIDLDTGCSYDDIELFKHQREQIKHKIQSKPLYYKIYRFWC 604

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  350 bits (898), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/566 (35%), Positives = 330/566 (58%), Gaps = 20/566 (3%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ-LQKTIQPRHVIMISXXXXX 98
           L  F DSFK++D +     I++++      ++   +L  Q L+K +  RH+ MI+     
Sbjct: 33  LYRFRDSFKRVDLDAT---IDEDDSKYTAEEKVQLRLAKQPLKKALMQRHLTMIAIGGTL 89

Query: 99  XXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLV 158
                     +L + GP  LLIG+I++   ++C++Q+  E++  Y  + G +  + +  +
Sbjct: 90  GTGLFIGLGYSLAS-GPGCLLIGFILVGLSMFCVVQSAAELSCQY-PVSGSYATHVTRFI 147

Query: 159 DTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGA 218
           D +  F V+  Y + WL   P EL+ ++M I+YWN+ VDP V++ IFYL ++ +NLFG  
Sbjct: 148 DESIGFTVSTNYALAWLISFPSELMGSAMVIQYWNDSVDPAVWIAIFYLFVMFLNLFG-V 206

Query: 219 RGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXX-XTSGYIGVSYWNNPGAFRGHTPGTRF 277
            G+AE EF+ ++ KIL                   +SGYIG  YW+NPG+F        F
Sbjct: 207 EGFAETEFWLSIIKILAIIIFIIIGIVLICGGGPGSSGYIGTKYWHNPGSFAHPV----F 262

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
           K + +T V+AAFSFG  E + +TA+E S    AI  AAK   +R    Y+ +++I+G LV
Sbjct: 263 KSLCNTFVSAAFSFGGAELVLLTAAE-SKKISAISRAAKGTFWRIAVFYITTVVIIGCLV 321

Query: 338 PYNSPELLGSKSSQ-TKASPYVIAV---ASHGIRIAPHFINAVILISVLSVANSSFYSSS 393
           PY    LLG+ S +   ASP+VIA+    S G  +A +F+N +IL++V+SV NS  Y+SS
Sbjct: 322 PYTDERLLGASSDEDVTASPFVIALTNAGSMGSSVA-NFMNVIILVAVISVCNSCVYASS 380

Query: 394 RMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGL 453
           R++  L   G  P+I  Y+D+KGRPL GI+   +   +AF     +E  VF+WL A+  +
Sbjct: 381 RVIQALGSAGQLPRICGYIDKKGRPLVGIVICGIFGLLAFLIDCSEEGTVFTWLFALCSI 440

Query: 454 SQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVAL 513
           S  FTW  IC S +R+R A+K Q RS +E+ YKS +G++G I  + +  L+++G+ +V++
Sbjct: 441 SSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSMLGIYGGILGSLLNILLIMGELYVSI 500

Query: 514 WPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDEDV 572
            PL+ +  + + FF+  L++PI+++ Y  +KT+KK W +LFI  K IDL + R + +  +
Sbjct: 501 SPLDES-PSASAFFENCLSIPIMIVVYIFHKTYKKGWRSLFIPLKHIDLDTGRAVENLAL 559

Query: 573 LKQEKNQYKENLKNGSLWLKIYAFWC 598
            KQ++ + K  + +   + ++Y FWC
Sbjct: 560 FKQQREEQKIIIASKPFYYRVYRFWC 585

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/575 (35%), Positives = 335/575 (58%), Gaps = 20/575 (3%)

Query: 30  NESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ-LQKTIQPRH 88
           ++    LI  +KD   SFK+ + +    ++E +E    + ++   KL +Q  QK +  RH
Sbjct: 27  SDRSGSLIRRMKD---SFKQSNLHVIPEDLENSE--QTEQEKIQWKLASQPYQKVLSQRH 81

Query: 89  VIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIG 148
           + MI+               +L  +GPA LLIG++++ + ++C++Q+  E++  +  + G
Sbjct: 82  LTMIAIGGTLGTGLFIGLGYSLA-SGPAALLIGFLLVGTSMFCVVQSAAELSCQF-PVSG 139

Query: 149 GFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLL 208
            +  + S  +D +  F VA  Y + WL   P EL+  ++TI YWN+ V+P V+V IFY+ 
Sbjct: 140 SYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAVWVAIFYVF 199

Query: 209 IIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GYIGVSYWNNPGA 267
           I+ +NLFG  RG+AE EF  ++ K++                   S GYIG  YW++PGA
Sbjct: 200 IMVLNLFG-VRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGAKYWHDPGA 258

Query: 268 FRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYV 327
           F        FK + +T V+AAFSFG +E + +T++E  N   AI  AAK   +R    Y+
Sbjct: 259 FAKPV----FKNLCNTFVSAAFSFGGSELVLLTSTESKNI-SAISRAAKGTFWRIAIFYI 313

Query: 328 GSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGIRIA--PHFINAVILISVLSV 384
            +++I+G LVPYN P LL GS S    ASP+VIA+++ G   A   +F+N VIL++V+SV
Sbjct: 314 TTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVILVAVVSV 373

Query: 385 ANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVF 444
            NS  Y+SSR++  L   G  P + +Y+DRKGRPL GI  +     + F  +S KE EVF
Sbjct: 374 CNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASKKEDEVF 433

Query: 445 SWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLI 504
           +WL A+  +S  FTW  IC+S IRFR A+K QGRS +E+ YKS +GV+G I    +  L+
Sbjct: 434 TWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILGCVLNALL 493

Query: 505 LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLIS 563
           + G+ +V+  P+ S  ++   FF+  L++PI+++ YF ++ +++DW + +I+  +IDL +
Sbjct: 494 IAGEIYVSAAPVGSP-SSAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDT 552

Query: 564 HRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
              + + ++ K +K   ++ + +   + KIY FWC
Sbjct: 553 GCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC 587

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  345 bits (886), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/587 (34%), Positives = 334/587 (56%), Gaps = 24/587 (4%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN 77
           + +V+ T  N+ N     LI   K+   SFK+ D    Q  +  +E++  +  Q+ D  N
Sbjct: 15  STSVLSTPSNEGN----NLIHRFKN---SFKRNDSPAIQEGLLYSELSEEEKIQW-DLAN 66

Query: 78  NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
              +K +  RH+ MI+               +L + GPA LLIG++++ + + C++Q   
Sbjct: 67  QPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLAS-GPASLLIGFLLVGASMLCVVQCGA 125

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           E++  Y  + G +  + S  +D +  F++   Y + WL   P ELV  S+TI YW   V+
Sbjct: 126 ELSCQY-PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVN 184

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GY 256
           P  +V I ++L + +NLFG ARG+AE+EF+ ++ KI+                   S GY
Sbjct: 185 PAAWVAIAFVLSMLLNLFG-ARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGY 243

Query: 257 IGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           IG  YW++PG+F        FK + +T V+AA+SF  TE + +T++E +    ++  AAK
Sbjct: 244 IGTKYWHDPGSFAVPV----FKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSVSSVSRAAK 298

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVA---SHGIRIAPHF 372
              +R +  Y+ ++II+G LVPYN P L+ GS S    ASP+VIA++   + G R++ HF
Sbjct: 299 GTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVS-HF 357

Query: 373 INAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIA 432
           +NAVILI+V SV NS  Y+SSR++  LA  G  PKI  Y+DR GRPL G+        + 
Sbjct: 358 MNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLG 417

Query: 433 FCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVW 492
           F   S  +  VF+WL A+  +S   TW  IC   +RFR AMK QGRS +++ Y+S +G++
Sbjct: 418 FLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIY 477

Query: 493 GSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-N 551
           G I+   +  L++IG+ +V+  P+ S  ++  NFF+  +++PI++  Y G++ +++DW +
Sbjct: 478 GGIFGCILNVLLVIGEIYVSAAPVGSP-SSAANFFEYCMSIPIMIAVYIGHRIYRRDWRH 536

Query: 552 LFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            +I+  DIDL S   + D +  K E+++ K+ + +  L+ +IY F+C
Sbjct: 537 WYIKRMDIDLDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC 583

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/586 (34%), Positives = 329/586 (56%), Gaps = 22/586 (3%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN 77
           + +VI T  N  N     LI   K+   SFK+ D +  Q  +  +E+   +  Q+ D  N
Sbjct: 15  STSVISTTSNDGNN----LIHRFKN---SFKRNDSSAIQDGLLYSELTEEEKIQW-DLAN 66

Query: 78  NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
              +K +  RH+ MI+               +L  +GPA LLIG++++ + + C++Q   
Sbjct: 67  QPYKKVLSQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGA 125

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           E++  Y  + G +  + S  +D +  F++   Y + WL   P ELV  S+TI YW   V+
Sbjct: 126 ELSCQY-PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVN 184

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GY 256
           P  +V I ++L + +N+FG ARG+AE+EF+ ++ KI+                   S GY
Sbjct: 185 PAAWVAIAFVLSMLLNMFG-ARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPDSTGY 243

Query: 257 IGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           IG  YW++PG+F    P   FK + +T V+AA+SF  TE + +T++E  N   ++  AAK
Sbjct: 244 IGTKYWHDPGSF---APPV-FKNLCNTFVSAAYSFSGTEMVVLTSTEARNV-SSVSRAAK 298

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGI--RIAPHFI 373
              +R +  Y+ ++II+G LVPYN   L+ GS S    ASP+VIA+++ G   +   HF+
Sbjct: 299 GTFWRIVIFYIVTVIIIGCLVPYNDSRLINGSSSEDITASPFVIALSNTGTMGKRVSHFM 358

Query: 374 NAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAF 433
           NAVILI+V SV NS  Y+SSR++  LA  G  P+I  Y+DR GRPL G+        + F
Sbjct: 359 NAVILIAVFSVCNSCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGLLGF 418

Query: 434 CASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWG 493
              S  +  VF+WL A+  +S   TW  IC   +RFR AMK QGRS +++ Y+S +G++G
Sbjct: 419 LVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYG 478

Query: 494 SIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NL 552
            I    +  L++IG+ +V+  P+ S  ++  NFF+  +++PI++  Y G++ ++KDW + 
Sbjct: 479 GIVGCILNVLLVIGEIYVSAAPVGSP-SSAANFFEYCMSIPIMIAVYIGHRIYRKDWRHW 537

Query: 553 FIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           +I+ +DIDL S   + D +  K E++  K  + +  L+ +IY F+C
Sbjct: 538 YIKRRDIDLDSGHSLEDFEATKLERDHDKRYVASRPLYYRIYRFFC 583

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  340 bits (871), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/583 (33%), Positives = 322/583 (55%), Gaps = 22/583 (3%)

Query: 28  QINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQP- 86
           Q   + +++     DF    K++ D+  Q E+   +  +   D  ++K   QL+   QP 
Sbjct: 13  QTTNTLTQIESQQDDFSSPLKRLKDSFKQSELAPID-EDSGFDGLSEKEKIQLKLASQPY 71

Query: 87  ------RHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140
                 RH+ MI+               +L   GP  LLIG++++ + I+C++Q+  E++
Sbjct: 72  EKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-CGPGALLIGFLLVGTSIFCVVQSAAELS 130

Query: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDV 200
             +  + G +  + S  +D +  F VA  Y + WL   P EL+  S+TI YW++  +P V
Sbjct: 131 CQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWDQTTNPAV 189

Query: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GYIGV 259
           +V IFY+ I+ +NLFG  RG+AE EF  ++ KIL                   S GYIG 
Sbjct: 190 WVAIFYVFIMTLNLFG-VRGFAEVEFVLSVIKILAIIIFIIIGIILIAGGGPDSKGYIGT 248

Query: 260 SYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
            YW++PG+F        FK + +T V+AAFSFG +E + +T S++S    AI  AAK   
Sbjct: 249 KYWHDPGSFNNPV----FKNLCNTFVSAAFSFGGSELVLLT-SKESKSVSAISRAAKGTF 303

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQ-TKASPYVIAVASHGI--RIAPHFINAV 376
           +R    Y+ +++I+G LVPY    LL  +S +   ASP+VIA+++ G   +    F+N V
Sbjct: 304 WRIAIFYITTVVIIGCLVPYTDDRLLNGRSDEDVTASPFVIALSNTGSMGKKVSDFMNVV 363

Query: 377 ILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCAS 436
           ILI+V+SV NS  Y++SR++  L   G  PKI  Y+DR+GRPL GI  + +   + F  +
Sbjct: 364 ILIAVVSVCNSCVYAASRVIQALGASGQLPKICGYIDRRGRPLVGIAISGIFGLLGFLVA 423

Query: 437 SPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIY 496
           S +E++VF+WL A+  +S  FTW  IC S IRFR A+K QGRS +++ YKS +GV+G I 
Sbjct: 424 SSEESKVFTWLFALCSISSFFTWFCICYSQIRFRMALKYQGRSTDQIAYKSMLGVYGGIL 483

Query: 497 AATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIR 555
              +  L++ G+ +V+  P+    +    FF+  L++PI++  Y  ++ ++KDW + +I+
Sbjct: 484 GCILNILLIAGEIYVSASPVGEK-STAEGFFEYCLSIPIMISVYVLHRIYRKDWTHWYIK 542

Query: 556 AKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
             DIDL +   + + ++ K+++ + K        + KIY F C
Sbjct: 543 RSDIDLDTGCSVENIELFKEQREEEKIYAATKPFYYKIYRFLC 585

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/565 (34%), Positives = 321/565 (56%), Gaps = 17/565 (3%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXX 99
           ++ F +SFK+ D +  Q  +  +E++  +  Q+ D  N   +K +  RH+ MI+      
Sbjct: 30  VRRFKNSFKRKDASVIQEGLLYSELSEEEKVQW-DLANQPYKKVLDQRHLTMIAIGGTLG 88

Query: 100 XXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVD 159
                    +L + GPA LLIG++++ + + C++Q   E++  Y  + G +  + S  +D
Sbjct: 89  TGLFIGLGESLAS-GPASLLIGFLLVGASMLCVVQCGAELSCQY-PVSGSYALHASRFID 146

Query: 160 TAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGAR 219
            +  F+V   Y + WL   P ELV  S+T+ YW   V+P V+V I + L + +NLFG AR
Sbjct: 147 PSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFTLSMLLNLFG-AR 205

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GYIGVSYWNNPGAFRGHTPGTRFK 278
           G+AE+EF+ ++ KI+                   S GYIG  YW +PG+F        FK
Sbjct: 206 GFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSFAPPA----FK 261

Query: 279 GIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVP 338
              +T V+AA+SF  TE + +T++E  +   ++  AAK   +R    Y+ ++II+G LVP
Sbjct: 262 NFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRAAKGTFWRIAVFYIVTVIIIGCLVP 320

Query: 339 YNSPELL-GSKSSQTKASPYVIAVA---SHGIRIAPHFINAVILISVLSVANSSFYSSSR 394
           YN P L+ GS S    ASP+VIA++   + G R++  F+NAVILI+V SV NS  Y+SSR
Sbjct: 321 YNDPRLINGSSSEDITASPFVIALSNTGAMGTRVS-QFMNAVILIAVFSVCNSCVYASSR 379

Query: 395 MLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLS 454
           ++  LA  G  PKI  Y+DR GRPL G+        + F   S  +  VF+WL A+  +S
Sbjct: 380 LIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFALCSIS 439

Query: 455 QVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALW 514
              TW  IC   IRFR AMK QG+  +++ YKS +G++G +   T+  L++IG+ +V+  
Sbjct: 440 FFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEIYVSAA 499

Query: 515 PLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDEDVL 573
           P+    ++  NFF+  +++PI++  Y G++ +++DW + +I+ +DIDL S   + D +  
Sbjct: 500 PVGMP-SSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLEDLEAT 558

Query: 574 KQEKNQYKENLKNGSLWLKIYAFWC 598
           K  ++Q KE + +  L+ ++Y F+C
Sbjct: 559 KLRRDQEKEYVASRPLYYRLYRFFC 583

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  338 bits (866), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/592 (35%), Positives = 338/592 (57%), Gaps = 23/592 (3%)

Query: 14  HLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFN 73
            +     +I T   + ++S S LI  +KD   SFK+ + +    ++E +E    + ++  
Sbjct: 15  KIETESTMIPTGLERSDKSES-LIRRMKD---SFKQSNLHVIPEDLENSE--QTEQEKIQ 68

Query: 74  DKLNNQ-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCI 132
            KL +Q  QK +  RH+ MI+               +L  +GPA LLIG++I+ + ++C+
Sbjct: 69  WKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPAALLIGFLIVGTSMFCV 127

Query: 133 IQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW 192
           +Q+  E++  +  + G +  + S  +D +  F VA  Y + WL   P EL+  S+TI YW
Sbjct: 128 VQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCSLTISYW 186

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
           N+ V+P V+V IFY  I+ +NLFG  +G+AE EF  ++ K++                  
Sbjct: 187 NQTVNPAVWVAIFYTFIMVLNLFG-VKGFAETEFALSIIKVVAIIIFIIIGIVLIAGGGP 245

Query: 253 TS-GYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311
            S GYIG  YW+NPGAF        FK + +T V+AAFSFG +E + +T++E S    AI
Sbjct: 246 NSTGYIGTKYWHNPGAFAKPV----FKNLCNTFVSAAFSFGGSELVLLTSTE-SKDISAI 300

Query: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAV---ASHGIR 367
             AAK   +R    Y+ +++I+G LVPYN   LL GS S    ASP+VIA+    S G +
Sbjct: 301 SRAAKGTFWRIAIFYITTVVIIGCLVPYNDSRLLSGSTSEDISASPFVIALRNTGSMGAK 360

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           ++ +F+N VIL++V+SV NS  Y+SSR++  L   G  P + +Y+DRKGRPL GI  +  
Sbjct: 361 VS-NFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGA 419

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
              + F  +S KE EVF+WL A+  +S  FTW  ICLS +RFR A+K QGRS +E+ YKS
Sbjct: 420 FGLLGFLVASNKEDEVFTWLFALCSISSFFTWFCICLSQVRFRMALKTQGRSKDEIAYKS 479

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWK 547
            +GV+G +    +  L++ G+ +V+  P+ S  ++   FF+  L++PI+++ Y  ++ ++
Sbjct: 480 ILGVYGGVLGCVLNALLIAGEVYVSAAPVGSP-SSAKAFFEYCLSIPIMIVVYIAHRIYR 538

Query: 548 KDWNL-FIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           KD    +I+  +IDL +   + + ++ K +K   K+ + +   + KIY FWC
Sbjct: 539 KDRRRWYIKRSEIDLDTGCSVENLELFKAQKEAEKQLIASKPFYYKIYRFWC 590

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/586 (34%), Positives = 335/586 (57%), Gaps = 26/586 (4%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQF-NDKLNNQ-LQ 81
           T+ + IN    K    + D   SF++ +  N+    E  +++ +  +Q  N +L NQ  +
Sbjct: 26  TSGSLINRFKQKSRRQIHDIAHSFQRQEAPNS----EGVDLSLLSEEQRRNYELANQPYE 81

Query: 82  KTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAV 141
           K++  RH++MIS               +L  +GP  LLIG++I+   ++C++Q+  EMA 
Sbjct: 82  KSLSQRHLMMISIGGTLGTGLFIGLGFSL-ASGPGSLLIGFLIVGLMMFCVVQSAAEMAC 140

Query: 142 NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVF 201
            Y  + G F+ + S  ++ +  F V+  Y + WL   P EL+  ++T++YW+  V+  V+
Sbjct: 141 QY-PVSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLRYWS-SVNGAVW 198

Query: 202 VTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXX-XTSGYIGVS 260
           V IFY+ I+ +NLFG  RGY EAEF+ +L K++                   +SGYIG  
Sbjct: 199 VAIFYVFIMQLNLFG-VRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPHSSGYIGTK 257

Query: 261 YWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320
           YW+NPG+F        FKG+ +T ++AAFSFG  E + +TASE S   +++  AAK   +
Sbjct: 258 YWHNPGSFAKPV----FKGLCNTFISAAFSFGGAELVVLTASE-SKKVESVSRAAKGTFW 312

Query: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQT-KASPYVIAVA---SHGIRIAPHFINAV 376
           R    Y+ +++++G LVPY    LLG  + +   ASP+VIA++   S G +++ HF+NAV
Sbjct: 313 RIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMGTKVS-HFMNAV 371

Query: 377 ILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCAS 436
           ILI+VLSV NS  Y+SSR++  L   G  P+   Y+D+KGRPL GI    +   + F  +
Sbjct: 372 ILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICGVFGLLGFLVA 431

Query: 437 SPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIY 496
             K+ +VF+WL A+  +S  FTW  IC+S +RFR A++ QGRS +E+ +KS +G++G I 
Sbjct: 432 CDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKSMLGIYGGIL 491

Query: 497 AATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW----NL 552
              +  L++ G+ +V+++PL  +  +   FF+  +++PI+++ Y  +KT+K        +
Sbjct: 492 GGVLNILLIAGEIYVSIFPLGGS-PSAEQFFQYCMSIPIMIVVYALHKTYKATRRDAKRI 550

Query: 553 FIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
            +   +IDL S R I D ++ K E  + K  +    L+ +IY FWC
Sbjct: 551 LVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAKPLYYRIYRFWC 596

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/550 (36%), Positives = 322/550 (58%), Gaps = 19/550 (3%)

Query: 40  LKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ-LQKTIQPRHVIMISXXXXX 98
           ++   DSFK+ + N    ++E +E +  +  Q+  KL +Q  QK ++ RH+ MI+     
Sbjct: 34  MRRMKDSFKQSNLNVITEDLENSEQSEQEKIQW--KLASQPYQKVLKQRHLTMIAIGGTL 91

Query: 99  XXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLV 158
                     +L  +GPA LLIG++++ + ++C++Q+  E++  +  + G +  + S  +
Sbjct: 92  GTGLFIGLGYSLA-SGPAALLIGFLLVGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFI 149

Query: 159 DTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGA 218
           D +  F VA  Y + WL   P EL+  S+TI YWN+ V+P V+V IFY+ I+ +NLFG  
Sbjct: 150 DQSIGFTVATNYALSWLISFPSELIGCSLTISYWNQTVNPAVWVAIFYVFIMCLNLFG-V 208

Query: 219 RGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS-GYIGVSYWNNPGAFRGHTPGTRF 277
           +G+AE EF  ++ K++                   S GYIG  YW+NPG+F        F
Sbjct: 209 KGFAETEFALSIIKVISIFIFIIIGIVLIAGGGPNSTGYIGTRYWHNPGSFAKPV----F 264

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
           K + +T V+AAFSFG +E + +T++E  N   +I  AAK   +R    Y+ +++I+G LV
Sbjct: 265 KNLCNTFVSAAFSFGGSELVLLTSTESKNI-SSISRAAKGTFWRIAIFYITTVVIIGCLV 323

Query: 338 PYNSPELL-GSKSSQTKASPYVIAVA---SHGIRIAPHFINAVILISVLSVANSSFYSSS 393
           PYN P LL GS S    ASP+VIA++   S G R++ +F+N VIL++V+SV NS  Y+SS
Sbjct: 324 PYNDPRLLNGSTSEDISASPFVIALSNTGSMGTRVS-NFMNVVILVAVVSVCNSCVYASS 382

Query: 394 RMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGL 453
           R++  L   G  P+I  Y+DRKGRPL GI  + +   + F  +S KE EVF+WL A+  +
Sbjct: 383 RLIQALGASGQLPEICAYMDRKGRPLVGIGISGIFGLLGFLVASNKEGEVFTWLFALCSI 442

Query: 454 SQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVAL 513
           S  FTW  IC+S +RFR A+K QGRS NE+ YKS +GV+G +    +  L++ G+ +V+ 
Sbjct: 443 SSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSA 502

Query: 514 WPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDEDV 572
            P+    +    FF+  L++PI+++ Y  ++ ++ DW N +I+   IDL +   + + ++
Sbjct: 503 APVGGT-STAKGFFEYCLSIPIMIVVYISHRIYRGDWKNWYIKKSKIDLDTGCSVENLEL 561

Query: 573 LKQEKNQYKE 582
             ++K   KE
Sbjct: 562 FNEQKQAEKE 571

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  331 bits (849), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 293/493 (59%), Gaps = 22/493 (4%)

Query: 112 NAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYC 171
            +GP  LLIG++I+   I+C+IQ+  E++  Y  + G F+++ S  ++ +  F V+  Y 
Sbjct: 21  QSGPGTLLIGFLIVGVSIFCVIQSAAELSCQY-PVSGSFSSHVSRFIEPSLGFTVSCAYA 79

Query: 172 IQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLC 231
           + WL   P ELV  +MTI YWNE + P V+V I YLL+I +NLF   RG+AE+EF+ ++ 
Sbjct: 80  LSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVIGLNLFA-VRGFAESEFWLSII 138

Query: 232 KILMXXXXXXXXXXXXXXXXXTS--GYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAF 289
           K+L                   +  GY+G  YW++PGAFR       F  +  T V+AAF
Sbjct: 139 KVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRPPF----FSSLCQTFVSAAF 194

Query: 290 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKS 349
           +FG  E + +TA+E S   ++I  AAK   +R    Y+ ++I++G LVPY SP L G   
Sbjct: 195 TFGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPALDGE-- 251

Query: 350 SQTKASPYVIAVA---SHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAP 406
              +ASP+VIA++   S G  ++ HF+NAVI+ +VLSV NS  Y++SR++ +L   G  P
Sbjct: 252 -SIRASPFVIALSNTGSFGTNVS-HFMNAVIVAAVLSVCNSCVYAASRVIQSLGACGQLP 309

Query: 407 KIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSH 466
           +IF Y+D+KGRPL GI   ++   +AF   + K  +VF+WL A+  ++  F W  IC+S 
Sbjct: 310 EIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFCICVSQ 369

Query: 467 IRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNF 526
           +R+RRA+K+QG    E+ Y+S +G W  +    + FL++ G+ +V++        ++  F
Sbjct: 370 LRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSV-----KDGDVETF 424

Query: 527 FKEYLAMPILLLFYFGYKTWKKDWNLF-IRAKDIDLISHRHIYDEDVLKQEKNQYKENLK 585
           F+  +++P+L++FYF ++ +++DW  + I A+D+DL + R   D +++K E    +  + 
Sbjct: 425 FQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHELIVSRARIA 484

Query: 586 NGSLWLKIYAFWC 598
           +   + + Y FWC
Sbjct: 485 SSPWYYRAYRFWC 497

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/585 (32%), Positives = 326/585 (55%), Gaps = 24/585 (4%)

Query: 28  QINESHSKLI---------ENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78
           +I ES  +LI          + ++F++SFK+        ++E +E+   +  Q+ D    
Sbjct: 13  EIRESDVELIASASATGSRSHFREFMESFKRDGAVTVPSDLEYDELTEEEKVQW-DLATQ 71

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
             +K +  RH+ MI+               +L + GP  LLIG++++   + C++Q   E
Sbjct: 72  PYKKVLDQRHLTMIAIGGTLGTGLFIGLGLSLAS-GPGSLLIGFMLVGISMLCVVQCGAE 130

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           ++  Y  + G +  + S  +D +  F+V   Y + WL   P ELV  S+T+ YWN  V+P
Sbjct: 131 LSCQY-PVSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSLTLSYWNNSVNP 189

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL-MXXXXXXXXXXXXXXXXXTSGYI 257
            V+V IF++ ++ +NLFG  RG+AE EF+ ++ K++ +                  +GYI
Sbjct: 190 AVWVAIFFVFVMLLNLFG-VRGFAETEFYMSIFKVISLFVFIIIGIVLITGGGPGNTGYI 248

Query: 258 GVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKK 317
           G  YW +PG+F   TP   FK   +T V+AA+SF  TE + +T++E  +   +I  AAK 
Sbjct: 249 GTKYWQDPGSF--ATPA--FKNFCNTFVSAAYSFSGTEMVVLTSTEVRDI-SSISRAAKG 303

Query: 318 VIYRALFIYVGSIIIVGFLVPYNSPELL-GSKSSQTKASPYVIAVASHGI--RIAPHFIN 374
             +R    Y+ +++I+G LVPYN   LL G+ S    ASP+VIA+++ G     A +F+N
Sbjct: 304 TFWRIALFYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALSNTGSMGSKAANFMN 363

Query: 375 AVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFC 434
            VIL++V+SV N   Y+SSR++  LA  G  P I  Y+DR GRPL GI    +   + F 
Sbjct: 364 VVILVAVVSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLVGIAITGVFGLLGFL 423

Query: 435 ASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGS 494
            +S  ++ VF+WL A+  +S   TW  IC   IRFR AMK Q RS +++ Y S +G++G 
Sbjct: 424 VASKDQSTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSADDIVYISPLGIYGG 483

Query: 495 IYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLF 553
           +    +  L++ G+ +V+ +P+    ++  NFF+  +++PI+++ Y G++ ++KDW + +
Sbjct: 484 VLGCVLNVLLVAGEIYVSAFPVGQP-SSAENFFQYCMSIPIMIVVYLGHRIYRKDWSHWY 542

Query: 554 IRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           I+AKDID  S   + + D +K  K + K ++ +   + K+Y F+C
Sbjct: 543 IKAKDIDRDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/454 (37%), Positives = 262/454 (57%), Gaps = 14/454 (3%)

Query: 45  DSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXX 104
           D  ++   N N   + +  +++ K  +     ++ L+K+++ RH++MI+           
Sbjct: 41  DGVRRRSTNRN---VLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFI 97

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164
                L   GP  L+IG+ I  + +   I   GE+ V +  ++G F +Y +  ++ + +F
Sbjct: 98  GSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISF 156

Query: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
            V  +Y +QW  V PLE++ A+MT++YW+  V P V+V IFY +I  INL G  RG+ EA
Sbjct: 157 VVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVG-VRGFGEA 215

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTL 284
           EF F+L K++                     ++G  YW++PG          FKG+   L
Sbjct: 216 EFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPL-----ANGFKGVAGVL 270

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           V A++S G TE +A  AS +++P K +PSA K+V +R +F ++ S+ +VGFLVPY +  L
Sbjct: 271 VIASYSLGGTE-MACLASGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNL 328

Query: 345 LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGY 404
           +G  S     SP+VIA+  HGI   P  +NAVIL+S+LSV NS  ++SSR L ++A QG 
Sbjct: 329 MGGSSVDN--SPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGL 386

Query: 405 APKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICL 464
            P++F Y+DR GRPL GI+   L   +AF   S    +VF+WL+AI+GL+    W +I +
Sbjct: 387 IPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINI 446

Query: 465 SHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
           SHIRFR AMK QG  L EL + S VG++GS+Y+A
Sbjct: 447 SHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSA 480

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/454 (37%), Positives = 262/454 (57%), Gaps = 14/454 (3%)

Query: 45  DSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXX 104
           D  ++   N N   + +  +++ K  +     ++ L+K+++ RH++MI+           
Sbjct: 41  DGVRRRSTNRN---VLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFI 97

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164
                L   GP  L+IG+ I  + +   I   GE+ V +  ++G F +Y +  ++ + +F
Sbjct: 98  GSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISF 156

Query: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
            V  +Y +QW  V PLE++ A+MT++YW+  V P V+V IFY +I  INL G  RG+ EA
Sbjct: 157 VVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVG-VRGFGEA 215

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTL 284
           EF F+L K++                     ++G  YW++PG          FKG+   L
Sbjct: 216 EFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPL-----ANGFKGVAGVL 270

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           V A++S G TE +A  AS +++P K +PSA K+V +R +F ++ S+ +VGFLVPY +  L
Sbjct: 271 VIASYSLGGTE-MACLASGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNL 328

Query: 345 LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGY 404
           +G  S     SP+VIA+  HGI   P  +NAVIL+S+LSV NS  ++SSR L ++A QG 
Sbjct: 329 MGGSSVDN--SPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGL 386

Query: 405 APKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICL 464
            P++F Y+DR GRPL GI+   L   +AF   S    +VF+WL+AI+GL+    W +I +
Sbjct: 387 IPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINI 446

Query: 465 SHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
           SHIRFR AMK QG  L EL + S VG++GS+Y+A
Sbjct: 447 SHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSA 480

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 194/581 (33%), Positives = 324/581 (55%), Gaps = 21/581 (3%)

Query: 25  NENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ-LQKT 83
           N+   +E   K  +    F+ SF++ +    + +++ + +N+ +   F   L +Q  QKT
Sbjct: 21  NQEYDSEKGGKAGKRFDKFIGSFQRHEAIIPE-DVDLSLLNDYERSNF--ILAHQPYQKT 77

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           +  RH+ MIS              ++L +   A LL   ++  S I+C+IQA  E++  Y
Sbjct: 78  LSQRHLTMISIGGTLGTGLFIGIGSSLASGPGALLLGFLLVGLS-IFCVIQAAAELSCQY 136

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
             + G F+ + S  ++ +  F V+  Y + WL   P ELV  ++TI YWN  V P ++V 
Sbjct: 137 -PVSGSFSTHVSRFIEPSVGFMVSTSYALSWLISFPSELVGLTLTIGYWNNSVSPGIWVA 195

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXX--XTSGYIGVSY 261
           IFYLLI+A+NLF   RG+AE E++ ++ KI+                     +GY+G  Y
Sbjct: 196 IFYLLIMAMNLFS-VRGFAETEYWLSIIKIIAITIFIIIGIVVICGGGPNNQAGYLGTKY 254

Query: 262 WNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 321
           W++PGAF+       F GI +T V+AAFSFG  E + +TA+E S   ++I  AAK   +R
Sbjct: 255 WHDPGAFKK----PYFSGICNTFVSAAFSFGGAELVLLTANE-SRKVESISRAAKGTFWR 309

Query: 322 ALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGI--RIAPHFINAVILI 379
               Y+ ++ ++  LVPY++  LLG+       SP+VI++A+ G   +   HF+NA+IL 
Sbjct: 310 IAIFYISTVAVISCLVPYDNETLLGNGEGVAN-SPFVISLANTGQFGKNVSHFMNAIILA 368

Query: 380 SVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPK 439
           +VLSV NSS Y++SR++  L   G  P +  Y+D+KGRPL GI    +   +AF      
Sbjct: 369 AVLSVCNSSVYAASRVIQALGACGQLPSVCGYIDKKGRPLVGIAICGVFGLLAFLVEYDN 428

Query: 440 ETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT 499
            TEVF+WL A+  ++   TW +ICLS +RFRRA+K+QG    E+ Y+S +G+W  +    
Sbjct: 429 VTEVFNWLFALCSIAAFVTWWSICLSQLRFRRALKVQGLGKEEIAYESMMGIWSGVVGIV 488

Query: 500 VMFLILIGQFWVALWP-LNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNL-FIRAK 557
           +  +++ G+ +VA+   ++ + A    FF+  +++P+++  Y  ++ + K+W+  F+RAK
Sbjct: 489 LNTMLICGEIYVAIHASIDEHSAK--TFFQYCMSIPVMITVYAAHRIYNKNWHTWFVRAK 546

Query: 558 DIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598
           DIDL + +   D +++K E    +  +    L+ +IY FWC
Sbjct: 547 DIDLSTGKKAEDIELMKHEIMVSRAKIAASPLYYRIYRFWC 587

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  301 bits (772), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 178/559 (31%), Positives = 296/559 (52%), Gaps = 30/559 (5%)

Query: 47  FKKIDDNNNQYEIEKNEI--NNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXX 104
           ++   + +  + I K  I  + +  +        Q+++ ++PRH+ MI+           
Sbjct: 7   YEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFI 66

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164
                L NAGP G LI Y+ + +  Y + Q+ GEMA  ++ +   F  +    +  A   
Sbjct: 67  SISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGS 125

Query: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224
           A  ++Y + W     LEL      I++W + V    ++ IF++++   NLF   + Y E 
Sbjct: 126 ANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP-VKYYGEV 184

Query: 225 EFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT--------R 276
           EF+    K+L                  T G +G  YW NPG +    PG         R
Sbjct: 185 EFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPW---GPGIISKDVNEGR 240

Query: 277 FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336
           F G VS+L++AAF++  TE + ITA E +NPRK +P A  KV +R LF Y+ S++ +G L
Sbjct: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLL 300

Query: 337 VPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396
           VP+N P+L  S+ S   +SP+VIA+ + G ++ PH  NAVIL +++S  NS+ Y  SR+ 
Sbjct: 301 VPFNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIA 359

Query: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456
            ++A  G APK  T+  + G P   ++  S+L  +A+  SS   + VF+WLL I+ ++  
Sbjct: 360 YSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGF 419

Query: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516
           FTW  I +SHIRF +A+K QG S ++L +K++   WG+ YAA  + +I+I Q + A  P 
Sbjct: 420 FTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP- 478

Query: 517 NSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQE 576
                 +++FF  Y+++ +  +F+ G++ W +   LFI+ +DIDL + R   D+ V +++
Sbjct: 479 ---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534

Query: 577 KNQYKENLKNGSLWLKIYA 595
           K +        +LW K +A
Sbjct: 535 KPR--------NLWEKFWA 545

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/538 (31%), Positives = 285/538 (52%), Gaps = 21/538 (3%)

Query: 51  DDNNNQYEIEKNEINNIKS-DQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXAT 109
           + N+ +   E +   ++ S +        Q+++ ++PRH+ MI+                
Sbjct: 12  EKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71

Query: 110 LHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWV 169
           L NAGP G LI Y+ + +  Y + Q+ GEMA  ++ +   F  +    +  A   A  ++
Sbjct: 72  LSNAGPVGALIAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYM 130

Query: 170 YCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFN 229
           Y + W     LEL      I++W + V    ++ I ++++++ NL    + Y E EF+  
Sbjct: 131 YFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANL-APVKFYGEVEFWIA 189

Query: 230 LCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIV 281
             K+L                  T G +G  YW NPG +    PG         RF G V
Sbjct: 190 CIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPW---GPGIISKDVNEGRFLGWV 245

Query: 282 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNS 341
           S+L++AAF++  TE + ITA E +NPRK +P A  KV +R LF Y+ S++ +G LVP+N 
Sbjct: 246 SSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFND 305

Query: 342 PELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAK 401
           P+L  S+ S   +SP+VIA+ + G ++ PH  NAVIL +++S  NS  Y SSR+L ++  
Sbjct: 306 PKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGL 364

Query: 402 QGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGT 461
            G APK  T+  + G P   ++  SL+  +A+  SS   + VF WLL I+ ++  F W  
Sbjct: 365 NGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWML 424

Query: 462 ICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA 521
           I ++HIRF +A+K QG S ++L +K++   WG+ YAA  + +I+I Q + A  P      
Sbjct: 425 ISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP----KF 480

Query: 522 NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           N+++FF  Y+++ +    + G++ W +   LF + +DIDL + R   D DV ++++ +
Sbjct: 481 NVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 175/572 (30%), Positives = 291/572 (50%), Gaps = 29/572 (5%)

Query: 20  NVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQF------- 72
            V+ TNE  + E+ ++         + + K    NN  EI    I     D+F       
Sbjct: 2   GVMATNETIVLETLTR---------ERYSKKAKGNNGSEIALESITPDSGDEFPEEHEQE 52

Query: 73  NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCI 132
            D    ++++ ++ RH+ MI+              + L  AGP G LI YI M + +Y I
Sbjct: 53  GDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSI 112

Query: 133 IQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW 192
            Q+ GEMA  ++ +      +    +  A+  A  ++Y   W     +EL      I YW
Sbjct: 113 TQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
              V    ++TIF++++  +N F   R Y E EF+    K++                  
Sbjct: 172 TSVVPLGAWITIFWIIVTLLNFFP-VRFYGEIEFWIASVKVI-TIVGYLIYAFIVVCGGS 229

Query: 253 TSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
           + G IG   W NPG +       +    RF G VS+L+ AAF++  TE + ITA E  NP
Sbjct: 230 SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNP 289

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIR 367
           RK +P A  KV +R LF Y+ S+  VG LVPYN P +  +  +   ASP+VI++ + G +
Sbjct: 290 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTK 349

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           I P   NAV+L++V+S ANS+ Y  SR++ +LA+ G APK F Y++R G P+ G++  +L
Sbjct: 350 ILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTAL 409

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
           +  +AF   +      F+WL+ IS L+ +  W  I L+HIRF + +K +G S + L +K+
Sbjct: 410 MGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKA 469

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWK 547
           +   W + YAA+ +F+I+  Q + A  P      ++T FF  Y+++ ++L+ + G + + 
Sbjct: 470 KFMPWAAYYAASFVFVIIFIQGYTAFSP----KFDVTQFFTAYISLMLMLVVFIGCQIYY 525

Query: 548 KDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           K   L+ + +DID+ ++R   D  V + ++ +
Sbjct: 526 KCRFLW-KLEDIDIDTNRREIDAIVWEDDEPK 556

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  283 bits (725), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/535 (31%), Positives = 276/535 (51%), Gaps = 15/535 (2%)

Query: 55  NQYEIEKNEINNIKSDQFNDKLNNQ-LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNA 113
           + ++++ N+     S   +D+   Q +++ ++ RH+ MI+                L  A
Sbjct: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIA 68

Query: 114 GPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQ 173
           GP G LI Y+ M + ++ + Q+ GEM   ++ +   F  +    +  A+  A  ++Y   
Sbjct: 69  GPIGALIAYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFS 127

Query: 174 WLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKI 233
           W     LEL      I++W   V    +++I ++L+   NLF   R Y E EF+    K+
Sbjct: 128 WAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFP-VRIYGEIEFWIASVKV 186

Query: 234 LMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAA 288
           L                  T G +G  YW NPG +       +    RF G VS+L+ AA
Sbjct: 187 LAILGFIIYGICIICGAGVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245

Query: 289 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK 348
           F+F  TE + ITA E   PRK +P A KKV++R L  Y+GS++++G LVPYN P+L  S 
Sbjct: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSN 304

Query: 349 SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKI 408
            S   +SP++I + + G +I PH  NAVILI+++S  NS+ Y  SR+L  LAK   APK 
Sbjct: 305 DSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKF 364

Query: 409 FTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIR 468
           FT   + G P   ++  S+  ++A+  ++    + F+WLL I G++  F W  I  SHIR
Sbjct: 365 FTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIR 424

Query: 469 FRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFK 528
           F +A+K +G S N+L YK+ +  W + YA   M +I++ Q + +  P       + NFF 
Sbjct: 425 FMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFA 480

Query: 529 EYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKEN 583
            Y+++ + ++F+  ++ W K   L  + +D+DL + R   +E+V   +     +N
Sbjct: 481 AYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  285 bits (728), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/567 (30%), Positives = 298/567 (52%), Gaps = 22/567 (3%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN 77
            K++ VT +N+I E      ++  D   S  +   + ++  I  +E ++ +  +F D   
Sbjct: 48  KKDMTVTYDNEILEKK----DSKSDIFTSVNRYASHPSEARISSDEYDH-QEAEFKD--- 99

Query: 78  NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
            ++++ ++PRH+ MI+                L  +GP G LI YI M + +Y + QA G
Sbjct: 100 TKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALG 159

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVD 197
           EMA  ++ +      + S  +  A+  +  ++Y   W     +E+      I++W  KV 
Sbjct: 160 EMA-TFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVP 218

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYI 257
              +++IF++L+ A+N F     Y E EF+    K+L                    G I
Sbjct: 219 LAAWISIFWVLVTALNFFP-VSVYGEIEFWVASVKVL-AIVGYLIYALVIVCGGSKQGPI 276

Query: 258 GVSYWNNPGAFRG-----HTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIP 312
           G  YW +  A  G          RF G V++L+ AAF++  TE + ITA E +NPRK++P
Sbjct: 277 GFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVP 336

Query: 313 SAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHF 372
            A  KV++R +  Y+ S+  +G LVPYN P+L  S +S   +SP+VI++ + G R  PH 
Sbjct: 337 RAINKVVFRIVIFYILSLFFIGLLVPYNDPKL-NSATSYIASSPFVISIENAGTRALPHI 395

Query: 373 INAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIA 432
            NA+I+I+++S ANS+ Y SSR+L +LA  G+APKIF  +  +G P  G+I  +L+  +A
Sbjct: 396 FNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLA 455

Query: 433 FCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVW 492
           F   +    E F+WL+ IS L+ +  W  I +SH+RF  A+K +G S ++L +K++   +
Sbjct: 456 FLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPY 515

Query: 493 GSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNL 552
           GS YA   + +I+  Q + A  P      ++ +FF  Y+++ +L + + G + + +    
Sbjct: 516 GSYYACFFITVIIFIQGFTAFSP----KFDVASFFTAYISLILLAVLFIGCQLYYR-CRF 570

Query: 553 FIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           F + +DID+ + R   DE V + ++ +
Sbjct: 571 FWKVEDIDIDTDRREIDEIVWEDDEPK 597

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  282 bits (721), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 173/524 (33%), Positives = 272/524 (51%), Gaps = 22/524 (4%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
            N +Q+ ++PRHV MI+              + L NAGP G LI Y+ M S  YC+ Q+ 
Sbjct: 50  RNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSL 109

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +   F  +    +      A  ++YC  W     LEL      I+YW   V
Sbjct: 110 GEMA-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAV 168

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ IF++ I   NL    + Y E +F+  L K++                  T G 
Sbjct: 169 PNAAWIAIFWVPITLSNLVP-VKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKT-GP 226

Query: 257 IGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311
           +G  YW NPG +            RF G VS+LV AAF++  TE + I+A E +NPRK +
Sbjct: 227 VGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTV 286

Query: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPH 371
           P A  KV +R L  YVGS+  +G LVP+N  E L S  S +  SP++IA+ + G +I P 
Sbjct: 287 PKAINKVFFRILLFYVGSLFFIGLLVPFND-EKLTSSDSYSAGSPFIIAIQNSGTKILPD 345

Query: 372 FINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATI 431
             NAVIL +++S ANS+ Y  SR+L  LAK+  AP+ F   +R G P   ++  +    +
Sbjct: 346 IFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFL 405

Query: 432 AFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGV 491
            + + S   ++ F WLL I+ ++  F+W  I L H+RF +A+K+QG S ++L +K+++  
Sbjct: 406 GYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMP 465

Query: 492 WGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWN 551
           WG+ Y+A  + LI+I Q + +L P      N++NFF  Y+++ + L+ +  ++ W     
Sbjct: 466 WGAYYSAFFITLIIIIQGFTSLAPT----FNVSNFFAAYISVFMFLVIWAVFQCW----- 516

Query: 552 LFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA 595
              R + I  I H  I D D  + +  Q+ +N +  +LW K +A
Sbjct: 517 --YRTRIIHRIEHVDI-DSDRREVDAQQW-DNTEPTTLWGKFWA 556

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  281 bits (718), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 181/579 (31%), Positives = 298/579 (51%), Gaps = 41/579 (7%)

Query: 28  QINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPR 87
            + +  SK +  L+ F +     D  + + +I+  +   ++        N ++++ ++ R
Sbjct: 40  SLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQ--------NAEVKRELKQR 91

Query: 88  HVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147
           H+ MI+                L NAGP G LI Y+ M S  Y + Q+ GEMA  ++ + 
Sbjct: 92  HIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVT 150

Query: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207
             F  +    +  A+  A  ++Y   W     LEL      I++W   V    +++IF++
Sbjct: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWV 210

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
           +I A+N+F   + Y E EF+    K++                  T G +G  YW NPGA
Sbjct: 211 IITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGA 268

Query: 268 FRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
           +    PG         RF G VS+L+ AAF+F  TE + ITA E +NPRK +P A KKV+
Sbjct: 269 W---GPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILI 379
           +R L  Y+GS++ +G LVPYN P+L  S +S    SP++IA+ + G ++ PH  NAVIL 
Sbjct: 326 FRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILT 384

Query: 380 SVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPK 439
           +++S ANS+ Y  SR+L  L+K   APK F+   + G P   + A S+   +A+  +S  
Sbjct: 385 TIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTG 444

Query: 440 ETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT 499
             +VF+WLL I+G++  F W  I +SHIRF +A+K +G S +EL +K+++    + YA  
Sbjct: 445 GGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATF 504

Query: 500 VMFLILIGQFWVALWPLNSNGAN-ITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
            M +I++ Q + +  P   NG N +  +   +L + I +LF   ++  +  W +    +D
Sbjct: 505 FMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKI----ED 558

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFW 597
           +D+ S R   D + +  E+ + K      +LW K   FW
Sbjct: 559 VDIDSDRR--DIEAIVWEEPEPK------TLWDK---FW 586

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  280 bits (715), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 178/541 (32%), Positives = 272/541 (50%), Gaps = 21/541 (3%)

Query: 49  KIDDNNNQYEIEKNEINNIKS-------DQFNDKLNNQLQKTIQPRHVIMISXXXXXXXX 101
           K   +  Q  +  NE  N  S       D   D    Q+++ ++PRHV MI+        
Sbjct: 16  KTRSDEFQMYVYSNETQNGGSGHNSSFEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTG 75

Query: 102 XXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTA 161
                 + L +AGP G LI YI M S +Y + Q+ GEMA  ++ +      + +  +  A
Sbjct: 76  LFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMA-TFIPVTSSITVFSNRFLSPA 134

Query: 162 WNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGY 221
           +  A  ++Y   W     +E+      I+YW + V    ++ IF++ I   N F   R Y
Sbjct: 135 FGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFP-VRFY 193

Query: 222 AEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF-----RGHTPGTR 276
            E EF+    K++                    G IG  YW NPG +      G     R
Sbjct: 194 GEVEFWVASIKVI-AIVGYLLYALIIVCGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGR 252

Query: 277 FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336
           F G V++L+ A+F++  TE + ITA E +NPRK +P A  KV +R LF Y+ S+  VG L
Sbjct: 253 FLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLL 312

Query: 337 VPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396
           VPYN P L    +S   +SP+VI++ S G RI P   NAV+L++++S ANS+ Y  SR+L
Sbjct: 313 VPYNHPGL-DKHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRIL 371

Query: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456
            +LA  G APK F+Y+  +G P  G+I  +LL  +AF        E F+WL+ IS L+ +
Sbjct: 372 FSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGL 431

Query: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516
             W  I +SHIRF + +K +G S ++L +KS++  +G+ YAA  + +I+  Q + A  P 
Sbjct: 432 CAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCP- 490

Query: 517 NSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQE 576
                 +  FF  Y+++ ILL   F           F R +DID+ S R   D  + ++E
Sbjct: 491 ---KFKVAEFFTGYISL-ILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEEE 546

Query: 577 K 577
           +
Sbjct: 547 E 547

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  280 bits (715), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 174/573 (30%), Positives = 296/573 (51%), Gaps = 34/573 (5%)

Query: 8   ITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNI 67
           ++K+G +  +N + I+  E  ++E +S   EN+   + + +K++D+              
Sbjct: 9   MSKEGQY-EINSSSIIKEEEFVDEQYSG--ENVTKAITTERKVEDDAA------------ 53

Query: 68  KSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMAS 127
           K  + + +   ++++ ++ RH+ MI+                L +AGP G LI Y+ M +
Sbjct: 54  KETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGT 113

Query: 128 CIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASM 187
            IY + Q+ GEM V ++ +   F+ +    +  A      ++Y + W     LEL     
Sbjct: 114 VIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172

Query: 188 TIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXX 247
            I+YW E V    ++ IF+ L+ ++N+F   + Y E EF     K++             
Sbjct: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFP-VKYYGEFEFCIASIKVIALLGFIIFSFCVV 231

Query: 248 XXXXXTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAI 299
                + G IG  YW NPGA+    PG         RF G VS+L+ AAF++  TE + I
Sbjct: 232 CGAGQSDGPIGFRYWRNPGAW---GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288

Query: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVI 359
           TA E +NPRKA+P A KKV+ R L  Y+ S+  +G LVPYN P+L  S      +SP++I
Sbjct: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMI 347

Query: 360 AVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPL 419
           ++ + G ++ P   NAV+LI++LS  NS+ Y  SR+L +L+K   AP+  + + R G P 
Sbjct: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407

Query: 420 FGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRS 479
           F +++ S+   +AF   S    + F+WLL I+G++  F W  I  SHIRF +A++ +G S
Sbjct: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467

Query: 480 LNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLF 539
            ++L YK+Q+  + + YA+  + LI++ Q + A  P         +F   Y+++ + L  
Sbjct: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP----IDFVAAYISIFLFLAI 523

Query: 540 YFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDV 572
           +  ++ W K   L  + +DID+ S R   +E V
Sbjct: 524 WLSFQVWFKC-RLLWKLQDIDIDSDRRQIEELV 555

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  279 bits (713), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 162/533 (30%), Positives = 271/533 (50%), Gaps = 15/533 (2%)

Query: 51  DDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATL 110
           +  N    I +  ++ ++S   ND  +  +++ ++PRH+ MIS              + +
Sbjct: 35  ETKNEGIFINQENMSEVESLYGND--DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPI 92

Query: 111 HNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVY 170
             AGP G L+ Y+ M +  +C+ Q+ GEMA  ++ +   F  Y    +  A   A  ++Y
Sbjct: 93  RVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLY 151

Query: 171 CIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNL 230
              W     LEL      I+YW   V   V++ +F++L+ A N+    R Y E EF+   
Sbjct: 152 WFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP-VRFYGEIEFWIAA 210

Query: 231 CKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLV 285
            K+L                  + G +G  YW NPG +       +    RF G VS+L+
Sbjct: 211 LKVL-SIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLI 269

Query: 286 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL 345
            AAF++  TE + ITA E  NPRK +P A  KV +R LF Y+ S+  VG LVPY  P L 
Sbjct: 270 KAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLS 329

Query: 346 GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYA 405
            +  S    SP+V+A+ + G ++ P   N VIL+++LS  NS+ Y  SR+L  L+K G A
Sbjct: 330 TTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLA 389

Query: 406 PKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLS 465
           P +F   +++G P + ++ +S+   +A+   S    +VF WLL I+ ++  F W  I LS
Sbjct: 390 PSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLS 449

Query: 466 HIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITN 525
           HIRF + +K +G S N+L +K++   WG+ YAA  + +I++ Q + +  P        + 
Sbjct: 450 HIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSE 505

Query: 526 FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKN 578
           F  +Y+++ + ++ + G++   K   L +R +D+D+ + R   D  V   +  
Sbjct: 506 FIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDE 557

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  277 bits (709), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 176/568 (30%), Positives = 290/568 (51%), Gaps = 25/568 (4%)

Query: 17  VNKNV-IVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKN---EINNIKSDQF 72
           +N+NV I T++    E++S      K+ VD+  + ++ +    I  N   E +  K  + 
Sbjct: 1   MNENVDICTSKEGKREANSAPTIKEKELVDA--QYEEQDTSAAIAANSSIENDGAKGTET 58

Query: 73  NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCI 132
           + +   ++Q+ ++ RH+ MI+                L +AGP G LI Y+ M + IY +
Sbjct: 59  SPRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSV 118

Query: 133 IQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW 192
            Q+ GEMA  ++ +   F+ +    +  A      ++Y + W     LEL      I+YW
Sbjct: 119 TQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYW 177

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
              V    ++ IF+ L+  +N+F   + Y E EF     K++                  
Sbjct: 178 THAVPLAAWIVIFWCLLTLMNMFP-VKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQ 236

Query: 253 TSGYIGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQ 304
             G IG  YW NPGA+    PG         RF G VS+L+ AAF++  TE + ITA E 
Sbjct: 237 PDGPIGFRYWRNPGAW---GPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 293

Query: 305 SNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASH 364
           +NPRKA+P A KKV+ R L  Y+ S+  +G LVPYN P+L  S  +   ASP++I++ + 
Sbjct: 294 ANPRKAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKL-DSDGTFVSASPFMISIENS 352

Query: 365 GIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIA 424
           G ++ P   NAV+LI++ S  NS+ Y  SR+L +L+K   APK  + + R G P   ++ 
Sbjct: 353 GTKVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLL 412

Query: 425 ASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELG 484
            SL   +AF  +S    + F+WLL I+G++  F W  I  SHIRF +A+K +G S ++L 
Sbjct: 413 TSLFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLP 472

Query: 485 YKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544
           YK+++  + + YA+  + LI++ Q + A  P         +F   Y+++ +  + +  ++
Sbjct: 473 YKARMMPFLAYYASFFIALIVLIQGFTAFAPTFQP----VDFVAAYISVFLFAIIWLSFQ 528

Query: 545 TWKKDWNLFIRAKDIDLISHRHIYDEDV 572
            W K   L  + +DID+ S R   +E V
Sbjct: 529 LWFKC-RLICKLQDIDIDSDRREIEEQV 555

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  276 bits (705), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 167/523 (31%), Positives = 272/523 (52%), Gaps = 22/523 (4%)

Query: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMA 126
           I+ +   +  N ++++ ++ RH+ MI+                L NAGP G LI Y+ M 
Sbjct: 71  IRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMG 130

Query: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186
           S  Y + Q+ GEMA  ++ +   F  +    +  A+  A  ++Y   W     LEL    
Sbjct: 131 SLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVG 189

Query: 187 MTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXX 246
             I++W  KV    +++IF+++I  +NLF   + Y E EF+    K+L            
Sbjct: 190 QVIEFWTNKVPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 247 XXXXXXTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLA 298
                 T G +G  YW NPGA+    PG         RF G VS+L+ AAF+F  TE + 
Sbjct: 249 VCGAGVT-GPVGFRYWRNPGAW---GPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVG 304

Query: 299 ITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYV 358
           ITA E +NPRK +P A KKV++R L  Y+GS++ +G LVPYN P+L  + +S    SP++
Sbjct: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-TATSYVSVSPFI 363

Query: 359 IAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRP 418
           IA+ + G ++ PH  NAVIL +++S ANS+ Y  SR+L  L+K   APK  +   + G P
Sbjct: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVP 423

Query: 419 LFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGR 478
              +   ++   +A+  +S    +VF WLL I+G++  F W  I +SHIRF +A+K +G 
Sbjct: 424 YIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGI 483

Query: 479 SLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLL 538
           S +EL +K+++    + +AAT M +I++ Q + A  P       +  +   +L + I +L
Sbjct: 484 SRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWIL 543

Query: 539 FYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYK 581
           F   ++          + +D+D+ S R   D + +  E ++ K
Sbjct: 544 FEIIFRC-----RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  276 bits (707), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 168/525 (32%), Positives = 276/525 (52%), Gaps = 25/525 (4%)

Query: 75  KLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQ 134
           K  + L+K +Q RHV MI+               +L  AGPA + I Y  +   ++  + 
Sbjct: 94  KHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMA 153

Query: 135 ACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW-- 192
           A GEMA +Y+ +  GF +Y S  VD A  FAV + Y  ++L +CP +L  AS+ I+YW  
Sbjct: 154 AIGEMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
            + V+P V++TIF ++I+ IN+  G + + E EF+ +  K+L+                 
Sbjct: 212 RDTVNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGP 270

Query: 253 TSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
               +G  YW +PGAF+ ++        +F   VS  V A F++   E   I A+E  NP
Sbjct: 271 DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNP 330

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHG 365
           RK++P A K  ++R +  Y+ +I ++G  V YN P LL +K + T A  SP+V+A+ + G
Sbjct: 331 RKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSG 390

Query: 366 IRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAA 425
           IR+ PH  NA +LI V S  NS  Y  SR L +LA  G AP IF      G P + +   
Sbjct: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450

Query: 426 SLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGY 485
            L A +A+   S    +VF++ + +  +  + +W  I +++I F RA+K+QG   ++  Y
Sbjct: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510

Query: 486 KSQVGVWGSIYA-ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544
            +    +G+ ++ A  +F+  I  F V L     +  +  NF   Y+ +P+ ++FYFGYK
Sbjct: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK 566

Query: 545 TWKKDWNLFIRAKDIDLISHRHIYDED-----VLKQEKN-QYKEN 583
             KK     +++ ++DL + + ++D+      +L QEK  + +EN
Sbjct: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 169/578 (29%), Positives = 293/578 (50%), Gaps = 31/578 (5%)

Query: 33  HSKLIENLKDFVDSFKKIDDNNNQYEI-EKNEINNIKSDQFNDKL--------NNQLQKT 83
              +I+++   +D       N+N  E+  +    ++ S Q+ D          ++ ++++
Sbjct: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRS 69

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           ++ RH+ MI+                L NAGP G L+ Y+ M + ++ + Q+ GEMA  +
Sbjct: 70  LKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TF 128

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
           + +   F+ +    +  A   A  ++Y + W     LEL      I++W  KV    +++
Sbjct: 129 IPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWIS 188

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IF++L+ A N+F   + Y E EF+    K+L                  T G IG  YW 
Sbjct: 189 IFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT-GPIGFRYWR 246

Query: 264 NPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
           NPGA        +T   RF G VS+L+ AAF++  TE + ITA E +NPRKA+P A +KV
Sbjct: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
           + R L  Y+GS+  +G  VPYN P+L  S  S   +SP++I + + G R+ PH  NAVIL
Sbjct: 307 LIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLPHIFNAVIL 365

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
            +++S  NS+ Y  SR+L ++AK G APK       +G P   ++A S   ++++   S 
Sbjct: 366 TTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELST 425

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
              + F+WLL I+G++  F W  I  SH+RF +A+K +G S ++L YK+    W + YA 
Sbjct: 426 GGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAI 485

Query: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
             M +I++ Q + +  P  S      +F   Y+++ + L+F+  ++ + +   +  + +D
Sbjct: 486 FFMVVIILIQGFTSFAPHFSG----RDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLED 540

Query: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAF 596
           +D+ + R   +  V + +  +        +LW K + F
Sbjct: 541 VDIDTDRREIESVVWEDDAPK--------TLWDKFWDF 570

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  275 bits (704), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 272/526 (51%), Gaps = 28/526 (5%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           +  +++ ++PRH+ MI+                L NAGP G LI YI + + I+ + Q+ 
Sbjct: 90  HRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSL 149

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEM V ++ +   F  +    +  A+  A  ++Y   W     +EL      I++W   V
Sbjct: 150 GEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAV 208

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ IF+ L+   N+F   + Y E EF+    K+L                    G 
Sbjct: 209 PLAAWIVIFWFLLTLSNMFP-VKYYGEIEFWIAFLKVL-SLVGFLIFCLCITSGAGPHGP 266

Query: 257 IGVSYWNNPGAFRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
            G  YW +PGA+    PG         RF G VS+L+ AAF++  TE + ITA E +NPR
Sbjct: 267 FGFRYWRDPGAW---GPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 323

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           KA+P A KKVI R LF YVGS+  +G LVP+N P+L  S +S   +SP++IA+ + G+ +
Sbjct: 324 KAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLT-SATSFVSSSPFIIAIQNSGVSL 382

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            P   N VILI+++S  NS+ Y  SR+L  LA    AP+ FT   + G P   ++  SL 
Sbjct: 383 LPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLF 442

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
            ++AF   +    +VF+WLL+I  ++  F W  I LSHIRF +A++ +G S N L +K+ 
Sbjct: 443 GSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAI 502

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
              W + YA   + LI++ Q + A  P      N+++F   Y+++ + ++ +  ++  KK
Sbjct: 503 FMPWLAYYATAFIILIILIQGFTAFAPR----FNVSDFVASYISLLLFVIIWGVFQAMKK 558

Query: 549 DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIY 594
              +F + +DIDL S R   D + ++ E +  K      + W K++
Sbjct: 559 C-RIFWKVEDIDLDSDRK--DIEDIRWEDDSPK------TFWTKVW 595

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  275 bits (702), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 172/544 (31%), Positives = 279/544 (51%), Gaps = 26/544 (4%)

Query: 46  SFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXX 105
           SF    +  + + +E    + I  +   +  N ++++ ++ RH+ MI+            
Sbjct: 54  SFPTRVNGEDTFSME----DGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIG 109

Query: 106 XXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFA 165
               L NAGP G LI Y+ M S  Y + Q+ GEMA  ++ +   F  +    +  A+  A
Sbjct: 110 LSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAA 168

Query: 166 VAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAE 225
             ++Y   W     LEL      I++W  KV    +++IF+++I  +NLF   + Y E E
Sbjct: 169 NGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFP-VKYYGEFE 227

Query: 226 FFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT--------RF 277
           F+    K+L                  T G +G  YW NPGA+    PG         RF
Sbjct: 228 FWVASIKVLAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAW---GPGIISKDKNEGRF 283

Query: 278 KGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLV 337
            G VS+L+ AAF+F  TE + ITA E +NPRK++P A KKV++R L  Y+GS++ +G LV
Sbjct: 284 LGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLV 343

Query: 338 PYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLL 397
           PYN P+L  S +S    SP++IA+ + G ++ PH  NAVIL +++S ANS+ Y  SR+L 
Sbjct: 344 PYNDPKLTQS-TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILF 402

Query: 398 TLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVF 457
            L+K   APK  +   + G P   +   +    +A+  +S    +VF WLL I+G++  F
Sbjct: 403 GLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFF 462

Query: 458 TWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLN 517
            W  I +SHIRF +A+K +G S +EL +K+++    + YAAT M +I+I Q + A  P  
Sbjct: 463 AWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKF 522

Query: 518 SNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEK 577
           +  +    +   +L + + +LF   ++          +  D+D+ S R   D + +  E 
Sbjct: 523 NGVSFAAAYISIFLFLAVWILFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIVWED 575

Query: 578 NQYK 581
           ++ K
Sbjct: 576 HEPK 579

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  275 bits (703), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 164/552 (29%), Positives = 283/552 (51%), Gaps = 30/552 (5%)

Query: 55  NQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAG 114
           ++  +E     + +   + DK   Q+++ ++ RH+ MI+                L +AG
Sbjct: 62  SRSRVEPEHDEDAEEADYEDK---QVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAG 118

Query: 115 PAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQW 174
           P G LI YI M S +Y + QA GEMA  ++ +      +    +  A+  A  ++Y   W
Sbjct: 119 PVGALIAYIFMGSIVYFVTQALGEMA-TFIPVTSSITVFSQRFLSPAFGVANGYMYWFNW 177

Query: 175 LCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL 234
                +E+      I+YW + V    ++ IF++L+  +N F   + Y E EF+    K++
Sbjct: 178 AITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFP-VKVYGEVEFWVAFMKVI 236

Query: 235 MXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF-RGHTPGT----------RFKGIVST 283
                               G IG  YW NPGA+  G T             RF G V++
Sbjct: 237 AIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVAS 296

Query: 284 LVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPE 343
           L+ AAF++  TE + ITA E +NPRK +P A  KV++R +  Y+ S+  +G LVP+    
Sbjct: 297 LINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSR 356

Query: 344 LLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQG 403
           L    ++   +SP+VI++ + G +I P   NA+++++VLS ANS+ Y  SR+L +LA   
Sbjct: 357 L-SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTK 415

Query: 404 YAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTIC 463
            APKIF  + R+G P  G+I  SLL  +AF          F+WL+ IS L+ +  W  I 
Sbjct: 416 VAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFIS 475

Query: 464 LSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANI 523
           L+H+RF + +K +G S ++L +K++   WGS YAA  +F+I+  Q + A  P      ++
Sbjct: 476 LAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSP----HFDV 531

Query: 524 TNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKEN 583
           T FF +Y+++ +L + + G + + +   L+ + +D+D+ S R   ++ + + ++ +    
Sbjct: 532 TTFFTDYISLILLAVVFIGAQLYYRCRFLW-KLEDVDIDSDRREIEDAIWEDDEPK---- 586

Query: 584 LKNGSLWLKIYA 595
               ++W K +A
Sbjct: 587 ----TIWDKFWA 594

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  272 bits (696), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 170/543 (31%), Positives = 277/543 (51%), Gaps = 26/543 (4%)

Query: 53  NNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHN 112
            +NQ    K EI  I  +   + +  +L++    RH+ MI+                L N
Sbjct: 4   GHNQDSKMKEEIREISVEVEAETVRRELKQ----RHMGMIALGGTIGTGLFIGVSTPLMN 59

Query: 113 AGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCI 172
           AGP G LI Y+ MA+  Y + Q+ GEMA  ++ +   F  +    V  A+  A  ++Y  
Sbjct: 60  AGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWF 118

Query: 173 QWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCK 232
            W     LEL      I++W   V    +++IF++L+  +N+F   + Y E EF+  L K
Sbjct: 119 SWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVK 177

Query: 233 ILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPG--------TRFKGIVSTL 284
           ++                  T G +G  YW +PGAF    PG         RF G VS+L
Sbjct: 178 VVAIMGFLIYCFCMVCGAGVT-GPVGFRYWRHPGAF---GPGIIAKDKNQARFLGWVSSL 233

Query: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
           + AAF+F  TE + ITA E +NPRK +P A KKV++R LF Y+ S+  +G LVPY+  +L
Sbjct: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL 293

Query: 345 LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGY 404
             S  S   ASP++IA+ + G  + PH  NAVI+ +++S  NS+ Y  SR++  L+    
Sbjct: 294 T-STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352

Query: 405 APKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICL 464
           AP I +   + G P   ++  SL   +A+  +S    + F+WLL I+G++  FTW  I L
Sbjct: 353 APGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISL 412

Query: 465 SHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANIT 524
           SHIRF +A++++G S ++L +K++     + Y    M LI+I Q + +  P N       
Sbjct: 413 SHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNG-----I 467

Query: 525 NFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDV-LKQEKNQYKEN 583
           +F   Y+++ + +  +  ++ W +   L  R +D+D+ + R   +E V ++QE   + + 
Sbjct: 468 DFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDK 526

Query: 584 LKN 586
             N
Sbjct: 527 FWN 529

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  273 bits (698), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 180/585 (30%), Positives = 298/585 (50%), Gaps = 27/585 (4%)

Query: 9   TKDGLH---LSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNE-- 63
           T+  +H    SV K+  +T +N ++ S ++            K   D+   Y   ++E  
Sbjct: 37  TEQSIHQRCCSVPKHPGMTEKNSLH-SRARRGSGATAGEPKLKAHSDDFEMYVYSQDEPS 95

Query: 64  INNIKSDQFN---DKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLI 120
            + + SD  +   D    ++++ ++PRHV MI+              + L  +GP G LI
Sbjct: 96  TDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALI 155

Query: 121 GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPL 180
            YI M + +Y + Q+ GEMA  ++ +      + S  +  A+  A  ++Y   W     +
Sbjct: 156 AYIFMGTVVYFVTQSMGEMA-TFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAV 214

Query: 181 ELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXX 240
           EL      I+YW E V    ++ IF++L+   N F   + Y E EF+    K+L      
Sbjct: 215 ELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFP-VQFYGEVEFWVASIKVL-AIVGY 272

Query: 241 XXXXXXXXXXXXTSGYIGVSYWNNPGAF------RGHTPGTRFKGIVSTLVTAAFSFGQT 294
                         G IG  YW NPG +      +    G RF G V++L+ A+F++  T
Sbjct: 273 LIYALVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEG-RFLGWVASLINASFTYQGT 331

Query: 295 EFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA 354
           E + ITA E +NPR+ +P A  KV +R LF Y+ S+  VG LVPYN   L    ++   +
Sbjct: 332 ELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL-DKTTTVIAS 390

Query: 355 SPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDR 414
           SP+VI++ + G R  P   NAV+L++++S ANS+ Y  SR+L +LA  G APK+F+ +  
Sbjct: 391 SPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTP 450

Query: 415 KGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMK 474
           +G P  G+I  SLL  +AF   +    E F+WL+ IS L+ +  W  I +SHIRF + +K
Sbjct: 451 QGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLK 510

Query: 475 IQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMP 534
            +G S ++L +KS++  +G+ YAA  + +I+  Q + A  P       +T FF  Y+++ 
Sbjct: 511 QRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSP----HFKVTEFFTSYISLM 566

Query: 535 ILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           +L++ + G + + +    F R +DID+ S R   + D L  E ++
Sbjct: 567 LLVVVFCGAQLFYR-CRFFNRLEDIDIDSDRR--EADALIWEDDE 608

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  271 bits (694), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 176/590 (29%), Positives = 302/590 (51%), Gaps = 38/590 (6%)

Query: 16  SVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIK-----SD 70
            + K  +  ++N + E  S+L          F     ++  + I     +++K     + 
Sbjct: 19  DIEKQQLFGDDNIVIERSSQL----------FYDGQSDSKVHGITSGHGSDVKNVVTHTS 68

Query: 71  QFNDKLNN-QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCI 129
           +F+ K +  +L+K ++ RHV MI+              ++L  AGPA +LI Y  +   +
Sbjct: 69  EFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLV 128

Query: 130 YCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTI 189
           + ++   GEMA  Y+ L  GF +Y +   D A  FAV + Y  ++  + P +L   ++ I
Sbjct: 129 FFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186

Query: 190 KYW--NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXX 247
           +YW   +KV+P V++TI  + II IN F G R + E E++ +  KI +            
Sbjct: 187 QYWVDRDKVNPGVWITILLVAIITIN-FLGVRFFGEIEYYISAVKITVMLGLIILLLVLA 245

Query: 248 XXXXXTSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITAS 302
                    +G  YW NPGAF+ ++        RF    S  V A F++  TE   I  S
Sbjct: 246 CGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVS 305

Query: 303 EQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIA 360
           E  NPRKA+P A K  +YR +  Y+ SI ++G  VP+N P L+ +KS++T AS  P+V+A
Sbjct: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVA 365

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           + + GI + PH +NA ILI V S ANS  Y +SR L  LA    AP+IF   +++G P +
Sbjct: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
            ++   L A +A+   S   +EVF++ +    +  + +W +I +++IRF +A ++QG   
Sbjct: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485

Query: 481 NELGYKSQVGVWGSIYAATVMFLILIGQFWVALWP-LNSNGANITNFFKEYLAMPILLLF 539
           + L Y+S +  +G+ +  ++ F ILIG   +  +P    +  +  +F   Y+ +P  ++ 
Sbjct: 486 STLAYQSPLQPYGAWF--SLFFCILIG--LIKNFPAFLGDTFDYKSFITGYIGIPTYIIS 541

Query: 540 YFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSL 589
           Y GYK W K     I ++++DL+S +   D   L++E+ +  +  +   L
Sbjct: 542 YIGYKLWYK--TKIIPSEEVDLVSFKEAVD---LEEEEGKMLDEERAAHL 586

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/498 (32%), Positives = 266/498 (53%), Gaps = 20/498 (4%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           + ++++ ++ RH+ MI+                L NAGP G LI Y+ M S +Y I Q+ 
Sbjct: 64  DTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSL 123

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +      +    +  A+  A  ++Y   W     +E+      I++W   V
Sbjct: 124 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAV 182

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ IF++ +  +N F   + Y E EF+    K++                  + G 
Sbjct: 183 PLAAWIAIFWVFVSLLNFFP-VKVYGEIEFWVASIKVI-AIVGYLIYALVIVCGGSSQGP 240

Query: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           IG  YW NPG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPR
Sbjct: 241 IGFRYWRNPGPW---GPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           K++P A  KV++R +  Y+ S+  VG LVP+N P L  S  +   +SP+VI++ + G R+
Sbjct: 298 KSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL-ASNVAVIASSPFVISIQNAGTRV 356

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            PH  NAV++++++S ANS+ Y  SR+L  L++ G APK F Y+ R G P  G+IA SLL
Sbjct: 357 LPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLL 416

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +AF   +      F+WL+ IS L+ +  W  I LSHIRF +A+K +G S ++L +K++
Sbjct: 417 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAK 476

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           +  WG+ YAA  + +I+  Q + A  P      +++ FF  Y+++ IL++   G + + +
Sbjct: 477 LMPWGAYYAAFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVLLIGCQLYYR 532

Query: 549 DWNLFIRAKDIDLISHRH 566
              L+ + +DID+ + R 
Sbjct: 533 CRFLW-KLEDIDIDTDRR 549

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  270 bits (690), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 174/571 (30%), Positives = 295/571 (51%), Gaps = 27/571 (4%)

Query: 13  LHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE-KNEINN--IKS 69
           ++ SV+  +   ++ +IN      I  +K+      + D  + +  +  K+ INN   K 
Sbjct: 1   MNESVDMRMSKVSQYEINS-----ISTIKEEELICARYDGQDTEEAVAGKSSINNDSAKE 55

Query: 70  DQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCI 129
            + + +   ++++ ++ RH+ MI+                L +AGP G LI Y+ M + I
Sbjct: 56  TETSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVI 115

Query: 130 YCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTI 189
           Y + Q+ GEMA  ++ +   F+ +    +  A      ++Y + W     LEL      I
Sbjct: 116 YSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQII 174

Query: 190 KYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXX 249
           +YW + V    ++ IF+ L+  +N+F   + Y E EF     K++               
Sbjct: 175 QYWTDAVPLVAWIVIFWCLLTLMNMFP-VKYYGEFEFCIASIKVIALLGFIFFSFCIVCG 233

Query: 250 XXXTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITA 301
              + G IG  YW NPGA+    PG         RF G VS+L+ AAF++  TE + ITA
Sbjct: 234 AGQSGGPIGFRYWRNPGAW---GPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITA 290

Query: 302 SEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAV 361
            E +NPR+A+P A KKV+ R L  Y+ S+  +G LVPYN P+L  S+ +   +SP++I++
Sbjct: 291 GEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSEGTFVSSSPFMISI 349

Query: 362 ASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFG 421
            + G ++ P   NAV+LI++LS  NS+ Y  SR+L +L+K   AP+  + + + G P F 
Sbjct: 350 ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFA 409

Query: 422 IIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLN 481
           +++ S    +AF  +S    +VF+WLL I+G++  F W  I LSHIRF +A+K +G S +
Sbjct: 410 VLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRD 469

Query: 482 ELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYF 541
           +L Y++++  + + YA+  + LI++ Q + A  P       I  +   +L + I LLF  
Sbjct: 470 DLPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQV 529

Query: 542 GYKTWKKDWNLFIRAKDIDLISHRHIYDEDV 572
            +K  +  W L    +D+D+ S R   +E V
Sbjct: 530 WFKC-RFVWKL----QDVDIDSDRRDIEEQV 555

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  271 bits (693), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 177/597 (29%), Positives = 300/597 (50%), Gaps = 29/597 (4%)

Query: 1   MSSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIE 60
           +SS   SI  +      N+ + + N N   +S  K    L+       +I   ++   + 
Sbjct: 22  VSSNDDSIGNNSTMKENNEVIELINTNSFKDSSDKPPITLRK--SKLSEIGSLHSGSNLH 79

Query: 61  KNEINNIKSDQFNDKLNNQLQKT-----IQPRHVIMISXXXXXXXXXXXXXXATLHNAGP 115
           ++   ++  D+ +D    Q Q T     ++ RH+ MI+                L NAGP
Sbjct: 80  QHGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGP 139

Query: 116 AGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWL 175
            G LI YI M S +Y + Q+ GEMA  ++ +      +    +  A+  A  ++Y   W 
Sbjct: 140 VGSLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWA 198

Query: 176 CVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILM 235
               +E+      I+YW + V    ++ IF++++  +N F   + Y E EF+    K+L 
Sbjct: 199 ITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFP-VKVYGEFEFWIASIKVLA 257

Query: 236 XXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFS 290
                              G IG  YW NPG +        T   RF G VS+L+ AAF+
Sbjct: 258 IMGYLIYALIIVCGGSH-QGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFT 316

Query: 291 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSS 350
           +  TE + ITA E +NPRK++P A  KV++R    Y+ S+  +G LVP+N  + L + S+
Sbjct: 317 YQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFND-DRLANDSA 375

Query: 351 QTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFT 410
              +SP+VI++ + G R  P   NAV+L++++S ANS+ Y  SR+L  LA  G APKIF+
Sbjct: 376 VIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFS 435

Query: 411 YLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFR 470
           Y+ + G P  G+I  + L  +AF   +      F+WL+ IS L+ +  W  I LSHIRF 
Sbjct: 436 YVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFM 495

Query: 471 RAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEY 530
           +A+K +G S ++L +K+++  WG+ YA+  + +I+  Q + A  P      +++ FF  Y
Sbjct: 496 QALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTP----KFDVSTFFTSY 551

Query: 531 LAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRH-----IYDEDVLKQEKNQYKE 582
           +++ +L + + G + + +      + +DID+ S R      I++ED   + KN +++
Sbjct: 552 ISLILLAVLFSGCQLYYR-CRFIWKVEDIDIDSDRREIEAIIWEED---EPKNLWEK 604

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  270 bits (691), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 167/546 (30%), Positives = 283/546 (51%), Gaps = 26/546 (4%)

Query: 44  VDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXX 103
           + SF    +  + + +E+N    ++ +   +  N ++++ ++ RH+ MI+          
Sbjct: 52  LRSFPTGVNGQDTFSMEEN----LQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLF 107

Query: 104 XXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWN 163
                 L NAGP G LI Y+ M S  + + Q+ GEMA  ++ +   F  +    +  A+ 
Sbjct: 108 IGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFG 166

Query: 164 FAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAE 223
            A  ++Y   W     LEL      I++W  KV    +++IF++LI  +NLF   + Y E
Sbjct: 167 AANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGE 225

Query: 224 AEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT-------- 275
            EF+    K++                  T G +G  YW NPGA+    PG         
Sbjct: 226 FEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAW---GPGIISKNKNEG 281

Query: 276 RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGF 335
           RF G VS+L+ AAF+F  TE + ITA E +NPRK +P A KKV++R L  Y+GS++ +G 
Sbjct: 282 RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGL 341

Query: 336 LVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRM 395
           LVPYN P+L    +S    SP+++A+ + G ++ PH  NAVIL +++S ANS+ Y  SR+
Sbjct: 342 LVPYNDPKLT-EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRI 400

Query: 396 LLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQ 455
           L  L+K   APK  +   + G P   + A ++   +A+  +S    +VF WLL I+G++ 
Sbjct: 401 LFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAG 460

Query: 456 VFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWP 515
            F W  I +SHIRF +A+K +G S +EL +K+++    + Y++  M +I+I Q + A  P
Sbjct: 461 FFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAP 520

Query: 516 LNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQ 575
             +  + +  +   +L + + +LF   ++          + +D+D+ S R   D + +  
Sbjct: 521 KFNGSSFLAAYISIFLFIAVWILFECIFRC-----RFIWKIEDVDIDSDRR--DIEAIVW 573

Query: 576 EKNQYK 581
           E ++ K
Sbjct: 574 EDHEPK 579

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  271 bits (692), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 273/527 (51%), Gaps = 28/527 (5%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           + Q+++ ++ RH+ MI+                L N+GP G LI Y+ M S IY I Q+ 
Sbjct: 90  DTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSL 149

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +      +    +  A+  A  ++Y   W     +E+      I+YW +KV
Sbjct: 150 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ IF++LI  +N F   + Y E EF+    K+L                  + G 
Sbjct: 209 PLAAWIAIFWVLITLLNFFP-VKVYGEIEFWIAFIKVL-AIMGYLLYALIIVCGGSSQGP 266

Query: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           IG  YW NPG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPR
Sbjct: 267 IGFRYWRNPGPW---GPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 323

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           K +P A  KV++R    Y+ S+  +G LVPYN  E L S S+   +SP+VI++ + G ++
Sbjct: 324 KTVPRAINKVVFRIALFYIMSLFFIGMLVPYND-ERLASTSAVIASSPFVISIQNAGTKV 382

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            P   NA+++I+++S ANS+ Y  SR+L  LA  G APK F ++ R G P  G+I  S L
Sbjct: 383 LPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSAL 442

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +AF   +      F+WL+ IS L+ +  W  I +SHIRF +A+K +G S ++L +K++
Sbjct: 443 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 502

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           +  +G+ YA   + +I+  Q + A  P      + T FF  Y+++ IL + + G + + +
Sbjct: 503 LMPFGAYYATFFVTVIIFIQGFQAFSP----HWDTTAFFTSYISLIILAVLFIGCQIFYR 558

Query: 549 DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA 595
               F R +DID+ S R   +  + + ++ +        +LW K +A
Sbjct: 559 C-RFFWRVEDIDIDSDRREIEAVIWEDDEPK--------TLWDKFWA 596

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  270 bits (690), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 178/608 (29%), Positives = 299/608 (49%), Gaps = 48/608 (7%)

Query: 19  KNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKL-- 76
           +N++   +N+ NE+ +      +D      + D+       E        S  F+D +  
Sbjct: 4   RNILKNEKNEKNEASASTSHASEDIEIIPSRYDNEKFYSATEATHKKKTGSTGFDDTISL 63

Query: 77  ------------------------NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHN 112
                                   + ++++ ++ RH+ MI+                L N
Sbjct: 64  THTLSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSN 123

Query: 113 AGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCI 172
           +GP G LI YI M + IY + Q+ GEMA  ++ +      +    +  A+  A  ++Y  
Sbjct: 124 SGPVGALIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWF 182

Query: 173 QWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCK 232
            W     +E+      I+YW  KV    ++ IF++LI  +N F   + Y E EF+    K
Sbjct: 183 NWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLMNFFP-VKIYGEFEFWVASIK 241

Query: 233 ILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTA 287
           ++                    G IG  YW NPGA       +     RF G VS+L+ A
Sbjct: 242 VIAIVGYLIYALIIVCGGSH-QGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINA 300

Query: 288 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS 347
           AF++  TE + ITA E +NPRK++P A  KV++R +  Y+ S+  VG LVPYN P L  +
Sbjct: 301 AFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLS-A 359

Query: 348 KSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPK 407
            S+   +SP+VI++ + G ++ P   NAV+L++V+S ANS+ Y  SR+L  LA+ G APK
Sbjct: 360 SSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPK 419

Query: 408 IFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHI 467
            F Y+ R G P  G+I  +LL  +AF   +      F+WL+ IS L+ +  W  I L+HI
Sbjct: 420 QFAYVTRHGVPYLGVICTALLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHI 479

Query: 468 RFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFF 527
           RF +A+K +G S ++L +K++   WG+ YA+  + +I+  Q + A  P      +++ FF
Sbjct: 480 RFMQALKFRGISRDDLPFKAKFMPWGAYYASFFVTVIIFIQGFQAFAP----KFDVSEFF 535

Query: 528 KEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNG 587
             Y+++ +L++ + G + + +   L+ + +DID+ S R   D  V + ++ Q        
Sbjct: 536 TAYISLILLVVLFAGCQLYYRCRFLW-KLEDIDIDSDRREIDAIVWEDDEPQ-------- 586

Query: 588 SLWLKIYA 595
           +LW K +A
Sbjct: 587 NLWEKFWA 594

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  268 bits (686), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/519 (31%), Positives = 271/519 (52%), Gaps = 29/519 (5%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           + ++++ ++ RH+ MI+                L NAGP G LI YI M S IY I Q+ 
Sbjct: 91  DTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSL 150

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +      +    +  A+     ++Y   W     +E+      I+YW + V
Sbjct: 151 GEMA-TFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAV 209

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ IF++ +  +N F   + Y E EF+    K+L                  + G 
Sbjct: 210 PLAAWIAIFWVFVTLLNFFP-VKVYGEVEFWVASIKVL-AIIGYLIYALVIVCGGSSQGP 267

Query: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           IG  YW NPG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPR
Sbjct: 268 IGFRYWRNPGPW---GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 324

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           K++P A  KV++R    Y+ S+  +G LVPYN    L S  S   +SP+VI++ + G   
Sbjct: 325 KSVPRAINKVVFRIALFYIMSLFFIGLLVPYND-HTLSSGDSYIASSPFVISIQNAGTYA 383

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            P   NAV++++++S ANS+ Y  SR+L  LA+ G APK F Y+ + G P  G+I  + L
Sbjct: 384 LPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASL 443

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +AF   +      F+WL+ IS L+ +  W  I LSHIRF +A+K +G S ++L +K++
Sbjct: 444 GLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAK 503

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           +  WG+ Y+A  +F+I+  Q + A  P ++     T FF  Y+++ +L++ + G + + +
Sbjct: 504 LMPWGAYYSAFFVFVIIFIQGFEAFTPWDT-----TTFFTSYISLILLVVVFIGCQLYYR 558

Query: 549 DWNLFIRAKDIDLISHRH-----IYDEDVLKQEKNQYKE 582
                ++ +DID+ + R      I+++D   + KN +++
Sbjct: 559 C-RFLLKVEDIDIDTDRREIEAIIWEDD---EPKNLWEK 593

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  267 bits (682), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 175/551 (31%), Positives = 281/551 (50%), Gaps = 32/551 (5%)

Query: 49  KIDDNNNQYEIEKNEINNIK---SDQFNDKLNNQ-------------LQKTIQPRHVIMI 92
           ++     Q ++ KNEI  ++   S    D +  Q             +Q+ ++PRHV MI
Sbjct: 2   EMQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMI 61

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           +                L +AGP G LI Y+ M S  + + Q+ GEMA  ++ +   F  
Sbjct: 62  ALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMA-TFIPVASSFTV 120

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAI 212
           +    +  A   A  ++YC  W     LEL      I+YW   V    ++ IF++ I   
Sbjct: 121 FTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLS 180

Query: 213 NLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF---- 268
           NL    + Y E +F+  L K++                  T G +G  YW NPG +    
Sbjct: 181 NLVS-VKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKT-GPVGFRYWRNPGPWGDGI 238

Query: 269 --RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIY 326
             +  + G RF G VS+LV AAF++  TE + ++A E +NPRK +P A +KV  R L  Y
Sbjct: 239 ISKSKSEG-RFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFY 297

Query: 327 VGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVAN 386
           VGS+  +G LVP+N P+L  S ++ + +SP++IA+ + G R  P   NAVIL +++S AN
Sbjct: 298 VGSLFFIGLLVPFNDPKL-DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAAN 356

Query: 387 SSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSW 446
           S+ Y  SR+L  LAK+G APKI   ++R G P   +   SL   + + + S    + F W
Sbjct: 357 SNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDW 416

Query: 447 LLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILI 506
           LL I+ ++  F W  I L HIRF +A+K QG S ++L +K+++  WG+ YAA  + LI+I
Sbjct: 417 LLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIII 476

Query: 507 GQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRH 566
            Q + A  P      N++NFF  Y+++ + +  +  ++   K   L  + +D+D+ S R 
Sbjct: 477 IQGFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFKS-RLIHKVEDVDIDSDRR 531

Query: 567 IYDEDVLKQEK 577
             + +V + ++
Sbjct: 532 EIEAEVWEDDE 542

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  267 bits (683), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 165/526 (31%), Positives = 276/526 (52%), Gaps = 24/526 (4%)

Query: 55  NQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAG 114
           +Q  IE  E   I + Q  +    ++++ ++ RH+ MI+                L NAG
Sbjct: 38  SQITIESQE-EEIANGQIREA---EVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAG 93

Query: 115 PAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQW 174
           P G LI Y+ M + +Y + Q+ GEMA  ++ +   F  +    +  ++  A  ++Y   W
Sbjct: 94  PVGALIAYLFMGTLVYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSW 152

Query: 175 LCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL 234
                LEL      I++W   V    +++IF++L++A+N+F   R Y E EF+    K+L
Sbjct: 153 AITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFP-VRFYGEFEFWVASIKVL 211

Query: 235 MXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPG--------TRFKGIVSTLVT 286
                             T G +G  YW NPG      PG         +F G VS+L+ 
Sbjct: 212 AIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPM---GPGIIAKNLNEAKFLGWVSSLIN 267

Query: 287 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLG 346
           AAF++  TE + ITA E +NPRK++P A KKV++R LF Y+GS+  +G LVPYN P+L  
Sbjct: 268 AAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLT- 326

Query: 347 SKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAP 406
           S  S   ASP++I++ + G  I PH  NAVIL +++S ANS+ Y  SR++  L+K   AP
Sbjct: 327 SDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAP 386

Query: 407 KIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSH 466
           +I +  ++ G P   +I   L   +A+  +S      F+WLL I+G++  F+W  I +SH
Sbjct: 387 RILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISH 446

Query: 467 IRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNF 526
           +RF +A++ +G S ++L +K++     + YA   M LI+I Q + +  P + +G    +F
Sbjct: 447 VRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP-SFDG---IDF 502

Query: 527 FKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDV 572
              Y++  + +  +  ++ W +   L  + +D+D+ + R   +E V
Sbjct: 503 LAAYISCFLFIAIWIVFQLWFRC-RLIWKIEDVDIDTDRRDIEEVV 547

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  268 bits (685), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 168/563 (29%), Positives = 288/563 (51%), Gaps = 21/563 (3%)

Query: 26  ENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEK----NEINNIKSDQFNDKLNNQLQ 81
           +N+I E   K I +   F      I D+  +  +      ++  + +  Q++D    +++
Sbjct: 46  KNEILEKDKKKIAHTNQFSSDIHSITDSLARSRLPHLGDDDDEEDAEEAQYHD---TEVK 102

Query: 82  KTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAV 141
           + ++ RH+ MI+                L N+GP G LI Y+ M S IY I Q+ GEMA 
Sbjct: 103 RALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEMA- 161

Query: 142 NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVF 201
            ++ +      +    +  A+  A  ++Y   W     +E+      I+YW +KV    +
Sbjct: 162 TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVPLAAW 221

Query: 202 VTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSY 261
           + IF++ +  +N F   + Y E EF+    K+L                  + G IG  Y
Sbjct: 222 IAIFWVFVTLMNFFP-VKVYGEIEFWIAFMKVL-AIAGYLLYALIIVCGGSSQGPIGFRY 279

Query: 262 WNNPGAFRG-----HTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           W NPG +           +RF G VS+L+ AAF++  TE + ITA E +NPRK++P A  
Sbjct: 280 WRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 339

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAV 376
           KV++R    Y+ S+  +G LVPY+ P L  S S+   +SP+VI++ + G +I P   NA+
Sbjct: 340 KVVFRIALFYIMSLFFIGLLVPYDDPRLS-SDSAVVASSPFVISIQNAGTKILPDIFNAI 398

Query: 377 ILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCAS 436
           ++I+V+S ANS+ Y  SR+L  LA+ G APK F Y+ R G P  G++  + L  +AF   
Sbjct: 399 VMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVV 458

Query: 437 SPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIY 496
           +      F+WL+ IS L+ +  W  I +SHIRF +A+K +G S ++L +K++   W + Y
Sbjct: 459 NNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYY 518

Query: 497 AATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRA 556
           A   + +I+  Q + A  P      ++T FF  Y+++ IL + + G + + +    F + 
Sbjct: 519 ATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQIYYRC-RFFWKL 573

Query: 557 KDIDLISHRHIYDEDVLKQEKNQ 579
           +DID+ + R   +E + + ++ +
Sbjct: 574 EDIDIDTDRREIEEVIWEDDEPK 596

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  266 bits (681), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 169/589 (28%), Positives = 292/589 (49%), Gaps = 38/589 (6%)

Query: 20  NVIVTNENQINESHSKLI----ENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDK 75
           +++  N  +  E  SK++    E+L+   D     D N       K  ++  + D+++  
Sbjct: 2   SILDINTEETLEGKSKIVIKSTESLEQH-DLQGNEDKNTPTTTPSKENVSENEKDEYH-- 58

Query: 76  LNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQA 135
              ++++ +  RH+ MI+                L  +GP G LI Y+ + + +Y + Q+
Sbjct: 59  ---EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQS 115

Query: 136 CGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK 195
            GEMA  ++ +   F  +    +  A   A  ++Y   W     LEL      I++W   
Sbjct: 116 LGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA 174

Query: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSG 255
           V    +++IF++++   NLF   R Y E EF+    K+                   T G
Sbjct: 175 VPLPAWISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-G 232

Query: 256 YIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
            +G  YW NPG +       +    RF G  S+L+ AAF+F  TE + ITA E +NPR+ 
Sbjct: 233 PVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQT 292

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           +P A +KV++R L  Y+ S+  +G LVPY+  +L  S++S   +SP++IA+ + G +I P
Sbjct: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILP 351

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
           H  N VIL++++S  NS+ Y  SR+L  LAK G  PK+F    + G P+F ++  SL   
Sbjct: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           +AF  +S    E F WLL + G++  F+W  I  +HIRF + ++ +G S N+L +K++  
Sbjct: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471

Query: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK-- 548
            + + YA  VM +I+  Q + A  P      ++ NFF  Y+++ +  +F+  ++ W K  
Sbjct: 472 PYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCR 527

Query: 549 -DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAF 596
             W L     DID+   R        ++ +++  ++    +LW K + F
Sbjct: 528 YVWKLV----DIDIDKDR--------REIEDRVWQDTTPANLWGKFWDF 564

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  266 bits (681), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 177/577 (30%), Positives = 302/577 (52%), Gaps = 39/577 (6%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSD-----QFNDKLNN 78
           T+E Q N    +L+++  D + S   I ++  + +I  +E+ + + D      + DK   
Sbjct: 51  TDEKQYNMKKKRLLQD--DAIASVNLITNSLPRSQIASHEVGDEEEDDEEEAHYEDK--- 105

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            +++ ++ RH+ MI+                L  AGP G LI YI M + +Y I Q+ GE
Sbjct: 106 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGE 165

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           MA  ++ +      +    +  A+  A  ++Y   W     +E+      I+YW +KV  
Sbjct: 166 MA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 224

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
            V++ IF++LI  +N F   + Y E EF+    K+L                    G IG
Sbjct: 225 AVWIAIFWVLITLMNFFP-VKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSH-QGPIG 282

Query: 259 VSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
             YW NPGA+    PG         RF G VS+L+ AAF++  TE + ITA E +NPRK 
Sbjct: 283 FRYWRNPGAW---GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 339

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           +P A  KV++R +  Y+ S+  +G LVPYN P L  + S+   +SP+VI++ + G    P
Sbjct: 340 VPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLS-ASSAVIASSPFVISIQNAGTYALP 398

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
              NAV+LI+V+S ANS+ Y  SR+L +LA+ G APK F Y+ ++G P  G+++ + L  
Sbjct: 399 DIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGL 458

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           +AF   +      F+WL+ IS L+ +  W  I L+HIRF +A++ +G S ++L +K+++ 
Sbjct: 459 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLM 518

Query: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW 550
            +G+ YAA  + +I+  Q + A  P       +++FF  Y+++ +L + + G + + K  
Sbjct: 519 PYGAYYAAFFVTVIIFIQGFQAFCPF-----KVSDFFTSYISLILLAVVFTGCQLYYK-C 572

Query: 551 NLFIRAKDIDLISHRH-----IYDEDVLKQEKNQYKE 582
               + +DID+ + R      I+++D   + KN +++
Sbjct: 573 RFIWKLEDIDIDTDRREIEAIIWEDD---EPKNLWEK 606

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  266 bits (681), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 182/619 (29%), Positives = 306/619 (49%), Gaps = 79/619 (12%)

Query: 23  VTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINN------IKSDQFNDKL 76
           +   N+ +E H    +N +D   S +++ +N  ++E+E  +INN      I   Q+N K 
Sbjct: 7   IITSNKWDEKH----DNFED--QSIRELPENQIEHEMEVIDINNKSTLYSIDEKQYNLKK 60

Query: 77  NNQLQ------------------------------------------KTIQPRHVIMISX 94
            + LQ                                          + ++ RH+ MI+ 
Sbjct: 61  KHGLQDDAIADVNSTTNSLTRTQIVSHEAGADEEDEEEAHYEDKHVKRALKQRHIGMIAL 120

Query: 95  XXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYP 154
                          L NAGP G LI YI M + IY I Q+ GEMA  ++ +      + 
Sbjct: 121 GGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGEMA-TFIPVTSSITVFS 179

Query: 155 SFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINL 214
              +  A+  +  ++Y   W     +E+      I+YW +KV    ++ IF++LI  +N 
Sbjct: 180 KRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLAAWIAIFWVLITLMNF 239

Query: 215 FGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAF------ 268
           F   + Y E EF+    K+L                    G IG  YW NPGA+      
Sbjct: 240 FP-VKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSH-QGPIGFRYWRNPGAWGPGIIS 297

Query: 269 RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVG 328
           +  + G RF G VS+L+ AAF++  TE + ITA E +NPRK +P A  KV++R +  Y+ 
Sbjct: 298 KNKSEG-RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVIFYIM 356

Query: 329 SIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSS 388
           S+  +G LVPYN P L  S S+   +SP+VI++ + G    P   NAV+LI+V+S ANS+
Sbjct: 357 SLFFIGLLVPYNEPRLSPS-SAVIASSPFVISIQNAGTYALPDIFNAVVLITVISAANSN 415

Query: 389 FYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLL 448
            Y  SR+L +LA+ G APK F Y+ ++G P  G+++ + L  +AF   +      F+WL+
Sbjct: 416 VYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVNNNANTAFNWLI 475

Query: 449 AISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQ 508
           +IS L+ +  W  I L+HIRF +A+K +G S ++L +K+++  +G+ YA+  + +I+  Q
Sbjct: 476 SISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYASFFVTIIIFIQ 535

Query: 509 FWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRH-- 566
            + A  P      +++ FF  Y+++ +L + +   + + K      + +DID+ S R   
Sbjct: 536 GFQAFCPF-----SVSEFFTSYISLILLAVVFISCQLYYKC-RFIWKLEDIDIDSDRREI 589

Query: 567 ---IYDEDVLKQEKNQYKE 582
              I+++D   + KN +++
Sbjct: 590 EAIIWEDD---EPKNLWEK 605

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  264 bits (675), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 274/527 (51%), Gaps = 24/527 (4%)

Query: 27  NQINESHSKLIENLKDFVDSFKKIDD--NNNQYEIEKNEINNIKSDQFN-DKLNNQLQKT 83
           N I+   S   EN K  V   KK++D  ++    I  +  +N   ++   D    ++++ 
Sbjct: 2   NLISSPDSSSSENTKPSVS--KKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRA 59

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           ++PRH+ MI+              + L  +GP G LI YI + S +Y + Q+ GEMA  +
Sbjct: 60  LKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMA-TF 118

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
           + +      +    +  A+  A  ++Y   W     +E+      I+YW + V    ++ 
Sbjct: 119 IPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIA 178

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IF++L+   N F   + Y E EF+    K++                    G IG  YW 
Sbjct: 179 IFWVLVTLANFFP-VKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSH-QGPIGFRYWR 236

Query: 264 NPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           NPG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPRK +P A 
Sbjct: 237 NPGPW---GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 293

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINA 375
            KV +R LF Y+ S+  +G LVPY+   L  + ++   +SP+VI++ + G ++ PH  NA
Sbjct: 294 NKVFFRILFFYILSLFFIGLLVPYDDLRL-SNTTAVIASSPFVISIQNAGTKVLPHIFNA 352

Query: 376 VILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCA 435
           +++I+++S ANS+ Y  SR+L +LA  G APK F Y+ ++G P  G+I  +LL  +AF  
Sbjct: 353 IVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLV 412

Query: 436 SSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSI 495
            +    E F+WL+ IS L+ +  W  I LSH+RF + +K +G S  +L +K+++  WG+ 
Sbjct: 413 VNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAY 472

Query: 496 YAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFG 542
           YAA  + +I+I Q + A  P       +++FF  Y+++ +L + + G
Sbjct: 473 YAAFFIGVIIIIQGFKAFTP----KFRVSDFFTSYISLILLAVLFLG 515

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  264 bits (675), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 267/514 (51%), Gaps = 16/514 (3%)

Query: 73  NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCI 132
            D    ++++ ++ RH+ MI+              + L  AGP G L+ YI + + +Y I
Sbjct: 48  GDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSI 107

Query: 133 IQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW 192
            Q+ GEMA  ++ +      +    +  A+  A  ++Y   W     +EL      I+YW
Sbjct: 108 TQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYW 166

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
            ++V    ++ IF++L+  +N F   R Y E EF+    K+L                  
Sbjct: 167 TDRVPIAAWIVIFWVLVTLVNFFP-VRFYGEIEFWIASVKVL-TIVGYLIYAFIIVCGGS 224

Query: 253 TSGYIGVSYWNNPGAFRGHTPGTR-------FKGIVSTLVTAAFSFGQTEFLAITASEQS 305
             G IG+       A RG    +R       F G VS+L+ AAF++  TE + ITA E +
Sbjct: 225 KQGPIGLPATGGIPA-RGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGEST 283

Query: 306 NPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHG 365
           NPRK +P A  KV +R LF Y+GS++ VG LVPY+ P L    S+   ASP+VI++ + G
Sbjct: 284 NPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAG 343

Query: 366 IRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAA 425
            +I P   NAV+LI+V+S ANS+ Y  SR+  +LA  G APK   ++ ++G P FG++  
Sbjct: 344 TKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLIT 403

Query: 426 SLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGY 485
           SL+  ++F   +   +  F WL+ IS L+ +  W  I L+HIRF + +K +G S ++L +
Sbjct: 404 SLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPF 463

Query: 486 KSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKT 545
           K++   W + YA   + +I+  Q + A  P      ++T FF  Y+++ ++LL + G + 
Sbjct: 464 KAKFMPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISLFLMLLVFIGCQI 519

Query: 546 WKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           + K   L+   +DID+ S R   D  V ++++ +
Sbjct: 520 YYKCRFLW-AVEDIDIDSDRREIDAIVWEEDEPK 552

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  262 bits (670), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 158/480 (32%), Positives = 256/480 (53%), Gaps = 19/480 (3%)

Query: 110 LHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWV 169
           L +AGP G LI YI M + IY + Q+ GEMA  ++ +   F+ +    +  A      ++
Sbjct: 20  LAHAGPVGALISYIFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 170 YCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFN 229
           Y + W     LEL      I+YW + V    ++ IF+ L+  +N+F   + Y E EF   
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFP-VKYYGEFEFCIA 137

Query: 230 LCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIV 281
             K++                    G IG  YW NPGA+    PG         RF G V
Sbjct: 138 SIKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAW---GPGIISSDKNEGRFLGWV 194

Query: 282 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNS 341
           S+L+ AAF++  TE + ITA E +NPRKA+P A KKV+ R L  Y+ S+  +G LVPYN 
Sbjct: 195 SSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYND 254

Query: 342 PELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAK 401
           P+L  S  S   ASP++I++ + G ++ P   NAV+LI+++S  NS+ Y  SR+L +L+K
Sbjct: 255 PKL-DSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSK 313

Query: 402 QGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGT 461
              AP+  + + + G P F ++A S+   +AF  +S    + F+WLL I+G++  F W  
Sbjct: 314 NDLAPRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLL 373

Query: 462 ICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGA 521
           I  SHIRF +A+  +G S N+L YK+++  + + YA+  + LI++ Q + A  P      
Sbjct: 374 ISFSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SF 429

Query: 522 NITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYK 581
              +F   Y+++ + +  +F ++ W K   + ++ +D+D+ S R   +E V  +   + K
Sbjct: 430 QPVDFVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDRREIEEQVWIEPLRKTK 488

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  265 bits (678), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 169/525 (32%), Positives = 267/525 (50%), Gaps = 23/525 (4%)

Query: 60  EKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
           E +E       +F+D    Q+++ ++PRH+ MI+                L  +GP G L
Sbjct: 85  ECDESGLPAKGKFHD---TQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSL 141

Query: 120 IGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCP 179
           I YI M S +Y + Q+ GEMA  ++ +      +    +  A   +  ++Y   W     
Sbjct: 142 IAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFA 200

Query: 180 LELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXX 239
            EL      I+YW  KV    ++ IF++++  +N F   + Y E EF+ +  K+L     
Sbjct: 201 TELSVTGQIIQYWTYKVPLAAWIPIFWVIVAVLNFFP-VKIYGEIEFWVSSVKVL-AIVG 258

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQT 294
                          G IG  YW +  AF       +    RF G VS+L+ AAF++  T
Sbjct: 259 YLIYALVIVCGGSRQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGT 318

Query: 295 EFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA 354
           E + I+A E +NPRK +P A  KVI+R    Y+ S+  +G LVPYN   L    S+   +
Sbjct: 319 ELVGISAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL-SDGSAIIAS 377

Query: 355 SPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDR 414
           SP+VI++ + G    P   NAVILI+VLS ANS  Y +SR+L  LA QG APK FTY++R
Sbjct: 378 SPFVISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNR 437

Query: 415 KGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMK 474
            G P  G+    L+  +AF   S      F+WL+ IS L+ +  W  IC +HIRF +A+K
Sbjct: 438 YGVPYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALK 497

Query: 475 IQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMP 534
            +G S ++L +K++   WG+ YAA  + LI+  Q + A  P ++      +FF  Y+++ 
Sbjct: 498 HKGISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFTPWDTK-----SFFTSYISLI 552

Query: 535 ILLLFYFGYKTWKKDWNLFIRAKDIDLISHR-----HIYDEDVLK 574
           +  + Y G   + +   L I+ +DID+ + R     ++++ED  +
Sbjct: 553 LFGVLYLGCLIYYRG-RLLIKIEDIDIDTDRKEVEAYVWEEDAPR 596

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  263 bits (673), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 154/469 (32%), Positives = 246/469 (52%), Gaps = 19/469 (4%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           + ++++ ++PRH+ MI+              + L +AGP G LI Y+ M +  Y + Q+ 
Sbjct: 79  DAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSL 138

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +   F  +    +  A+  A  ++Y   W     LEL      I++W   V
Sbjct: 139 GEMA-TFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAV 197

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ IF++++   NLF   + Y E EF+    K+L                  T G 
Sbjct: 198 PLGAWIAIFWVILTTSNLFP-VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GP 255

Query: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           +G  YW NPG +    PG         RF G VS+L+ AAF++  TE + ITA E  NPR
Sbjct: 256 VGFRYWRNPGPW---GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPR 312

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           + +P A  KV +R LF Y+ S++ +G LVP+N P+L  S+ S   +SP+VIA+ + G ++
Sbjct: 313 RTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL-KSEDSYISSSPFVIAIENSGTKV 371

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            PH  NAVIL +++S  NS+ Y  SR+L  LAK   APK+F    + G P   ++  +  
Sbjct: 372 LPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAF 431

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +A+   S    +VF WLL I+ ++  F W  I L+HIRF + +K +  S N+L +K++
Sbjct: 432 GFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAK 491

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILL 537
              WG+ Y+A  + LI+I Q + A  P      N++NFF  Y+++ + L
Sbjct: 492 FMPWGAYYSAFFISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFL 536

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  263 bits (672), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 174/585 (29%), Positives = 298/585 (50%), Gaps = 42/585 (7%)

Query: 25  NENQIN--ESHSKL----IENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN 78
           +E Q N  + H  L    I ++    +S  ++   +++ +I ++E    +   + DK   
Sbjct: 52  DEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDE----EEAHYEDK--- 104

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
            +++ ++ RH+ MI+                L NAGP G LI YI M + +Y + Q+ GE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGE 164

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           MA  ++ +      +    +  A+  +  ++Y   W     +E+      I+YW +KV  
Sbjct: 165 MA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPL 223

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
             ++ IF+++I  +N F   + Y E EF+    K+L                    G IG
Sbjct: 224 AAWIAIFWVIITLMNFFP-VKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSH-QGPIG 281

Query: 259 VSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
             YW NPGA+    PG         RF G VS+L+ AAF++  TE + ITA E +NPRK 
Sbjct: 282 FRYWRNPGAW---GPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           +P A  KV++R +  Y+ S+  +G LVPYN   L  + S+   +SP+VI++ + G    P
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLS-ASSAVIASSPFVISIQNAGTYALP 397

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
              NAV+LI+V+S ANS+ Y  SR+L +LA+ G APK F Y+ R+G P  G++  + L  
Sbjct: 398 DIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGL 457

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           +AF   +      F+WL+ IS L+ +  W  I L+HIRF +A+K +G S ++L +K+++ 
Sbjct: 458 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLM 517

Query: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW 550
            +G+ YAA  + +I+  Q + A  P       ++ FF  Y+++ +L + + G + + K  
Sbjct: 518 PYGAYYAAFFVTVIIFIQGFQAFCPF-----KVSEFFTSYISLILLAVVFIGCQIYYK-C 571

Query: 551 NLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYA 595
               + +DID+ S R   +  + + ++ +        +LW K +A
Sbjct: 572 RFIWKLEDIDIDSDRREIEAIIWEDDEPK--------NLWEKFWA 608

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  261 bits (668), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 167/555 (30%), Positives = 284/555 (51%), Gaps = 28/555 (5%)

Query: 1   MSSLSPSITKDGLH-LSVNKNVIVTNENQINESHSKLIENL---KDFVDSFKKIDDNNNQ 56
           M+S++  I  + L  L  N +   +  + ++ S+SK+ + L   KD   + + IDD++++
Sbjct: 1   MTSIAQQIELEELEALHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSR 60

Query: 57  YEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPA 116
               +  I              ++++ ++PRHV MI+                L NAGP 
Sbjct: 61  MFDPEGSIGQ-----------AEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPV 109

Query: 117 GLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLC 176
           G LI ++++ +  Y + Q+ GEMA  ++ +   F  +    +  A   A  ++Y   W  
Sbjct: 110 GSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAI 168

Query: 177 VCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMX 236
              LEL      I+YW + V  + ++ IF++L+++ N+F   + Y E EF+    K++  
Sbjct: 169 TFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP-VKWYGEFEFWVASIKVI-A 226

Query: 237 XXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRG-----HTPGTRFKGIVSTLVTAAFSF 291
                             G IG  YW  PG +       +    RF G VS+L++AAF++
Sbjct: 227 IIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTY 286

Query: 292 GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKS-S 350
             TE + ITA E  NPRKA+P A  KV +R L  Y+GS+  +G LVPYN P+L GS + S
Sbjct: 287 QGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGS 346

Query: 351 QTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFT 410
               SP++IA+ +    + PH  NAVIL +++S  NS+ Y  SR+L  L+K   APK F+
Sbjct: 347 YIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFS 406

Query: 411 YLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFR 470
              + G P   ++  ++   +A+   S    EVF WLL I+ ++   TW  I +SHIRF 
Sbjct: 407 KTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFM 466

Query: 471 RAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEY 530
           + +K +G S ++L YK++   + + YAA  + +I+I Q + A  P      N+++FF  Y
Sbjct: 467 QTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAP----HFNVSDFFAAY 522

Query: 531 LAMPILLLFYFGYKT 545
           +++ +  + +  ++T
Sbjct: 523 ISVFLFFIVWAIFQT 537

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 163/521 (31%), Positives = 265/521 (50%), Gaps = 23/521 (4%)

Query: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMA 126
           +K  Q ++    ++++ ++ RH+ MI+                L NAGP G LI Y+ MA
Sbjct: 67  VKEGQVHEA---EVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMA 123

Query: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186
           + +Y ++Q+ GEMA  ++ +   F  + S  +  A+  A  ++Y   W     LEL    
Sbjct: 124 TLVYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182

Query: 187 MTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXX 246
             I++W   V    ++TIF++L+   NLF   + Y E EF+    K++            
Sbjct: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCM 241

Query: 247 XXXXXXTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLA 298
                 T G +G  YW NPGA+    PG         RF G VS+L+ AAF++  TE + 
Sbjct: 242 VCGAGIT-GPVGFRYWRNPGAW---GPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVG 297

Query: 299 ITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYV 358
           ITA E +NPRK++P A KKV++R L  Y    + +G LVPYN P+L  S  S   +SP++
Sbjct: 298 ITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFI 356

Query: 359 IAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRP 418
           IA+ + G ++ PH  NAV+L +++S  NS+ Y  SR++  LAK   AP  F   +  G P
Sbjct: 357 IAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVP 416

Query: 419 LFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGR 478
            F +   S    +A+   S      F+WLL I+G++  FTW  I   HIRF +A+K +G 
Sbjct: 417 YFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGI 476

Query: 479 SLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLL 538
           S ++L +K++   W + YA   M +I++ Q + A  P  S      +F   Y+++ + + 
Sbjct: 477 SRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG----VDFAAAYVSVFLFIA 532

Query: 539 FYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
            + G + W +   +F R  ++D+ + R   +  V   E  +
Sbjct: 533 IWLGAQIWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDEPPK 572

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 164/573 (28%), Positives = 288/573 (50%), Gaps = 48/573 (8%)

Query: 32  SHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIM 91
           + S+L   + D  +S     D +++ E E +E               ++++ ++ RH+ M
Sbjct: 63  TRSRLNSRVDDGAES-----DGSDELEAEVHE--------------TKVKRALKQRHIGM 103

Query: 92  ISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFN 151
           I+                L  AGP G LI YI M + IY + Q+ GEMA  ++ +     
Sbjct: 104 IALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSIT 162

Query: 152 NYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIA 211
            +    +  A+  A  ++Y   W     +E+      I+YW + V    ++ IF++L+  
Sbjct: 163 VFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTL 222

Query: 212 INLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGH 271
           +N F   + Y E EF+    K+L                    G IG  YW +PGAF   
Sbjct: 223 MNFFP-VKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSH-QGPIGFRYWRHPGAF--- 277

Query: 272 TPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
            PG         +F G V++L+ AAF++  TE + ITA E +NPRK +P A  KV++R +
Sbjct: 278 GPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIV 337

Query: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLS 383
             Y+ S+  +G L+PYN   L  ++ +   +SP+VI++ +   ++ P   NAV++++V+S
Sbjct: 338 LFYIMSLFFIGMLLPYNDKRL-SAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMS 396

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
            ANS+ Y  SR+L  LA  G APK F+Y+ R G P  G++  + L  +AF   +      
Sbjct: 397 AANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTA 456

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F+WL+ IS L+ +  W  I L+HIRF +A+K +G S ++L +K+++  WG+ YAA  + +
Sbjct: 457 FNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTV 516

Query: 504 ILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
           I+  Q + A  P      +++ FF  Y+++ +L +   G + + +     ++ +DID+ +
Sbjct: 517 IIFIQGYQAFCPW-----DVSTFFTSYISLILLAVLVVGCQLYYRG-RFLLKLEDIDIDT 570

Query: 564 HRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAF 596
            R   +  V + ++ +        +LW K +A+
Sbjct: 571 DRREIESIVWEDDEPK--------TLWDKFWAW 595

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  259 bits (662), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/489 (31%), Positives = 258/489 (52%), Gaps = 15/489 (3%)

Query: 65  NNIKSDQFNDKLN-NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYI 123
           N  + +   +K N + +++ ++PRHV MIS              + + NAGP G L+ YI
Sbjct: 33  NTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYI 92

Query: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183
            +A+  YC+ Q+ GEMA  ++ +   F  + S  V  A   A  ++Y + W     LE+ 
Sbjct: 93  FVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEIS 151

Query: 184 TASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXX 243
                I YW++ V    ++ IF++L+ AINL    + Y E EF+    K++         
Sbjct: 152 VIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVIAILCFLFYG 210

Query: 244 XXXXXXXXXTSGYIGVSYWNNPGAF-------RGHTPGTRFKGIVSTLVTAAFSFGQTEF 296
                      G IG  YW +PG +         HT   +F G VS+L+ AAF+F  TE 
Sbjct: 211 LVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHT--AQFLGWVSSLIKAAFTFQGTEL 267

Query: 297 LAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSS-QTKAS 355
           + +TA E  NPR+ +P A   V +R L  Y+GS++++G LV Y+ P+L+   S+    AS
Sbjct: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS 327

Query: 356 PYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRK 415
           P+V+A+ + G ++ P  +N VI+++++S  NS+ Y  SR+L  L + G AP   +    +
Sbjct: 328 PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSR 387

Query: 416 GRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKI 475
           G P   ++A S+   + +   S K   VF WLL+I+ +S  FTW  I +SHIRF + +K 
Sbjct: 388 GVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKK 447

Query: 476 QGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPI 535
           +G S ++L +K++   +G+ YAA  + +I++ Q + A  P ++    +  +   ++ + I
Sbjct: 448 RGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDF-VAYYISAFIFVVI 506

Query: 536 LLLFYFGYK 544
            LLF F +K
Sbjct: 507 WLLFQFLFK 515

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  259 bits (663), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 171/565 (30%), Positives = 295/565 (52%), Gaps = 36/565 (6%)

Query: 41  KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQ---LQKTIQPRHVIMISXXXX 97
           KD +D    I+D +N   +     ++ K D + D   ++   L+K ++ RH+ MI+    
Sbjct: 48  KDGLD----INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGS 103

Query: 98  XXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFL 157
                      +L+ AGP  + I Y  +   ++  + A GEMA +Y+ L  GF +Y S  
Sbjct: 104 IGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRY 161

Query: 158 VDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTIFYLLIIAINLF 215
            D A  FAV + Y  ++L + P +L  A++ I+YW   E+V+P V++TIF ++I+A+N F
Sbjct: 162 CDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN-F 220

Query: 216 GGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT 275
            G + + E EF+ +  K+++                 T   +G  ++++PGAF+ ++   
Sbjct: 221 IGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSI 280

Query: 276 -----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSI 330
                +F   V+ LV A F++   E   I A+E +NPRK+IP A K  +YR +  Y+ +I
Sbjct: 281 DGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTI 340

Query: 331 IIVGFLVPYNSPELLGSKSSQT--KASPYVIAVASHGIRIAPHFINAVILISVLSVANSS 388
            ++G  V Y+ P L  +K+S T   ASPYV+A+ + GI+  PH  NA +L+ V S  NS 
Sbjct: 341 FLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSD 400

Query: 389 FYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLL 448
            Y +SR L  LA    APKIF   +R G P + ++ +S    +A+ + S    ++F++ +
Sbjct: 401 LYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFV 460

Query: 449 AISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG- 507
            +  +  + +W +I ++++ F RA+K Q    +   Y++    +GS +  T+ F ILI  
Sbjct: 461 NVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYF--TLAFCILIAF 518

Query: 508 --QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKD--WNLFIRAKDIDLIS 563
              F V L    ++  +  NF   Y+ +P+ ++ YFGYK  KK   W    + +++DL +
Sbjct: 519 IKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYT 570

Query: 564 HRHIYDEDVL--KQEKNQYKENLKN 586
            +   DE+    K    + +E LKN
Sbjct: 571 FKAAIDEEEEQGKIADAERRERLKN 595

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  258 bits (660), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 165/512 (32%), Positives = 270/512 (52%), Gaps = 14/512 (2%)

Query: 73  NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCI 132
            D    ++++ ++PRHV MI+                L  +GP G LI YI M S +Y +
Sbjct: 66  GDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFV 125

Query: 133 IQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW 192
            Q+ GEMA  ++ +      +    +  A+  A  ++Y   W     +EL      I YW
Sbjct: 126 TQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYW 184

Query: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXX 252
            + V    ++ IF++L+ A N F   + Y E EF     K++                  
Sbjct: 185 TDAVPLAAWIAIFWVLLTAANFFP-VKWYGEFEFCVASIKVI-AIVGYLLYALIIVCGGS 242

Query: 253 TSGYIGVSYWNNPGAFRGHTPG-----TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307
           + G IG  YW NPG +   T        RF G V +LV A+F++  TE + ITA E SNP
Sbjct: 243 SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNP 302

Query: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIR 367
           RK +P A  KV +R L  Y+GS+  VG LVPYNSP+L  S S+   +SP+VI++ + G +
Sbjct: 303 RKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL-ESNSAVIASSPFVISIQNAGTK 361

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + P   NAV+L+++LS  NS+ Y  SR+L +LA  G APK F+Y+ ++G P  G+I  +L
Sbjct: 362 VLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTAL 421

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
           L  +AF A++      F+WL+ IS L+ +  W  I ++HIRF + +K++G S + L +K+
Sbjct: 422 LGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKA 481

Query: 488 QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWK 547
           ++  WG+ YAA  + LI+  Q + A  P      +++ FF  Y+++ +L++ +   + + 
Sbjct: 482 KLMPWGAYYAAFFVGLIVFIQGFTAFAPR----FDVSEFFTAYISLILLVVLFILCQLYY 537

Query: 548 KDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           +      + +DID+ S R   D  + + ++ +
Sbjct: 538 RC-RFLTKIEDIDIDSDRREIDAIIWEDDEPK 568

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/498 (31%), Positives = 255/498 (51%), Gaps = 20/498 (4%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           + ++++ ++ RH+ MI+                L  AGP G LI YI M + +Y + Q+ 
Sbjct: 70  DAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSL 129

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +   F  +    +  +   A  ++Y   W     LEL      I+YW   V
Sbjct: 130 GEMA-TFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               +++IF+++I A N+F   + Y E EF+    K++                  T G 
Sbjct: 189 PLAAWISIFWVVITAGNMFP-VKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVT-GP 246

Query: 257 IGVSYWNNPGAFRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           +G  YW NPG +    PG         RF G VS+L+  AF++  TE + I+A E +NPR
Sbjct: 247 VGFRYWRNPGPW---GPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPR 303

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           KA+P A KKV++R LF Y+GS+  +G LVPYN  + L +  S   +SP++IA+ + G  +
Sbjct: 304 KAVPRAIKKVVFRILFFYIGSLFFIGLLVPYND-DALNNTDSYVASSPFIIAIKNSGTPV 362

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            PH  NAVI  +++S  NS+ Y  SR+L  L+K   APKI +   + G P   ++  S++
Sbjct: 363 LPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVV 422

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +A+  +S      F+WLL I+ ++  FTW  I LSHIRF +A+K +G S ++L +K+ 
Sbjct: 423 GALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAA 482

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           +    + YA+ +MF+I+I Q + A  P  S       +   +L + I  LF   ++    
Sbjct: 483 LMPGLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRC--- 539

Query: 549 DWNLFIRAKDIDLISHRH 566
                 + +D+D+ + R 
Sbjct: 540 --RFIHKVEDVDIDTDRR 555

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  257 bits (657), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/561 (28%), Positives = 285/561 (50%), Gaps = 17/561 (3%)

Query: 24  TNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
           T++  +NE++ K  +     + S  K +D        + ++++    +  +  + ++++ 
Sbjct: 21  TDKPSLNETYVKEYDRS---ISSPPKENDGYGYRVDNEYDVDDSVDGEKGEVRSTEVKRA 77

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           ++PRH+ MI+                L NAGP G+LI Y+ MA+  + ++Q+ GEMA  Y
Sbjct: 78  LKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMA-TY 136

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203
           + +   F+ +    +  A+  A  ++Y   W     LEL      ++YW  KV    +++
Sbjct: 137 IPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVAAWIS 196

Query: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWN 263
           IF++LI  +N F   + Y E EF+    K++                  T G +G  YW 
Sbjct: 197 IFWVLIAGLN-FCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKT-GPVGFRYWR 254

Query: 264 NPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318
           +  AF       +    RF G VS+L+ AAF++  TE + ITA E +NPRK +P + K+ 
Sbjct: 255 HGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRT 314

Query: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378
           ++R L  Y+ S++ VG LVP+N   L  S+S    +SP+++A+ + G +  P   NAVIL
Sbjct: 315 LWRILIFYIFSLLFVGLLVPFNDHGLQDSRS-YAASSPFILAIKNSGTKALPDIFNAVIL 373

Query: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438
            +V+S ANS  Y  SR++ ++A+   AP I     + G P   ++  S +  +A+  +S 
Sbjct: 374 TTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSS 433

Query: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498
               VF+WL+ I+G++  F+W  I  SH+RF +A+K +G S N+L +K+    W +IY+ 
Sbjct: 434 SGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSF 493

Query: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558
             M LI++ Q +    P        ++F   Y+++ +  + +  ++ W +   L +   +
Sbjct: 494 FFMTLIILVQGFTCFTP----HFQASDFVASYISVGLFFVIWAVFQIWFRC-PLLVPIAE 548

Query: 559 IDLISHRHIYDEDVLKQEKNQ 579
           ID+ + R   D +V + E  +
Sbjct: 549 IDIDTDRRDVDAEVWEDEPPK 569

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  257 bits (656), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 157/523 (30%), Positives = 266/523 (50%), Gaps = 22/523 (4%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           N +L+K ++ RH+ MI+                L   GP  +LI Y  +   ++  +   
Sbjct: 77  NTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMACL 136

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NE 194
           GEMA +Y+ L  GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+YW   +
Sbjct: 137 GEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194

Query: 195 KVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS 254
           +V+P V++TIF ++I+AIN+ G  + + E EF+ +  K+++                   
Sbjct: 195 RVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDH 253

Query: 255 GYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
             +G  YW +PGAF+ ++        +F   V+  V + FS+   E   I  SE  NPRK
Sbjct: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK--SSQTKASPYVIAVASHGIR 367
           ++P A K  +YR +  Y+ ++ ++G  V YN P LL +K  S    ASP+V+A+ + GI+
Sbjct: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + PH  NA +L+ V S  NS  Y SSR L  LA  G APKIF    + G P   +I + L
Sbjct: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
              +A+   S    ++F++ + +  +  + +W TI + +I F +A + QG   ++  Y +
Sbjct: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493

Query: 488 QVGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW 546
               +G+ +A +   LI LI  F V L     +  +   F   Y+ +P+ +L + GYK  
Sbjct: 494 PGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLI 549

Query: 547 KKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSL 589
            K     I++ D+DL + + IYD +   +E+ + K+  +   L
Sbjct: 550 YK--TKVIKSTDVDLYTFKEIYDRE---EEEGRIKDQEREERL 587

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  256 bits (654), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 161/561 (28%), Positives = 286/561 (50%), Gaps = 33/561 (5%)

Query: 27  NQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNN-------Q 79
           + +  S   +    K  V +F  +  +++  +I   +  +  S   ++++ N       +
Sbjct: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           +++ ++ RH+ MI+                L ++GP G LI YI + +  Y + Q+ GEM
Sbjct: 62  VKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPD 199
           A  ++ +   F  + S  +  +   AV ++Y   W     LEL      + YW   V   
Sbjct: 122 A-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180

Query: 200 VFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGV 259
            +++IF++++ A+N+F   + Y E EF+    K++                  T G +G 
Sbjct: 181 AWISIFWVILTALNMFP-VKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT-GPVGF 238

Query: 260 SYWNNPGAF-RGHTPGT----------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
            YW NPG +  G T             RF G  ++L+ AAF++  TE + ITA E +NPR
Sbjct: 239 RYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPR 298

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           K +P A KKV++R L  Y+GS+  +G LVP++ P+L  S  S   +SP++IA+ + G +I
Sbjct: 299 KTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLS-SDDSYVSSSPFIIAIENSGTKI 357

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            P   NA+ILI+++S  NS+ Y  SR+L +LAK G APKI +   +KG P   ++A ++ 
Sbjct: 358 LPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVF 417

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +A+  ++     VF WL+ I+ ++  + W  I +SHIRF + +K +G S ++L +K+ 
Sbjct: 418 GVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKAN 477

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           +    + YA   M +I+I Q + A  P      ++++FF  Y+++ +  L +  ++ W K
Sbjct: 478 LMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLIWGAFQLWFK 533

Query: 549 ---DWNLFIRAKDIDLISHRH 566
               W L    +D+D+ S+R 
Sbjct: 534 CRWIWKL----EDVDIDSNRR 550

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  256 bits (655), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 157/479 (32%), Positives = 250/479 (52%), Gaps = 18/479 (3%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           Q+++ ++PRH+ MI+                + NAGP G LI YI M + ++ + Q+ GE
Sbjct: 101 QVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           MA  ++ +   F  + S  V   +  A  ++Y   W     LEL      I++W  KV  
Sbjct: 161 MA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
             +++IF++LI+ +N F   + Y E EF+    K++                  T G +G
Sbjct: 220 AAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVG 277

Query: 259 VSYWNNPGAFRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
             YW +PG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPRK+
Sbjct: 278 FRYWRHPGPW---GPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           +P A KKV  R L  Y+ S+  +G LVPYN P+ L S  S   ASP++IA+ + G ++ P
Sbjct: 335 VPRAIKKVSVRILLFYILSLFFIGLLVPYNDPK-LSSTDSYVSASPFIIAIQNSGTKVLP 393

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
           H  NAVIL +++S ANS+ Y  SR+L  L+    APK F    R G P   ++  +    
Sbjct: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490
           +A+  +S      F+WLL I+G++  F W +I +SHIRF + +K +G S ++L YK+ + 
Sbjct: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512

Query: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLF--YFGYKTWK 547
              + Y A  + LI++ Q + A  P   + A +T +   +L + I ++   YF  + W+
Sbjct: 513 PGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  256 bits (653), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 271/519 (52%), Gaps = 29/519 (5%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           +  +++ ++ RH+ MI+                L NAGP G LI YI M + +Y + Q+ 
Sbjct: 103 DKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSL 162

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +      +    +  A+  +  ++Y   W     +E+      I+YW  KV
Sbjct: 163 GEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
              V++ IF++LI  +N F   + Y E EF+    K+L                    G 
Sbjct: 222 PLGVWIAIFWVLITLMNFFP-VKVYGEFEFWVASVKVL-AIMGYLIYALVIVCGGSKQGP 279

Query: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           IG  YW NPGA+    PG         RF G VS+L+ AAF++  TE + ITA E +NPR
Sbjct: 280 IGFRYWRNPGAW---GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 336

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368
           K +P A  KV++R +  Y+ S+  +G LVPY  P L  + S+   +SP+VI++ + G   
Sbjct: 337 KTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLS-ASSAVIASSPFVISIQNAGTYA 395

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            P   NA++LI+V+S ANS+ Y  SR+L +LA+ G APK F Y+ ++G P  G+++ + L
Sbjct: 396 LPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 455

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +AF   +      F+WL+ IS L+ +  W  I LSHIRF +A+  +G S ++L +K++
Sbjct: 456 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAK 515

Query: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
              +G+ YA+  + +I+  Q + +  P       + +FF  Y+++ +L + + G + + K
Sbjct: 516 FMPYGAYYASFFVTVIIFIQGFQSFCPF-----RVADFFTSYISLILLAVVFTGCQLYYK 570

Query: 549 DWNLFIRAKDIDLISHRH-----IYDEDVLKQEKNQYKE 582
                 + +DID+ S R      I+++D   + KN +++
Sbjct: 571 -CRFIWKLEDIDIDSDRREIEAIIWEDD---EPKNLWEK 605

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  255 bits (652), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 263/518 (50%), Gaps = 20/518 (3%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           N +L+K ++ RH+ MI+                L   GP  +LI Y  +   ++  +   
Sbjct: 79  NTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMACL 138

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NE 194
           GEMA +Y+ L  GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+YW   +
Sbjct: 139 GEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196

Query: 195 KVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTS 254
           +V+P V++TIF ++I+AIN+ G  + + E EF+ +  K+++                   
Sbjct: 197 RVNPGVWITIFLVVIVAINVVG-VKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNH 255

Query: 255 GYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
             +G  YW +PGAF+ ++        +F   V+  V + FS+   E   I  SE  NPRK
Sbjct: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK--SSQTKASPYVIAVASHGIR 367
           ++P A K  +YR +  Y+ ++ ++G  V YN P LL +K  S    ASP+V+A+ + GI 
Sbjct: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + PH  NA +L+ V S  NS  Y SSR L  LA  G APKIF    R G P   +I + L
Sbjct: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
              +A+   S    ++F++ + +  +  + +W TI + +I F +A + QG   ++  Y +
Sbjct: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495

Query: 488 QVGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW 546
               +G+ +A     LI LI  F V L     +  +   F   Y+ +P+ ++ + GYK  
Sbjct: 496 PGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551

Query: 547 KKDWNLFIRAKDIDLISHRHIYD-EDVLKQEKNQYKEN 583
            K     I++ D+DL + + IYD E+   + K+Q KE 
Sbjct: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEE 587

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  252 bits (644), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 178/586 (30%), Positives = 294/586 (50%), Gaps = 39/586 (6%)

Query: 27  NQINESHSKLIENL--KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN------- 77
           N  ++ + +  E L  K+F    ++ +  N+  ++E+N I++  S   ND  N       
Sbjct: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELIND--DLERN-ISSASSQDENDSYNIDGKTEG 65

Query: 78  NQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACG 137
            +L+K ++ RHV MI+               +L  AGP   LI Y  +   ++  +   G
Sbjct: 66  TRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLG 125

Query: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEK 195
           EMA  Y+ L  GF +Y S   D A  FAV + Y  ++  + P +L  A++ I+YW   EK
Sbjct: 126 EMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183

Query: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSG 255
           V+P V+VTIF ++I++IN+FG  R + E EF+ +  K+L+                    
Sbjct: 184 VNPGVWVTIFLVVIVSINVFG-VRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHD 242

Query: 256 YIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
            +G  YW +PG+F+ ++        RF   VS  V A +++   E   I A+E  NPRK+
Sbjct: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHGIRI 368
           IP A K  +YR +  Y+ SI ++G  V Y+ P L+ +K+S T A  SP+V+A+ + GI  
Sbjct: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINA 362

Query: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428
            PH INA +L+ V S  NS  Y SSR L +LA    APKIF   +R G P + +  + L 
Sbjct: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422

Query: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
             +A+   S    ++F++ + +  +  + +W +I +++I F RA++ QG   +   Y + 
Sbjct: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482

Query: 489 VGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK-TW 546
              +G+ ++     LI LI  F V L    ++  +  NF   Y+ +P+    YFGYK T+
Sbjct: 483 FQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538

Query: 547 KKDWNLFIRAKDIDLISHRHIYDED------VLKQEKNQYKENLKN 586
           K      I    +DL + +   D++         ++  + K+N KN
Sbjct: 539 KTK---VIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKN 581

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score =  243 bits (621), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 205/326 (62%), Gaps = 6/326 (1%)

Query: 277 FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336
           FK + +T V+AAFSFG +E + +T++E  N   AI  AAK   +R    Y+ +++I+G L
Sbjct: 5   FKNLCNTFVSAAFSFGGSELVLLTSTESKNI-SAISRAAKGTFWRIAIFYITTVVIIGCL 63

Query: 337 VPYNSPELL-GSKSSQTKASPYVIAVASHGIRIA--PHFINAVILISVLSVANSSFYSSS 393
           VPYN   LL GS S    ASP+VIA+++ G   A   +F+N VIL++V+SV NS  Y+SS
Sbjct: 64  VPYNDSRLLNGSTSEDISASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASS 123

Query: 394 RMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGL 453
           R++  L   G  P I +Y+DRKGRPL GI  + +   + F  +S KE EVF+WL A+  +
Sbjct: 124 RLIQALGASGQLPSICSYMDRKGRPLVGIAISGVFGLLGFLVASNKEDEVFTWLFALCSI 183

Query: 454 SQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVAL 513
           S  FTW  IC+S IRFR A+K QGRS +E+ YKS +GV+G +    +  L++ G+ +V+ 
Sbjct: 184 SSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSA 243

Query: 514 WPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDEDV 572
            P+ S  ++   FF+  L++PI+++ Y  ++ ++KDW N +I+  DIDL +   I + D+
Sbjct: 244 APVGSP-SSAKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLDL 302

Query: 573 LKQEKNQYKENLKNGSLWLKIYAFWC 598
            K +K   KE + +   + KIY FWC
Sbjct: 303 FKAQKEAEKELIASKPFYYKIYRFWC 328

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  251 bits (642), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 162/567 (28%), Positives = 280/567 (49%), Gaps = 34/567 (5%)

Query: 45  DSFKKIDDNNNQYEIEKNEINN---------IKSDQF----NDKLNNQLQKTIQPRHVIM 91
           DSF   +      ++E+N +++          + D F          +L+K ++ RH+ M
Sbjct: 33  DSFPVKEQEIYNIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISM 92

Query: 92  ISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFN 151
           I+                L   GP  +LI Y  +   ++  +   GEMA +Y+ L  GF 
Sbjct: 93  IAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMA-SYIPL-DGFT 150

Query: 152 NYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTIFYLLI 209
           +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+YW   ++V+P V++TIF ++I
Sbjct: 151 SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVI 210

Query: 210 IAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFR 269
           +AIN+ G  + + E EF+ +  K+L+                     +G  YW +PGAF+
Sbjct: 211 VAINVIG-VKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFK 269

Query: 270 GHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALF 324
            ++        +F   ++  V + FS+   E   I  SE  NPRK++P A K  +YR + 
Sbjct: 270 EYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIV 329

Query: 325 IYVGSIIIVGFLVPYNSPELLGSKSS--QTKASPYVIAVASHGIRIAPHFINAVILISVL 382
            Y+ ++ ++G  V YN P L+ +K       ASP+V+A+ + GI++ PH  NA +L+ V 
Sbjct: 330 FYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVF 389

Query: 383 SVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETE 442
           S  NS  Y SSR L  LA  G APKIF+  ++ G P   +I + L   +A+   S    +
Sbjct: 390 SACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAK 449

Query: 443 VFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT-VM 501
           +F++ + +  +  + +W TI + +I F +A + QG   ++  Y +    +G+ +A    +
Sbjct: 450 IFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCI 509

Query: 502 FLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDL 561
           F+ LI  F V L     +  +   F   Y+ +P+ +  + GYK   K     I++ D+DL
Sbjct: 510 FIALIKNFTVFL----GHKFDYKTFITGYIGLPVYVFSWVGYKLIYK--TKVIKSTDVDL 563

Query: 562 ISHRHIYD--EDVLKQEKNQYKENLKN 586
            + + IYD  E+  K E  + +E LK 
Sbjct: 564 YTFKEIYDREEEQGKIEDQEKEERLKK 590

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  250 bits (639), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/574 (28%), Positives = 276/574 (48%), Gaps = 45/574 (7%)

Query: 50  IDDNNNQYEIEKNEINNI-------------------KSDQF----NDKLNNQLQKTIQP 86
           +  N +++ +++ EI NI                   + D F          +L+K ++ 
Sbjct: 27  MKQNPDKFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETTRLRKDLKA 86

Query: 87  RHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTL 146
           RH+ MI+                L   GP  +LI Y  +   ++  +   GEMA +Y+ L
Sbjct: 87  RHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGEMA-SYIPL 145

Query: 147 IGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTI 204
             GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+YW   ++V+P V++TI
Sbjct: 146 -DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITI 204

Query: 205 FYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNN 264
           F ++I+AIN+ G  R + E EF+ +  K+++                     +G  YW +
Sbjct: 205 FLVVIVAINIVG-VRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRD 263

Query: 265 PGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
           PGAF+ ++        +F    S  V + FS+   E   I  SE  NPRK++P A K  +
Sbjct: 264 PGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPKAIKLTV 323

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSS--QTKASPYVIAVASHGIRIAPHFINAVI 377
           YR +  Y+ ++ ++G  V YN P LL +K       ASP+V+A+ + GI++ PH  N  +
Sbjct: 324 YRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPHIFNGCV 383

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           L+ V S  NS  Y SSR L  LA  G APKIF    + G P + ++ + L   +A+   S
Sbjct: 384 LVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCLAYMNVS 443

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
               ++F++ + +  +  + +W TI + +I F RA + QG   ++  Y +    +G+ +A
Sbjct: 444 AGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQRYGAYFA 503

Query: 498 ATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRA 556
                LI LI  F V L     +  +   F   Y+ +PI +  + GYK   K     ++ 
Sbjct: 504 LFFCILIALIKNFTVFL----GHTFDYKTFITGYIGLPIYVFSWVGYKLIYK--TKVVKP 557

Query: 557 KDIDLISHRHIYD--EDVLKQEKNQYKENL-KNG 587
            D DL + + IYD  E+  K +  + +E L +NG
Sbjct: 558 ADADLYTLKEIYDREEEQGKLQDQEKEERLQRNG 591

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 176/583 (30%), Positives = 296/583 (50%), Gaps = 42/583 (7%)

Query: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINN 66
           S  +D     + K  IV+N N    + SK +ENL           D +NQ +I   E ++
Sbjct: 2   SFIQDSYRKDLEK--IVSNSN----TTSKDVENL-----------DLSNQDDISSQE-SH 43

Query: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMA 126
           +  D  +D +  +L+K ++ RHV MI+               +L  AGP  +LI Y  + 
Sbjct: 44  LNIDGKHDGI--RLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVG 101

Query: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186
             +Y ++   GEMA  Y+ L  GF +Y S   D A  FAV + Y  ++L + P +L  A+
Sbjct: 102 FLVYIVMTCLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAA 159

Query: 187 MTIKYW--NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXX 244
           + ++YW   EKV+P V++TIF ++I+ IN+ G  + + E EF+ +  K+L+         
Sbjct: 160 LVLQYWVSREKVNPGVWITIFLVIIVTINVVG-VKFFGEFEFWLSSFKVLVMLCLIVLLF 218

Query: 245 XXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAI 299
                   +   +G  ++ +PGAFR ++        +F   V+  V A F++  TE   I
Sbjct: 219 VIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGI 278

Query: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK--SSQTKASPY 357
            A+E  NPR+ +P A K  +YR +  Y+ +I ++G  V YN P LL +K  S+   ASP+
Sbjct: 279 VAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPF 338

Query: 358 VIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGR 417
           V+A+ + GI + PH  NA +L+ V S  NS  Y +SR L  LA    APKIF   ++ G 
Sbjct: 339 VVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGV 398

Query: 418 PLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQG 477
           P   +I   L   +A+   S    +VF++ + +  +  + +W  I +++I F RA++ QG
Sbjct: 399 PYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQG 458

Query: 478 RSLNELGYKSQVGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPIL 536
              + L Y + +   G+ +A     LI LI  F V L     +  +  NF   Y+ +P+ 
Sbjct: 459 VDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVF 514

Query: 537 LLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579
           ++ +FGYK  +     F++ ++ DL + + + D   L++E+ +
Sbjct: 515 IICFFGYKYIRG--TKFVKPEEADLYTFKELID---LEEEEGK 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 169/571 (29%), Positives = 281/571 (49%), Gaps = 26/571 (4%)

Query: 33  HSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMI 92
            SKLI   +D +D  K    + N +E E +  +N  SD   D +  +L+K ++ RH+ MI
Sbjct: 9   DSKLIR--EDIIDLEKNTTSSLNSFEQEDD--SNKISDGKEDGV--RLKKELKARHISMI 62

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           +                L   GPA +LI Y  +   ++ ++   GEMA  Y+ L  GF +
Sbjct: 63  AIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTS 120

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTIFYLLII 210
           Y +   D A  FAV + Y  ++  + P +L   ++ I+YW   E V+P V++TIF ++I+
Sbjct: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180

Query: 211 AINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRG 270
            IN  G  R + E EF+ +  KI++                     +G  YW NPGAF+ 
Sbjct: 181 IINTVG-VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239

Query: 271 HTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFI 325
           ++        +F   V+  V A F++   E   I A+E  NPR+ IP A K  +YR +  
Sbjct: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299

Query: 326 YVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIAVASHGIRIAPHFINAVILISVLS 383
           Y+ +I ++G  V YN P LL +  + T A+  P+V+A+ + G+R  PH  N  +LI V S
Sbjct: 300 YIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFS 359

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
             NS  Y  +R L +LA  G APK+F   +R G P   +    L   +A+   S    ++
Sbjct: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQI 419

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFL 503
           F++ + +  +  + +W +I +++I F RA   Q    N   Y++    +G+    T+ F 
Sbjct: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFC 477

Query: 504 ILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
           +LI   ++  + +     +  +F   Y+ +P+ ++FYFGYK   K     ++A++ DL S
Sbjct: 478 VLIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYS 533

Query: 564 HRHIYDEDVL--KQEKNQYKENLKNGSLWLK 592
            +   D +    K ++ + KE LKN    LK
Sbjct: 534 FKEAIDREEAEGKIKEAEAKERLKNSKKSLK 564

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  249 bits (636), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 173/558 (31%), Positives = 277/558 (49%), Gaps = 36/558 (6%)

Query: 48  KKIDDNNNQYEIEKNEINNIKSDQFNDKLN----NQLQKTIQPRHVIMISXXXXXXXXXX 103
             +DD  N+ +   N++  + SD   + L     N L++ ++ RHV +I+          
Sbjct: 39  DSLDDRFNKKDSGLNKVLTVSSDTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLF 98

Query: 104 XXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYL-----TLIGGFNNYPSFLV 158
               +TLH  GPAGL I Y I++S IY I+ A GEM V YL        G   +     V
Sbjct: 99  VGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM-VCYLPGDGHDSAGSVTHLVKRYV 157

Query: 159 DTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGA 218
           D +  FA  W Y   ++ +   E   A+  ++YW   V    ++TIF  +I  +N+    
Sbjct: 158 DESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNM-SSV 216

Query: 219 RGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGH-TPGT-- 275
           + + E EF+F   KIL                  +   +G  YW NPGAF  H T G+  
Sbjct: 217 KYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGSLG 276

Query: 276 RFKGIVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVG 334
            F  I S ++  AF+F    E +A+T+SE S+ R+ I  A+K+ IYR +F Y+   + +G
Sbjct: 277 NFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIG 336

Query: 335 FLVPYNSPELLGSKSSQTK---ASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYS 391
            +V +N P L  + S+ T    +SP+VI + + GI + PH INA IL S  S  N+  ++
Sbjct: 337 VIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFA 396

Query: 392 SSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAIS 451
           SSR L T+A+ G APKIF  +++ G P   +I ++L++ +A+  +S     VF+WL  IS
Sbjct: 397 SSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNIS 456

Query: 452 GLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIY----AATVMFLILIG 507
            +S    W   C++++RFR+A+       N L  +     WG  Y    + TV+ +I I 
Sbjct: 457 TISGFLGWICACIAYLRFRKAI-----FYNNLYDRMPFKTWGQPYLILWSLTVVSIITIT 511

Query: 508 QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW---KKDWNLFIRA---KDIDL 561
             +    P      N+++F   Y+ +PI L  Y G+K +   K D+ L   A   +DID+
Sbjct: 512 NGYQTFIP---KFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDV 568

Query: 562 ISHRHIYDEDVLKQEKNQ 579
           I+     +    + ++N+
Sbjct: 569 ITGLDEIETKTCELDENR 586

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  248 bits (633), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/578 (29%), Positives = 287/578 (49%), Gaps = 37/578 (6%)

Query: 38  ENLKDFVDSFKKIDDNN---NQYEIEKNEINN-----IKSDQFNDKLN-------NQLQK 82
           +  +++ D  KK+D       + E+  +++ N       ++  ND  N        +L+K
Sbjct: 14  DRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKK 73

Query: 83  TIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVN 142
            ++ R V M++               +L  AGP  +LI Y  +   ++  + + GEMA +
Sbjct: 74  VLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMA-S 132

Query: 143 YLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDV 200
           Y+ L  GF +Y +   D A  FAV + Y  ++  + P +L  A++ I+YW   EKV+P V
Sbjct: 133 YIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGV 191

Query: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVS 260
           ++TIF ++I+AIN  G  + + E EF+ +  K+L+                     +G  
Sbjct: 192 WITIFLVVIVAINTLG-VQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFR 250

Query: 261 YWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 315
           +W +PGAF  ++P       +F   VS  V A F++  TE + I   E  NPRK++P A 
Sbjct: 251 HWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAI 310

Query: 316 KKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHGIRIAPHFI 373
           K  +YR +  Y+ SI+++G  V Y+ P LL +K+  T A  SP+V+A+ + GI++ PH  
Sbjct: 311 KLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIF 370

Query: 374 NAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAF 433
           NA +L+ V S  NS  Y +SR L +LA    APKIF   +R G P + +  + L   +A+
Sbjct: 371 NACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAY 430

Query: 434 CASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWG 493
            + S    ++F++ + +  +  + +W  I ++++ F RA++ QG   +   Y +    +G
Sbjct: 431 MSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYG 490

Query: 494 SIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNL 552
           + +A     LI LI  F V L     +  +   F   Y+ +P+  + YFGYK   K    
Sbjct: 491 AYFALFFCSLIALIKNFTVFL----GHQFDYKTFITGYIGIPVFFISYFGYKLIYK--TK 544

Query: 553 FIRAKDIDLISHRHIYD--EDVLKQEKNQYKENLK-NG 587
            I   ++DL + +   D  E+  K E    KE +K NG
Sbjct: 545 IIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANG 582

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  248 bits (632), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 171/573 (29%), Positives = 279/573 (48%), Gaps = 41/573 (7%)

Query: 45  DSFKKIDDNNNQYEIEKNEINNIKS---------------DQFNDKLNNQLQKTIQPRHV 89
           DS+ K D+    Y++E N+     +               D  +D    +L+K ++ RH+
Sbjct: 34  DSYFKKDNGTVAYDLEVNDQTRQNTLDDDASADSDGYNVMDGKDD--GTRLKKDLKARHI 91

Query: 90  IMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGG 149
            MI+                L  AGPA +LI Y  + + ++  + A GEMA  Y+ L  G
Sbjct: 92  SMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAA-YIPL-DG 149

Query: 150 FNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK--VDPDVFVTIFYL 207
           F +Y S   D A  FAV + Y  ++  + P +L  A++ I+YW ++  V+P V++TIF +
Sbjct: 150 FTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLV 209

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
           +IIAIN  G  + + E EF+ +  KI++                     +G  YW  PGA
Sbjct: 210 VIIAINTIG-VKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGA 268

Query: 268 FRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319
           F+ ++           +F   V+  V A F++   E   I A+E  NPR+ IP A K  +
Sbjct: 269 FKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTV 328

Query: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHGIRIAPHFINAVI 377
           +R LF YV +I ++G  V Y+ P LL + ++QT A  SP+V+A+ + G+ + PH  N  +
Sbjct: 329 WRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCV 388

Query: 378 LISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASS 437
           L+ V S  NS  Y  +R L +LA  G APKIF   +R G P   +    L   +A+   S
Sbjct: 389 LMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVS 448

Query: 438 PKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYA 497
               E+F++ + +  +  V +W +I ++ I F RA++ QG   +   Y +    +GS +A
Sbjct: 449 SGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFA 508

Query: 498 A-TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRA 556
               + L LI  F V L     N  +   F   Y+ +P+    + GYK + K     ++ 
Sbjct: 509 LFFCVLLALIKNFSVFL----GNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKT--VKP 562

Query: 557 KDIDLISHRHIYD--EDVLKQEKNQYKENLKNG 587
            + DL S++   D  E+  K ++ + KE LK+G
Sbjct: 563 HEADLNSYKAAVDREEEEGKIKEAERKERLKHG 595

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  245 bits (626), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 160/530 (30%), Positives = 264/530 (49%), Gaps = 15/530 (2%)

Query: 41  KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXX 100
           K   +  K++  N   Y    + + +  SD  +D  +N L+K +  RH+ +I+       
Sbjct: 13  KQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHN-LKKGLSNRHIQLIALGGCIGT 71

Query: 101 XXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDT 160
                  +TL   GPA L + +II+++ +YCI+    EM V YL   G      +  VD 
Sbjct: 72  GLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEM-VCYLPQQGSVPELVTRYVDP 130

Query: 161 AWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARG 220
           +  FA  W Y   +  +   EL  A+  ++YW ++V   V++TIF ++++ +N F   R 
Sbjct: 131 SLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLN-FSAVRF 189

Query: 221 YAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT---RF 277
           Y E+EF+F   KI+                      +G  YW NPGAF  H  G    RF
Sbjct: 190 YGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGNLGRF 249

Query: 278 KGIVSTLVTAAFSFGQT-EFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336
             + + ++ +AF+F  + E + +   E  + R+ I  A+++ IYR +F Y+ S +++G +
Sbjct: 250 LDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVI 309

Query: 337 VPYNSPELL---GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSS 393
           V  N   LL           +SP+V  +A+ GI +  H IN  IL S  S  NS FY+SS
Sbjct: 310 VAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASS 369

Query: 394 RMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGL 453
           R +L L+KQG APKIF+ ++R G P   +   SL+A +A+   S   ++VF WL  I  +
Sbjct: 370 RSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTI 429

Query: 454 SQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVAL 513
           S    W  I +++IRFR+A+ +  R L+ + Y+S +  + + +   V+ +I +   +V  
Sbjct: 430 SGFIGWFLIGVAYIRFRKAI-LFNRLLDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVF 488

Query: 514 WPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLIS 563
                   +  +F   Y+++PI L FY G+KT  K     I    ID+I+
Sbjct: 489 I---KGRWDYKDFLTSYISLPIFLAFYLGHKTIYKT-RFCIPVDQIDVIT 534

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  243 bits (620), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 163/536 (30%), Positives = 268/536 (50%), Gaps = 30/536 (5%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           +L+K +Q RHV MI+              + L  AGP  +LI Y IM   ++ ++   GE
Sbjct: 57  RLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGE 116

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196
           MA  Y+ L  GF +Y +   D A  FAV + Y  ++L + P +L  A++ ++YW    KV
Sbjct: 117 MAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
           +P V++T+F  +I+ IN+ G  + + E EF+ +  K+L+                 +   
Sbjct: 175 NPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNR 233

Query: 257 IGVSYWNNPGAFRGHT-----PGTR--FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
           +G  YW +PG F+ ++     PG +  F    S  V A F++  TE   I A+E  NPR+
Sbjct: 234 LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRR 293

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHGIR 367
            +P A K  +YR +  Y+ ++ ++G  V YN P LL +K ++T A  SPYV+A+ + GI 
Sbjct: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIP 353

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           + PH  NA +L  V S  NS  Y  SR L  LA    APKIF   +  G P   +   +L
Sbjct: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
              +A+   S     +FS+ + ++ +  + +W +I +++I F RA ++QG   N L Y++
Sbjct: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473

Query: 488 ---QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544
               V  W  I     + + L+  F V L     +  +   F   Y+ +P+ +L +  YK
Sbjct: 474 PFQPVTAW--IALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYK 527

Query: 545 -TWKKDWNLFIRAKDIDLISHRHIYD--EDVLKQEKNQYKENLK-NGSLWLKIYAF 596
              K  W   I++ ++DL +++   D  E+  K E  + KE  K +G  W + Y +
Sbjct: 528 IVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  244 bits (623), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 168/600 (28%), Positives = 286/600 (47%), Gaps = 41/600 (6%)

Query: 18  NKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYE--IEKNEINNIKSDQFN-D 74
           + NV+   E+  + S +   E  KD     +KI  N +       + E++  KS   + D
Sbjct: 97  DPNVVQVTESPSSGSRTHHYEAEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGD 156

Query: 75  KLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQ 134
              ++L++ +Q RHV +I+              +TLH  GPAGL I YII+++ IY I+ 
Sbjct: 157 AGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMC 216

Query: 135 ACGEMAV----NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIK 190
           A GEM      +     G   N  +  VD +  FA  W Y   ++ +   E   AS  ++
Sbjct: 217 ALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVE 276

Query: 191 YWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXX 250
           YW   V   V++TIF  +++ +N F   + Y E+EF+F   KIL                
Sbjct: 277 YWTTAVPKGVWITIFLCVVVLLN-FSAVKVYGESEFWFASIKILCIVGLIILSFILFWGG 335

Query: 251 XXTSGYIGVSYWNNPGAFRGHTPGT---RFKGIVSTLVTAAFSF-GQTEFLAITASEQSN 306
                 +G  YW +PG+F  H  G     F  I + ++  AF+F    E + +T++E ++
Sbjct: 336 GPKHDRLGFRYWQHPGSFAHHLAGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECAD 395

Query: 307 PRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL---LGSKSSQTKASPYVIAVAS 363
            R+ I  A+++ ++R +F YV   + +  +VPYN P L   L        +SPYVI + +
Sbjct: 396 QRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQN 455

Query: 364 HGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGII 423
            GI++ PH IN  IL S  S AN+  ++S+R LLT+A+ G APK    ++R G P   + 
Sbjct: 456 AGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVG 515

Query: 424 AASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNEL 483
            + L + +A+   S    +VF+W   IS +S    W   C++++RFR+A+   G   + L
Sbjct: 516 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRL 574

Query: 484 GYKS---QVGVWGSIYAATVM-----FLILIGQFWVALWPLNSNGANITNFFKEYLAMPI 535
            +K+      VW S+   +++     + I I ++W           N+ +F   Y+ +PI
Sbjct: 575 PFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYW-----------NVADFIAAYITLPI 623

Query: 536 LLLFYFGYKTWKKDWNLFIRA-KDIDLIS-----HRHIYDEDVLKQEKNQYKENLKNGSL 589
            L+ + G+K + + WN +  +  +ID+ +          D + L+     +KE   +  L
Sbjct: 624 FLVLWLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMDALL 683

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  240 bits (613), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/572 (27%), Positives = 277/572 (48%), Gaps = 31/572 (5%)

Query: 36  LIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN-NQLQKTIQPRHVIMISX 94
           +  +LK  ++      D  +Q E     +N ++S     K + N L+K +  RH+ +I+ 
Sbjct: 1   MTSDLKANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIAL 60

Query: 95  XXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYP 154
                        +TLHN GP  L + ++I++  +Y ++    EM + YL   G      
Sbjct: 61  GGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEM-ICYLPQQGTVPELT 119

Query: 155 SFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINL 214
           S  VD +  FA  W Y   +  +   EL  A+  ++YW +KV   V++TIF ++++ +N 
Sbjct: 120 SRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLN- 178

Query: 215 FGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPG 274
           F   + Y E+EF+F   KI+                  +   +G  YWNNPG F  H  G
Sbjct: 179 FAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITG 238

Query: 275 T---RFKGIVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSI 330
               RF  I + ++ + F+F    E + +   E  + R+ I  A+++ I+R +F Y+ S 
Sbjct: 239 GNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITST 298

Query: 331 IIVGFLVPYNSPEL---LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANS 387
           + +GF++  + P+L   L S +    +SP+V  +++ GI +  H INAVIL S  S ANS
Sbjct: 299 LCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANS 358

Query: 388 SFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWL 447
             Y+SSR +L LAKQG APK+FT ++R G P   +  ++ ++ + +  +S    +VF+WL
Sbjct: 359 FMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWL 418

Query: 448 LAISGLSQVFTWGTICLSHIRFRRAM-------KIQGRSLNELGYKSQVGVWGSIYAATV 500
             I  +S    W  I ++++RFR+A+       ++  +S  +  +     V+  +   T 
Sbjct: 419 SNICTISGFIGWALIGITYLRFRKAIFYNNLYERVPFKSALQPYFTYFFVVFVVLLCLTN 478

Query: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW-KKDWNLFIRAKDI 559
            +   I ++W           N ++F   Y+ +PI  L Y G+K W K  W  +I  ++I
Sbjct: 479 GYATFIPKYW-----------NASDFVAAYITLPIFFLLYLGHKIWFKTRW--YIPFREI 525

Query: 560 DLISHRHIYDEDVLKQEKNQYKENLKNGSLWL 591
           D+I+     +E+    +    K   +    WL
Sbjct: 526 DVITGLADAEEEAKMTQPRTPKNMWEKFMYWL 557

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  241 bits (616), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 142/418 (33%), Positives = 218/418 (52%), Gaps = 15/418 (3%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           ++++ ++ RH+ MI+                L NAGP G LI Y+ MA+ ++ + Q+ GE
Sbjct: 96  EVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGE 155

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198
           MA  ++ +   F  + S  +  A   A  ++Y   W     LEL      I++W   V  
Sbjct: 156 MA-TFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPL 214

Query: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIG 258
             ++ I+++++  +NLF   + Y E EF+    K+L                  T G +G
Sbjct: 215 SAWIVIWWVILTIMNLFP-VKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT-GPVG 272

Query: 259 VSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310
             YW NPG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPRK 
Sbjct: 273 FRYWRNPGPW---GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 329

Query: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370
           +P A KKV +R L  Y+ S+  +G LVPY+  E L S  S   ASP++IA+ + G +I P
Sbjct: 330 VPRAIKKVTFRILIFYILSLFFIGLLVPYDD-EKLTSTDSYISASPFIIAIENSGTKILP 388

Query: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430
           H  NAVIL +++S  NS+ Y  SR+L  LAK   APK F Y  R G P + +   S    
Sbjct: 389 HIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGA 448

Query: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488
           +AF   S    + F+WLL I  ++  F W  I ++H+RF +A+K +G S ++L +K++
Sbjct: 449 LAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKAR 506

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  242 bits (618), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 168/563 (29%), Positives = 278/563 (49%), Gaps = 31/563 (5%)

Query: 25  NENQINESHSKLIENLKDFVD-SFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKT 83
            +N    + SKL  N++   D S K + D+ +  ++  +EI + K +        +L+K 
Sbjct: 17  GDNAKEVTASKLALNIEVQSDQSSKSLCDSAS--DVLASEIGDGKYEGI------RLKKQ 68

Query: 84  IQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143
           ++ RH+ MI+               +L  AGP   LI Y  +   ++  +   GEMA   
Sbjct: 69  LKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMAT-- 126

Query: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVF 201
              + GF +Y S   D A  FAV + Y I++  + P +L  A+M ++YW   + V+P ++
Sbjct: 127 FIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIW 186

Query: 202 VTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSY 261
           VT+ + +I  IN+FG  R + E EF+ +  K+L+                 +   +G  Y
Sbjct: 187 VTLVFAVITVINIFG-VRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRY 245

Query: 262 WNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 316
           W +PGAF  ++        +F   V+ LV   F++   E   I A+E SNPR+++P A K
Sbjct: 246 WKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIK 305

Query: 317 KVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAV 376
              YR L  YV SI ++G  VPYN  +L+ +  +   ASP+ IA+ + GI + P   N  
Sbjct: 306 LTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLPDIFNGC 365

Query: 377 ILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCAS 436
           +LI V S ANS  Y +SR L +LA    APKIF + +R G P   +  + L   +A+   
Sbjct: 366 LLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTV 425

Query: 437 SPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIY 496
           S    +VF + + +  ++ + TW +I +++I F RA++ Q    +   Y +    +G+  
Sbjct: 426 SSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYV 485

Query: 497 AATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK-TWKKDWNLFI 554
           +     LI +I  F V L   +        F   Y+ +PI +L YFGYK T K +    I
Sbjct: 486 SLFFCCLIAIIKNFTVFLGHFDYK-----TFITGYIGLPIFVLCYFGYKITCKSE----I 536

Query: 555 R-AKDIDLISHRHIYDEDVLKQE 576
           R A+ +DL+S + + D + ++ E
Sbjct: 537 RSARYVDLVSQKSLVDREQVEYE 559

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  239 bits (611), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 160/545 (29%), Positives = 269/545 (49%), Gaps = 37/545 (6%)

Query: 60  EKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
           E +  N   +   + KL  +LQ+ +  RH+ +I+              +TLH  GPAGL 
Sbjct: 36  EGSSTNRGINGNKDAKLEGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLF 95

Query: 120 IGYIIMASCIYCIIQACGEMAVNYL-----TLIGGFNNYPSFLVDTAWNFAVAWVYCIQW 174
           I Y+I+++ +Y I+ A GEM V YL        G  ++     VD + +FA  W Y   +
Sbjct: 96  ISYVIISTVLYPIMNAFGEM-VCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCY 154

Query: 175 LCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL 234
           + +   E   AS  +KYW + V    ++TIF  +++ +NL    + Y E EF+F   K+L
Sbjct: 155 VILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCA-VKYYGETEFWFASIKVL 213

Query: 235 MXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTR---FKGIVSTLVTAAFSF 291
                                 +G  YW NPG F  H  G     F  + S ++  AF+F
Sbjct: 214 CIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGGNLGNFLDVYSGIIKGAFAF 273

Query: 292 -GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL---LGS 347
               E +A+ +SE  + R+ I  A+K+ ++R +F Y+   + +  +V  N P L   L S
Sbjct: 274 ILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALAS 333

Query: 348 KSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPK 407
                 +SP+VI + + GI+I PH INA IL S  S  N+  ++SSR LLT+A  G APK
Sbjct: 334 GKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPK 393

Query: 408 IFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHI 467
           IF  ++R G P   +  ++L++ +A+   S    +VF+W   IS +S    W    ++++
Sbjct: 394 IFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYL 453

Query: 468 RFRRAMKIQGRSLNELGYK---SQVGVWGSIYAATVM-----FLILIGQFWVALWPLNSN 519
           RFR+A+K  G   N L Y     Q  VW SI   T++     + + I +FW         
Sbjct: 454 RFRKAIKYNGLE-NRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFW--------- 503

Query: 520 GANITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDE--DVLKQE 576
             N+++F   Y+ +P+ ++ + G+K + +D+   +   ++ID+++     +E   +L +E
Sbjct: 504 --NVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVTGLTEIEERTRILDEE 561

Query: 577 KNQYK 581
           + + K
Sbjct: 562 RVEPK 566

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  239 bits (610), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 150/501 (29%), Positives = 250/501 (49%), Gaps = 19/501 (3%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           +L+K ++ RHV MI+              ++L +AGP  +LI Y  +   +Y ++   GE
Sbjct: 49  RLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGE 108

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196
           MA      + GF +Y S  VD A  FAV + Y  ++  V P +L   +M +++W   ++V
Sbjct: 109 MAA--FIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
           +P V++TIF  LI+ IN  G  R + E EF+ +  K+L+                     
Sbjct: 167 NPGVWITIFLALIVLINTVG-VRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDR 225

Query: 257 IGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311
            G  +W +PGAF+ ++        +F    S    A F++  TE   I A+E  NPR+++
Sbjct: 226 TGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSV 285

Query: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHGIRIA 369
           P A K  +YR +  YV +I+++G  V YN P LL +K   T A  SP+V+A+ +  I + 
Sbjct: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVL 345

Query: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429
           PH  N  +L+ V S  NS  Y +SR L  LA  G AP+IF   ++ G P + +  + L  
Sbjct: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405

Query: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489
            +A+   S    +VF++ + +  +  + +W TI +++IRF +A+++Q    + L Y +  
Sbjct: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465

Query: 490 GVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
             W +  A     LI LI  + V L     +  +   F   Y+ +P+ L+ Y GYK   +
Sbjct: 466 QPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521

Query: 549 DWNLFIRAKDIDLISHRHIYD 569
                I+ +D+DL + +   D
Sbjct: 522 --TKLIKPEDVDLYTFKDAID 540

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  239 bits (609), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 164/572 (28%), Positives = 277/572 (48%), Gaps = 46/572 (8%)

Query: 25  NENQINESHSKLI------ENLKDFVDSFKKIDDNNNQYE---IEKNEINNIKSDQF--- 72
           N  Q+ ES S  +      +N KD     +KI  N++      I ++ I ++  ++    
Sbjct: 42  NVVQVTESLSSGLRRNHPYDNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPSV 101

Query: 73  -NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYC 131
             D   ++L++ +Q RHV +I+              +TLH  GPAGL I YII+++ IY 
Sbjct: 102 EGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 161

Query: 132 IIQACGEMAV----NYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASM 187
           I+ A GEM      +     G   N  +  VD +  FA  W Y   ++ +   E   AS 
Sbjct: 162 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 221

Query: 188 TIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXX 247
            ++YW   V   V++TIF  +++ +NL    + Y E+EF+F   KIL             
Sbjct: 222 VVEYWTTAVPKGVWITIFLCVVVLLNL-SAVKVYGESEFWFASIKILCIVGLIILSFILF 280

Query: 248 XXXXXTSGYIGVSYWNNPGAFRGHTPGT---RFKGIVSTLVTAAFSF-GQTEFLAITASE 303
                    +G  YW +PGAF  H  G     F  I + ++  AF+F    E + +T++E
Sbjct: 281 WGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAE 340

Query: 304 QSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL---LGSKSSQTKASPYVIA 360
            ++ R+ I  A+++ ++R +F YV   + +  +VPYN P L   L        +SP+VI 
Sbjct: 341 CADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIG 400

Query: 361 VASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLF 420
           + + GI++ PH IN  IL S  S AN+  ++S+R LLT+A+ G APK    ++R G P  
Sbjct: 401 IQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYV 460

Query: 421 GIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSL 480
            +  + L + +A+   S    +VF+W   IS +S    W   C++++RFR+A+   G   
Sbjct: 461 AVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-F 519

Query: 481 NELGYKS---QVGVWGSIYAATVMFL-----ILIGQFWVALWPLNSNGANITNFFKEYLA 532
           + L +K+      VW S+    ++ L     I I ++W            I +F   Y+ 
Sbjct: 520 DRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYW-----------KIADFIAAYIT 568

Query: 533 MPILLLFYFGYKTWKKDWN-LFIRAKDIDLIS 563
           +PI L+ +FG+K + + W+  ++   +ID+ +
Sbjct: 569 LPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTT 600

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  237 bits (604), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 156/526 (29%), Positives = 259/526 (49%), Gaps = 29/526 (5%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           +L+K ++ RHV MI+              ++L +AGPA +LI Y  +   +Y ++   GE
Sbjct: 50  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGE 109

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196
           MA      + GF +Y S  VD A  FAV + Y  ++  V P +L   +M ++YW   EKV
Sbjct: 110 MAA--FIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
           +P V++TIF +LI+ IN  G  R + E EF+ +  K+L+                     
Sbjct: 168 NPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDR 226

Query: 257 IGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311
            G  YW +PGAF+ ++        +F    S    A F++  TE   I A+E  NPR+++
Sbjct: 227 TGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSV 286

Query: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK--SSQTKASPYVIAVASHGIRIA 369
           P A K  +YR +  YV SI+++G  V YN P L+ +K  S+   ASP+V+A+ + GI + 
Sbjct: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVL 346

Query: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429
           PH  NA +L+ V S  NS  Y +SR L  LA    APKIF   +  G P + +  + L  
Sbjct: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406

Query: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489
            +A+   S    ++F++ + +  +  + +W +I ++++RF +A+  Q    +   Y +  
Sbjct: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466

Query: 490 GVWGSIYAATVMFLILIG---QFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW 546
             W +    ++ F  LIG    + V L     +  +   F   Y+ +P+  + Y GYK  
Sbjct: 467 QPWST--WVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLV 520

Query: 547 KKDWNLFIRAKDIDLISHRHIYDE------DVLKQEKNQYKENLKN 586
            +  +  I+ +D+DL + +   D        +  + K Q K + KN
Sbjct: 521 HR--SKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKN 564

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  237 bits (605), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 170/584 (29%), Positives = 280/584 (47%), Gaps = 39/584 (6%)

Query: 30  NESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKS--------DQFNDKLNN--Q 79
           N ++SK      +  D  K+ D      ++E+N I+   S        D F+D      +
Sbjct: 9   NSNNSKF-----EMTDLQKQSDQVTISSDLEQNSISIASSRNSSIGDRDIFDDGKTEGFR 63

Query: 80  LQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEM 139
           L+K ++ RHV MI+               +L  AGP  L I Y  +   ++  +   GEM
Sbjct: 64  LKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEM 123

Query: 140 AVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK--VD 197
           A      + GF +Y S  VD A  FAV + Y  ++L +   +L   +M ++YW ++  ++
Sbjct: 124 AA--FIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLN 181

Query: 198 PDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYI 257
           P VF+TIF +LI+ IN+FG  + + E EF+ +  K+L+                     +
Sbjct: 182 PGVFITIFLILIVTINIFG-VKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRL 240

Query: 258 GVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309
           G  YW +PG+F+ ++           +F    S  V A F +   E   I A+E  NPRK
Sbjct: 241 GFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRK 300

Query: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS--KSSQTKASPYVIAVASHGIR 367
            IP A K  +YR +  YV +I+++   V YN P LL +  +S+   ASP+V+A+ + GI 
Sbjct: 301 NIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGIN 360

Query: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427
           I PH  N  +L  VLS ANS  Y +SR L +LA    APK F   ++ G P + +  ++ 
Sbjct: 361 ILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTA 420

Query: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487
            + +A+   S   + VF++ +    +  V +W  I +++I F +A K QG   +   Y +
Sbjct: 421 FSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVA 480

Query: 488 QVGVWGSIYAA-TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW 546
               +G+ +A      L L+  F V L        +  NF   Y+ +P+  + + GYK  
Sbjct: 481 PWQPYGAYFALFFCCVLALVKNFTVFL----GGQFDYKNFITGYIGIPVFFICFVGYKIV 536

Query: 547 KKDWNLFIRAKDIDLISHRHIYD--EDVLKQEKNQYKENLKNGS 588
            K      R +++DL++ + + D  E+  K E  + +E LKNG+
Sbjct: 537 YKTKTH--RPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGN 578

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 177/571 (30%), Positives = 284/571 (49%), Gaps = 33/571 (5%)

Query: 44  VDSFKKIDDNNN------QYEIEKNEINNIKSD----QFNDKLNNQ-LQKTIQPRHVIMI 92
           V SF    DN +      Q +IEK    ++  D    QF+ K ++Q L+K ++ RHV MI
Sbjct: 15  VPSFSNHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMI 74

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNN 152
           +               +L  AGP  +LI Y  +   ++ ++   GEMA  Y+ L  GF +
Sbjct: 75  AIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAA-YIPL-DGFTS 132

Query: 153 YPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTIFYLLII 210
           Y S   D A  FAV + Y +++  + P +L  A++ I+YW   EKV+P V++TI  ++I+
Sbjct: 133 YASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIV 192

Query: 211 AINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRG 270
            IN FG  + + E EF+ +  K+++                 T   +G  YW +PGAF+ 
Sbjct: 193 VINTFG-VKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKE 251

Query: 271 HTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFI 325
           ++        RF   VS  V   F +   E   I A+E  NPRK IP A K  ++R +  
Sbjct: 252 YSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIF 311

Query: 326 YVGSIIIVGFLVPYNSPELLGSKSSQTKA--SPYVIAVASHGIRIAPHFINAVILISVLS 383
           Y+ +I ++G  V  N P LL +K+  T A  SP+V+A+ + GI   PH  NA +L+ V S
Sbjct: 312 YIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFS 371

Query: 384 VANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEV 443
             NS  Y +SR L +LA    APKIF   +R G P   +  A L   +A+ + S    ++
Sbjct: 372 ACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKI 431

Query: 444 FSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA-TVMF 502
           F++ + +  ++ V TW +I +++I F RA++ QG   +   Y + +  +G+ ++      
Sbjct: 432 FNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCL 491

Query: 503 LILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLI 562
           L LI  F V L    ++  +  NF   Y+ +P+  + YFGYK  KK      + +++DL 
Sbjct: 492 LALIKNFTVFL----NHKFDYRNFITGYIGLPLFFICYFGYKFVKK--TKIRKPEEVDLF 545

Query: 563 SHRHIYD---EDVLKQEKNQYKENLKNGSLW 590
           S +   D   ED   ++    +   KNG  W
Sbjct: 546 SFKAAIDQEEEDGRIKDAATAERIKKNGKNW 576

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  236 bits (601), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 172/614 (28%), Positives = 292/614 (47%), Gaps = 51/614 (8%)

Query: 3   SLSPSITKDGLHLSVNKN---VIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYE- 58
           + +  ++ DG      K    V VT        ++   +N KD     +KI  N +    
Sbjct: 19  TCADDVSGDGSGGDTKKEEDVVQVTESPSSGSRNNHRSDNEKDDAIRMEKISKNQSASSN 78

Query: 59  --IEKNEINNIKSDQF----NDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHN 112
             I ++ I ++  ++      D   ++L++ +Q RHV +I+              +TLH 
Sbjct: 79  GTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHT 138

Query: 113 AGPAGLLIGYIIMASCIYCIIQACGEMAV----NYLTLIGGFNNYPSFLVDTAWNFAVAW 168
            GPAGL I YII+++ IY I+ A GEM      +     G   N  +  VD +  FA  W
Sbjct: 139 CGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGW 198

Query: 169 VYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFF 228
            Y   ++ +   E   AS  ++YW   V   V++TIF  +++ +N F   + Y E+EF+F
Sbjct: 199 NYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILN-FSAVKVYGESEFWF 257

Query: 229 NLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT---RFKGIVSTLV 285
              KIL                      +G  YW +PGAF  H  G     F  I + ++
Sbjct: 258 ASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGII 317

Query: 286 TAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344
             AF+F    E + +T++E ++ R+ I  A+++ ++R +F YV   + +  +VPYN P L
Sbjct: 318 KGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTL 377

Query: 345 ---LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAK 401
              L        +SP+VI + + GI++ PH IN  IL S  S AN+  ++S+R LLT+A+
Sbjct: 378 VNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQ 437

Query: 402 QGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGT 461
            G APK    +++ G P   +  + L + +A+   S    +VF+W   IS +S    W  
Sbjct: 438 TGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMC 497

Query: 462 ICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMF-LILIGQFWVALWPLNSNG 520
            C++++RFR+A+   G   + L +K+    WG  Y  TV F LI+IG   +      +NG
Sbjct: 498 GCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPY--TVWFSLIVIGIITI------TNG 544

Query: 521 A--------NITNFFKEYLAMPILLLFYFGYKTWKKDW-NLFIRAKDIDLISHRHIYDED 571
                     + +F   Y+ +PI L+ +FG+K + + W   ++   +ID+ +        
Sbjct: 545 YAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGL------ 598

Query: 572 VLKQEKNQYKENLK 585
           V  +EK++  E ++
Sbjct: 599 VEIEEKSREIEEMR 612

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  232 bits (591), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 259/533 (48%), Gaps = 27/533 (5%)

Query: 79  QLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138
           +L+K +Q RHV MI+              ++L  AGP  +LI Y IM   ++ ++   GE
Sbjct: 58  RLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGE 117

Query: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196
           MA  Y+ L  GF +Y +   D A  FAV W Y  ++L + P +L   ++ I++W    +V
Sbjct: 118 MAA-YIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARV 175

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
            P V++T+   +I+ IN  G  R + E EF+ +  K+L+                 T   
Sbjct: 176 SPGVWITVVLAVIVVINTVG-VRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDR 234

Query: 257 IGVSYWNNPGAFR------GHTPGT--RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308
           +G  YW++PGAF+       H  G   +F   +S  V A F++  TE   I A+E  +PR
Sbjct: 235 LGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPR 294

Query: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL--GSKSSQTKASPYVIAVASHGI 366
           + +P A K  +YR +  Y+ +I ++G  V YN P L+   S      ASPYV+A+ +  I
Sbjct: 295 RNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVI 354

Query: 367 RIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAAS 426
            + P+  NA +L  V S  NS  Y  SR L  LA  G APK+F   ++ G P   +   +
Sbjct: 355 PVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCT 414

Query: 427 LLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYK 486
           L   +A+ + S      F + + ++ +  + +W +I +++I F RA + QG   + L Y 
Sbjct: 415 LFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYV 474

Query: 487 SQVGVW-GSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK- 544
           +    + G +     +F+ LI  F   +        ++  F   Y+ +PI +  + GYK 
Sbjct: 475 APCQPYAGWVALIFCIFVALIKNFDAFI----GKEVDVPTFITGYIGLPIYIFCFIGYKI 530

Query: 545 TWKKDWNLFIRAKDIDLISHRHIYD--EDVLKQEKNQYKENLKNGSL-WLKIY 594
             K  W   I +K++DL + +   D  E+   +E+   KE L  G L W KIY
Sbjct: 531 VHKTKW---IPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIY 580

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 154/525 (29%), Positives = 253/525 (48%), Gaps = 38/525 (7%)

Query: 45  DSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXX 104
           + F K+  + + + +  +      S  + D   ++L++ ++ RHV +I+           
Sbjct: 42  EKFGKMPGDVDVFSLSSS--TEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFV 99

Query: 105 XXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIG----GFNNY-PSFLVD 159
              +TLH  GPAGL I Y I++S IY I+Q  GEM V YL   G    GF  Y     VD
Sbjct: 100 GTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGEM-VCYLPGSGSKPEGFAAYLVGKYVD 158

Query: 160 TAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGAR 219
            +  FA AW Y   ++ +   E   AS  ++YW   V    ++TIF   ++ +N F   +
Sbjct: 159 ESLGFADAWNYYYCYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILN-FTAVK 217

Query: 220 GYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKG 279
            Y E+EF+F   KIL                      +G  YW NPG F  H  G  F  
Sbjct: 218 FYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGS 277

Query: 280 ---IVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGF 335
              I + ++   F+F    E +A+T+SE  + R+ I  AA++ ++R +F Y+   + +  
Sbjct: 278 FLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISV 337

Query: 336 LVPYNSPEL---LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSS 392
           +V YN P L   L        +SP+VI + + GI++ PH INA IL S  S  N+  ++S
Sbjct: 338 IVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTS 397

Query: 393 SRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISG 452
           SR LLT+A+ G AP+IF  ++R G P + +  +S ++ +A+   S    +VF+W   IS 
Sbjct: 398 SRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISV 457

Query: 453 LSQVFTWGTICLSHIRFRRAMKIQG---------RSLNELGYKSQVGVWGSIYAATVMFL 503
           +S    W  +C+++IRF +A+   G         R +  L Y   + +  SI   T  + 
Sbjct: 458 ISGFIGWICVCIAYIRFHKAILFHGMQSRLPYTARGMPYLIYWPLLVI--SIITLTNGYE 515

Query: 504 ILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548
           + I +FW A            NF   Y+ +P+  + + G++ +++
Sbjct: 516 VFIPRFWDA-----------KNFVAAYITLPVFWVLWIGHRVYRR 549

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  230 bits (586), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 160/574 (27%), Positives = 278/574 (48%), Gaps = 25/574 (4%)

Query: 37  IENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFND----KLNNQLQKTIQPRHVIMI 92
           +++LKD  ++          YEI+    + I   + +     + ++ L+K ++ RH+ +I
Sbjct: 4   LQDLKDAGETTVTDKQTGQVYEIDIESYSQISGPKVSSSDAPQGDHTLKKGLKSRHIQLI 63

Query: 93  SXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYL-----TLI 147
           +              +TLH  GPAGL   Y I++  IY ++ A GEM V YL     +  
Sbjct: 64  ALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEM-VCYLPGDGSSSG 122

Query: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207
           G  +   +  VD +  FA  W Y   ++ +   E   AS  ++YW   V    ++TIF  
Sbjct: 123 GSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFLG 182

Query: 208 LIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGA 267
           +++ +N F   + Y E+EF+F   KIL                      +G  YW  PGA
Sbjct: 183 VVVLLN-FCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGA 241

Query: 268 FRGH-TPGT--RFKGIVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323
           F  H T G   RF  I + ++   F+F    E +A+T++E  + R+ I  A+++ +YR +
Sbjct: 242 FAYHITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLI 301

Query: 324 FIYVGSIIIVGFLVPYNSPEL---LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380
           F YV S + +G +V YN   L   L        +SP+VI + + GI++ PH IN  IL S
Sbjct: 302 FFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSS 361

Query: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440
             S  NS  +++SR LL+++++G+APKI   ++R G P   +   SLL+ IA+   S   
Sbjct: 362 AWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSST 421

Query: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500
            +VF+W   IS +S    W  I ++++RFR+A+  Q      + +K+    +G+ +    
Sbjct: 422 ADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQ-NLYERVPFKTPFQPYGTWFFIIA 480

Query: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLF-IRAKDI 559
           + +I +   +    P N    N+++F   Y+ +PI L+ + G+K W + W  + I   +I
Sbjct: 481 VSVICLTNGYAIFIPAN---WNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEI 537

Query: 560 DLISHRHIYDEDVLKQEKNQYKENLKNGSL--WL 591
           D+ +     +E+  + ++ +       G    WL
Sbjct: 538 DVTTGLKEIEEESKECDEKRIVPTTAGGKFMEWL 571

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  230 bits (586), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 148/486 (30%), Positives = 251/486 (51%), Gaps = 20/486 (4%)

Query: 77  NNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYIIMASCIYCIIQAC 136
           + ++++ ++ RH+ MI+                L NAGP G LI Y+ MA+ ++ + Q+ 
Sbjct: 86  DAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145

Query: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196
           GEMA  ++ +   F  + S  +  +   A  ++Y   W     LEL      I++W + V
Sbjct: 146 GEMA-TFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204

Query: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXXXXXXXXXXXXXTSGY 256
               ++ I++ ++  +N+F   + Y E EF+    K++                  T G 
Sbjct: 205 PLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GP 262

Query: 257 IGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311
           +G  YW NPG +            RF G VS+L+ AAF++  TE + ITA E +NPRK +
Sbjct: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322

Query: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPH 371
           P A KKV +R L  Y+ S+  +G LVP++ P+L  S  S   +SP++IA+ + G ++ PH
Sbjct: 323 PRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLS-SDDSYVSSSPFIIAIQNSGTKVLPH 381

Query: 372 FINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATI 431
             NAVIL +++S  NS+ Y  SR++  LAK   AP+ F    + G P   ++  S    +
Sbjct: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441

Query: 432 AFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGV 491
           AF   S    + F+WLL I G++  F W  I ++H+RF + ++ +G S ++L +K+ +  
Sbjct: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501

Query: 492 WGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWN 551
           W + YA   M +I+I Q + A  P   NG   ++F   Y++   + LF+F + +++    
Sbjct: 502 WLAYYAIFFMIIIIIIQGFTAFAP-TFNG---SDFVAAYIS---VFLFFFLWVSFQ---- 550

Query: 552 LFIRAK 557
           L+ R K
Sbjct: 551 LYFRCK 556

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  230 bits (586), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 163/522 (31%), Positives = 255/522 (48%), Gaps = 30/522 (5%)

Query: 60  EKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLL 119
           EK    +  +D F ++    LQ+ ++ RH+ MI+              +TL   GPAGL 
Sbjct: 59  EKLGDGDGDADPFANE--GSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLF 116

Query: 120 IGYIIMASCIYCIIQACGEMAVNYL-----TLIGGFNNYPSFLVDTAWNFAVAWVYCIQW 174
           I YII++S +Y I+   GEM V YL        G   +  +  VD +  FA AW Y   +
Sbjct: 117 ISYIIISSVVYPIMCGFGEM-VCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCY 175

Query: 175 LCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKIL 234
           + +   E   AS  ++YW   V   V++ IF  +++ +N FG  + Y EAEF+F   KIL
Sbjct: 176 IILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILN-FGPVKYYGEAEFWFASIKIL 234

Query: 235 MXXXXXXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGT---RFKGIVSTLVTAAFSF 291
                                 +G  YW  PGAF  H       RF  I S ++   F+F
Sbjct: 235 CIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMKGGFGRFLDIYSGVIKGGFAF 294

Query: 292 -GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL---LGS 347
               E + +T++E  + R+ I  AA++ I+R +F YV   + +  +V YN P L   L S
Sbjct: 295 ILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALAS 354

Query: 348 KSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPK 407
                 +SP+VI + + GIR+ PH INA IL S  S  N+  ++S+R LLT+A+ G AP+
Sbjct: 355 GKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPR 414

Query: 408 IFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHI 467
           +F  ++R G P   I  +  L+ +AF   S    +VF+W   IS +S    W   C+++I
Sbjct: 415 VFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYI 474

Query: 468 RFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT----VMFLILIGQFWVALWPLNSNGANI 523
           RFR+A+   G   + L +K+    WG  YA      V+ LI +   +    P N  G   
Sbjct: 475 RFRKAIFFNGM-YDRLPFKT----WGQPYAVYYSLFVISLITLTNGYATFIPKNWKG--- 526

Query: 524 TNFFKEYLAMPILLLFYFGYKTWKKDWN--LFIRAKDIDLIS 563
           ++F   Y+ +PI ++ + G+K W + +    + R   ID+ +
Sbjct: 527 SDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTT 568

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  229 bits (585), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 162/587 (27%), Positives = 280/587 (47%), Gaps = 38/587 (6%)

Query: 2   SSLSPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNN-NQYEIE 60
           S++  S  +D   L   +    T  +Q++ S  K  E  +  V S ++ +    + + ++
Sbjct: 43  SAIKESTQRDHPGLHKTRTTCFTIVSQMSVSGKK--EAFELNVTSLEEGETATIDDFVLQ 100

Query: 61  KNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLI 120
             +    +S    +++    ++ + PR V MI                 +   GP  LLI
Sbjct: 101 NRDSPKSQSLSLEERIA---RRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLI 157

Query: 121 GYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCI-QWLCVCP 179
            + +  S ++  +  C  + V YL + G F ++    VD +  FAV W Y + Q   VC 
Sbjct: 158 AFCLW-SVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVC- 215

Query: 180 LELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXX 239
            E+    + ++YW +K+     +++  +L  ++NL+     + E EF+ ++ K+++    
Sbjct: 216 FEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYS-VFFFGEGEFYLSIGKVVLAIGL 274

Query: 240 XXXXXXXXXXXXXTSGYIGVSYWNNPGAFRGH-TPGT--RFKGIVSTLVTAAFSFGQTEF 296
                            +G   W+NPGAF  + + G+  RF G +S LV A + F   ++
Sbjct: 275 IIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVFWGVDY 334

Query: 297 LAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGS---KSSQTK 353
           L   ASE  NPRK IPS+ +KV  R +  Y+G  I VG L+PYN P ++ +    +    
Sbjct: 335 LGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAG 394

Query: 354 ASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLD 413
           ASPYV A+ + GIR+ PH +N +IL S++S  NSS YS+SR+L  LA    AP+IF    
Sbjct: 395 ASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTT 454

Query: 414 RKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAM 473
           +KG P++  IA  ++  +A+ + S     V +W L +   +    +  IC+S+++FR+  
Sbjct: 455 KKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGC 514

Query: 474 KIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANI--------TN 525
             Q   L  L Y          Y++++ +L     FW+ L  L  NG  +         +
Sbjct: 515 LAQNVDLKSLPY----------YSSSLPYLAWHSLFWLVLMLL-VNGYTVFLKGSWDTQS 563

Query: 526 FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISH-RHIYDED 571
           F   Y  +P  L+F FG+K +K   +  +R  ++DL +    + DED
Sbjct: 564 FVFSYFMIPFFLVFLFGHKLYKGTKS--VRPLEMDLFTGIEELADED 608

>Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)
          Length = 348

 Score =  220 bits (561), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 192/341 (56%), Gaps = 20/341 (5%)

Query: 5   SPSITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEI 64
           + SI+++      + N  +T+E  +N + ++   + K F    +++D N    + EK  I
Sbjct: 25  TESISQEPFSTFSSDNNELTSEGGLNNTWTRFKNSFKRF--ELEELDPNLT--DAEKIAI 80

Query: 65  NNIKSDQFNDKLNNQLQKTIQPRHVIMISXXXXXXXXXXXXXXATLHNAGPAGLLIGYII 124
              +S          L+ T++ RH+ MI+                L  AGPAG+LIG+ +
Sbjct: 81  ATARS---------PLKHTLKKRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTV 131

Query: 125 MASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVT 184
             S IYC++ A GE+AV +  + GGF  Y +  +D ++ FAV + Y +QWL   PLE+V 
Sbjct: 132 TGSMIYCMVMAVGELAVIF-PVSGGFTTYATRFIDESFGFAVNFNYMLQWLVTLPLEIVA 190

Query: 185 ASMTIKYWNEKVDP---DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMXXXXXX 241
           AS+T+ YW   VDP   D FV +F+++I++INLFG  +GY EAEF F + K++       
Sbjct: 191 ASITVNYWG--VDPKYRDGFVALFWVVIVSINLFG-VKGYGEAEFIFAVIKVITIIGFII 247

Query: 242 XXXXXXXXXXXTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITA 301
                        G+IG  YW+NPGAF G TPG +FKG  +  +TA+FSFG +E + I  
Sbjct: 248 MAVVLVCGGGPQGGFIGAKYWHNPGAFVGATPGLKFKGFCTVFITASFSFGGSEVVGIAG 307

Query: 302 SEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSP 342
           SE  NPRK++P AAK+V +R +  YV  ++++G LVPYN P
Sbjct: 308 SEAENPRKSVPGAAKQVFWRIILFYVICLLLIGMLVPYNDP 348

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,951,606
Number of extensions: 2568844
Number of successful extensions: 18714
Number of sequences better than 10.0: 453
Number of HSP's gapped: 17758
Number of HSP's successfully gapped: 483
Length of query: 598
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 483
Effective length of database: 40,294,809
Effective search space: 19462392747
Effective search space used: 19462392747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 69 (31.2 bits)