Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D00510na 1ON61761731880.0
KAFR0D005001.50ON61761424490.0
KAFR0D00520na 2ON59857820930.0
Smik_3.531.50ON63363220250.0
NDAI0A006401.50ON64162920240.0
Suva_3.1891.50ON63363220190.0
NCAS0B085801.50ON62760620170.0
YCL025C (AGP1)1.50ON63363220120.0
Skud_3.381.50ON63363220030.0
KAFR0D04120na 2ON64863720000.0
Skud_4.7841.50ON66363419960.0
Suva_2.6881.50ON66163619860.0
Kpol_2000.921.50ON63763519720.0
Smik_4.7901.50ON66363419740.0
YDR508C (GNP1)1.50ON66363419740.0
NDAI0F043901.50ON66761819720.0
KNAG0C005901.50ON63462419530.0
CAGL0K05753g1.50ON66063019540.0
TBLA0A051801.50ON67653919530.0
NCAS0A004201.50ON67963719450.0
CAGL0B01012g1.50ON62362719370.0
TPHA0E036601.50ON64764219160.0
TDEL0C065101.50ON64261019100.0
KAFR0D041401.50ON63757719010.0
SAKL0C01232gsingletonON61360918840.0
TPHA0B047501.50ON63963618790.0
SAKL0C01650g1.50ON61359318710.0
TBLA0A05190na 2ON66759418760.0
KAFR0D04130na 1ON64463618390.0
Kpol_2002.441.50ON62762617520.0
KLLA0C01606g1.50ON62062417230.0
KLTH0F01584g1.50ON59661617190.0
Kwal_33.132041.50ON60759917140.0
KNAG0F002701.50ON63461117100.0
AFR698C1.50ON60960116870.0
Ecym_10561.50ON60661416830.0
KLTH0F01606gna 2ON60459416590.0
ZYRO0F17446g1.50ON63363216610.0
Kwal_33.13215na 2ON59859615830.0
Smik_4.2843.284ON60462115570.0
Ecym_26643.285ON57557015480.0
NCAS0I015303.284ON59562215460.0
SAKL0D02948gna 3ON59460515430.0
Kpol_1065.133.284ON59660915420.0
CAGL0L07546g3.284ON63461415440.0
Suva_2.2033.284ON60456515400.0
YDR046C (BAP3)3.284ON60460215370.0
Skud_4.3003.284ON60459515360.0
Suva_4.3073.284ON60961815360.0
YBR068C (BAP2)3.284ON60961315320.0
SAKL0D02926g3.285ON58354015270.0
KNAG0J022003.284ON60761115260.0
TPHA0M012003.284ON60760315070.0
Smik_2.2013.284ON60961715060.0
Skud_2.1913.284ON60961215010.0
NDAI0A056203.284ON57158114920.0
NDAI0A074903.284ON59661514820.0
KNAG0H011503.284ON61757814840.0
NCAS0A106803.284ON59360514730.0
KAFR0A011203.284ON59258314690.0
SAKL0D02970g3.284ON60159114610.0
AGR040C3.285ON57352914560.0
AGR039Cna 3ON58653714530.0
KAFR0C004003.284ON58260614490.0
CAGL0H08393g3.284ON61257214480.0
AGR038C3.284ON58059814340.0
Ecym_26623.284ON58956814280.0
KLTH0C05170g3.284ON59860114080.0
Kwal_27.105383.284ON60256614080.0
TBLA0I020003.284ON66457414100.0
TPHA0A039603.284ON61561513970.0
Kpol_1052.163.284ON61360313750.0
Skud_2.1923.285ON61958813670.0
TBLA0G031203.284ON67366513720.0
Smik_2.2023.285ON61754413501e-180
TBLA0I020103.285ON62851013321e-177
Suva_4.3083.285ON61862513301e-177
YBR069C (TAT1)3.285ON61962413101e-174
KNAG0J022103.285ON58159713031e-173
Ecym_2663na 3ON58956912901e-171
Kwal_27.126811.244ON59359012631e-167
Kpol_1052.143.285ON60251512451e-164
KLTH0E15642g1.244ON59661212401e-163
ZYRO0G12342g3.284ON62052612391e-163
TPHA0B010901.244ON60662212371e-163
NDAI0B052201.244ON61161012171e-160
SAKL0H08184gna 4ON59852112151e-160
ZYRO0D03762g1.244ON60061612151e-160
NCAS0I015203.285ON61457312171e-160
KLLA0A06886gsingletonON58757712001e-158
ADL272Wna 4ON56449611871e-156
TDEL0C00930singletonON59560811881e-155
Suva_11.2731.244ON60161911831e-155
NDAI0A075003.285ON61956711811e-154
KNAG0C02140singletonON59861311701e-153
NCAS0B079001.244ON61957611691e-152
SAKL0G14014g5.158ON60557111661e-152
Skud_11.2751.244ON60262011641e-152
Kpol_543.791.244ON60562011621e-151
YKR039W (GAP1)1.244ON60262011601e-151
KLLA0A06930g1.244ON58757611471e-149
CAGL0L03267g1.244ON59761311481e-149
Ecym_8297na 4ON56953511401e-149
SAKL0D04664g1.244ON59358811401e-148
SAKL0D00836gna 5ON60157311351e-147
Ecym_60211.244ON60059411341e-147
Kwal_33.14276na 5ON59659411211e-145
KAFR0E018505.158ON56052411121e-145
TPHA0A002405.158ON60359211131e-144
Kwal_33.154075.158ON58758511051e-143
KLLA0A11770g5.158ON58155711041e-143
Suva_7.4855.158ON60360511021e-142
KLLA0F01012gna 4ON55652210961e-142
Suva_2.716singletonON60361510891e-141
Skud_7.5255.158ON60355210881e-140
Ecym_47895.158ON58859010861e-140
Smik_16.1155.158ON60352910801e-139
KLTH0B02046g5.158ON58958910781e-139
CAGL0B03773g5.158ON60553010791e-139
NCAS0A089201.368ON59960510751e-139
AFR230C1.244ON60459110751e-138
NDAI0D021605.158ON58753910731e-138
Kpol_543.78singletonON60557710731e-138
NDAI0C029505.158ON60958310711e-138
Kpol_1010.325.158ON59958010631e-137
NDAI0G060301.368ON59961610581e-136
NCAS0D018705.158ON59557610571e-136
Smik_11.3021.244ON55357110491e-135
Kpol_534.221.368ON59261910521e-135
TPHA0A047005.158ON56952410481e-135
AGR319W5.158ON62661810511e-135
YGR191W (HIP1)5.158ON60353210441e-134
KNAG0G009005.158ON61354310421e-133
Smik_15.1461.368ON59360510371e-133
YOL020W (TAT2)1.368ON59254710361e-133
TBLA0C012101.368ON60062410351e-133
CAGL0D02178g1.368ON57759710321e-132
Skud_15.1381.368ON59257410271e-131
TBLA0B077605.158ON65862810291e-131
NCAS0A071105.158ON59258310201e-130
Suva_15.1481.368ON5925799991e-127
AEL030W1.368ON5826209941e-127
TPHA0A025001.368ON5906289921e-126
Ecym_27161.368ON5925869921e-126
KLTH0H13398g1.368ON5876209871e-126
KLLA0A10813g1.368ON5846049821e-125
KAFR0F04410singletonON5805979381e-118
TDEL0E05700singletonON5845749381e-118
KLTH0C08052gna 6ON5995729381e-118
KLLA0B06776gna 6ON5885799331e-117
TDEL0B00130singletonON5846089311e-117
Sklu_YGOB_Anc_1.3681.368ON5414999241e-117
TPHA0G03770singletonON6046089241e-116
SAKL0D04048gna 6ON5865819181e-115
YLL061W (MMP1)na 7ON5835789081e-114
KAFR0B00220singletonON5856039041e-113
Smik_12.2na 7ON5835788991e-112
TDEL0H04510singletonON5846048901e-111
YPL274W (SAM3)na 6ON5876098881e-111
Smik_6.483na 6ON5906088841e-110
Kwal_56.22951na 6ON5965968841e-110
TDEL0E00250singletonON5875948781e-109
Kwal_34.16254singletonOFF4815108601e-108
ZYRO0D17952gna 6ON5856048681e-108
Kwal_YGOB_34.162541.368ON4915108601e-108
AER405Cna 6ON4974928511e-106
Suva_16.18na 6ON5835718581e-106
Suva_16.31singletonON5865938331e-103
SAKL0C02662g1.83ON5485468281e-102
Ecym_4758na 6ON5875978251e-101
YNL270C (ALP1)1.83ON5735868201e-101
Skud_14.701.83ON5735558191e-101
TBLA0A054601.84ON6085458211e-101
ZYRO0F16632g1.84ON6074968131e-99
Kpol_2000.641.84ON6106017973e-97
NDAI0F041901.84ON5995877938e-97
Ecym_10871.83ON5705677882e-96
SAKL0C02728g1.84ON5625117872e-96
SAKL0C02640gsingletonON5485467853e-96
TPHA0B044701.84ON5996017876e-96
TDEL0C061701.84ON5735497856e-96
KAFR0D039401.83ON5976017842e-95
CAGL0J08162g1.84ON5975967815e-95
KLTH0F02420g1.84ON6215717826e-95
CAGL0J08184g1.83ON5725367778e-95
Ecym_10881.84ON5675227779e-95
KNAG0F004801.84ON5975287711e-93
Kwal_33.134111.84ON5605257682e-93
Smik_14.671.83ON5735507673e-93
Smik_14.681.84ON6114947693e-93
NCAS0A006101.84ON6075147685e-93
Suva_5.41.83ON5906037658e-93
Smik_5.241.83ON5905087658e-93
YNL268W (LYP1)1.84ON6115177633e-92
ZYRO0F16654g1.83ON5805707586e-92
YEL063C (CAN1)1.83ON5905087571e-91
Kwal_33.134011.83ON5595407523e-91
Suva_14.731.83ON4974907464e-91
NCAS0B085701.83ON5325327479e-91
KLLA0E16281gna 8ON6056147539e-91
NCAS0A006001.83ON5445567462e-90
Skud_5.261.83ON5905177502e-90
KNAG0C05920singletonON5995127475e-90
KLTH0F02398g1.83ON5555497411e-89
Suva_14.751.84ON6114957442e-89
Skud_14.711.84ON6124957433e-89
KLLA0C02365g1.84ON5795347395e-89
KLLA0C02343g1.83ON5814917361e-88
NDAI0A006101.83ON5655407341e-88
TDEL0C061801.83ON5835007325e-88
NDAI0F042001.83ON5665377308e-88
AFR667C1.84ON5635177272e-87
SAKL0C02684gsingletonON5884927212e-86
TBLA0A07060na 8ON6255167233e-86
AFR668W1.83ON5564997158e-86
KNAG0C007901.83ON5795127109e-85
TPHA0B044801.83ON6034577022e-83
KAFR0D007001.83ON5745506993e-83
Smik_6.473na 8ON6065417004e-83
CAGL0A01199gna 8ON6135546981e-82
TBLA0A054501.83ON6064766971e-82
YPL265W (DIP5)na 8ON6085356962e-82
KAFR0B06430singletonON5935706924e-82
Skud_16.12na 8ON6075746892e-81
Kpol_2000.651.83ON5955136831e-80
NCAS0D02260na 8ON5975956812e-80
KNAG0L02470singletonON6385406808e-80
TPHA0M00130singletonON6115296771e-79
Suva_16.40na 8ON6065396743e-79
SAKL0G14916gna 8ON5815636644e-78
Skud_47.1singletonON3283266418e-78
Kpol_358.3na 8ON5755416611e-77
Ecym_80357.44ON5635156522e-76
KLTH0B01166gna 8ON5775236452e-75
NDAI0I02660na 8ON5946016453e-75
Kwal_33.15545na 8ON5765336434e-75
Ecym_2480na 8ON5865366436e-75
KNAG0E003907.44ON5995796437e-75
KAFR0C051607.44ON5845106374e-74
YOR348C (PUT4)7.44ON6275896361e-73
TPHA0H028507.44ON6016406305e-73
SAKL0F09790gsingletonON5585386267e-73
CAGL0E05632g7.44ON5985466281e-72
KNAG0L02460singletonON5885836243e-72
Suva_8.4027.44ON6835846233e-71
Smik_15.5327.44ON6315716194e-71
NDAI0E038007.44ON6215746169e-71
Kpol_367.77.44ON5845566061e-69
Skud_15.5157.44ON6266086081e-69
SAKL0B10956g7.44ON5725206023e-69
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00510
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}     1232   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      947   0.0  
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   810   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   784   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   784   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   782   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   781   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   779   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   776   0.0  
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   775   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   773   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   769   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   764   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   764   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   764   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   764   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   756   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   757   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   756   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   753   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   750   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   742   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   740   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              736   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   730   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   728   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   725   0.0  
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   727   0.0  
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              712   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   679   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   668   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   666   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   664   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   663   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   654   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   652   0.0  
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   643   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   644   0.0  
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   614   0.0  
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   604   0.0  
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   600   0.0  
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              600   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   598   0.0  
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   598   0.0  
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   599   0.0  
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   597   0.0  
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   596   0.0  
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   596   0.0  
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   596   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   594   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   592   0.0  
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   592   0.0  
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   585   0.0  
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   584   0.0  
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   582   0.0  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            579   0.0  
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   575   0.0  
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              576   0.0  
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   572   0.0  
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   570   0.0  
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   567   0.0  
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   565   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   564   0.0  
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                562   0.0  
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   562   0.0  
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   556   0.0  
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   554   0.0  
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   546   0.0  
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   546   0.0  
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   547   0.0  
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              542   0.0  
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   534   0.0  
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   531   0.0  
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              533   0.0  
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   524   e-180
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   517   e-177
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   516   e-177
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   509   e-174
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   506   e-173
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   501   e-171
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   491   e-167
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   484   e-164
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   482   e-163
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   481   e-163
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   481   e-163
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   473   e-160
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   472   e-160
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   472   e-160
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              473   e-160
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   466   e-158
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   461   e-156
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   462   e-155
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   460   e-155
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   459   e-154
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   455   e-153
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   454   e-152
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   453   e-152
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   452   e-152
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   452   e-151
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   451   e-151
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   446   e-149
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   446   e-149
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   443   e-149
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   443   e-148
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   441   e-147
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   441   e-147
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   436   e-145
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   432   e-145
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   433   e-144
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   430   e-143
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   429   e-143
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   429   e-142
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   426   e-142
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   424   e-141
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   423   e-140
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   422   e-140
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   420   e-139
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   419   e-139
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   420   e-139
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   418   e-139
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   418   e-138
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    417   e-138
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   417   e-138
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    417   e-138
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   414   e-137
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   412   e-136
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   411   e-136
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   408   e-135
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   409   e-135
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   408   e-135
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   409   e-135
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   406   e-134
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   405   e-133
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   404   e-133
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   403   e-133
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   403   e-133
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   402   e-132
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   400   e-131
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   400   e-131
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   397   e-130
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   389   e-127
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   387   e-127
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   386   e-126
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   386   e-126
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   384   e-126
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   382   e-125
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              365   e-118
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   365   e-118
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   365   e-118
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   363   e-117
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                363   e-117
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   360   e-117
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   360   e-116
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   358   e-115
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   354   e-114
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      352   e-113
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    350   e-112
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   347   e-111
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   346   e-111
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   345   e-110
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   345   e-110
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                342   e-109
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   335   e-108
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   338   e-108
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   335   e-108
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   332   e-106
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   335   e-106
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   325   e-103
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   323   e-102
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   322   e-101
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   320   e-101
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   320   e-101
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   320   e-101
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   317   1e-99
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   311   3e-97
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   310   8e-97
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   308   2e-96
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   307   2e-96
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   306   3e-96
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   307   6e-96
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   306   6e-96
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   306   2e-95
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   305   5e-95
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   305   6e-95
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   303   8e-95
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   303   9e-95
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                301   1e-93
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   300   2e-93
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   300   3e-93
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   300   3e-93
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              300   5e-93
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   299   8e-93
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   299   8e-93
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   298   3e-92
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   296   6e-92
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   296   1e-91
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   294   3e-91
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   291   4e-91
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            292   9e-91
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   294   9e-91
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   291   2e-90
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   293   2e-90
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            292   5e-90
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   290   1e-89
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   291   2e-89
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   290   3e-89
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   289   5e-89
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   288   1e-88
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   287   1e-88
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   286   5e-88
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            285   8e-88
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   284   2e-87
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   282   2e-86
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   283   3e-86
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   280   8e-86
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              278   9e-85
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   275   2e-83
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   273   3e-83
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   274   4e-83
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   273   1e-82
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   273   1e-82
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   272   2e-82
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   271   4e-82
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   270   2e-81
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   267   1e-80
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              266   2e-80
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             266   8e-80
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     265   1e-79
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   264   3e-79
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   260   4e-78
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         251   8e-78
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   259   1e-77
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   255   2e-76
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   253   2e-75
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   253   3e-75
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   252   4e-75
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   252   6e-75
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   252   7e-75
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   249   4e-74
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   249   1e-73
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   247   5e-73
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   245   7e-73
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   246   1e-72
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             244   3e-72
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   244   3e-71
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   243   4e-71
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     241   9e-71
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   238   1e-69
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   238   1e-69
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   236   3e-69
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            235   5e-69
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   234   1e-68
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   233   2e-68
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   233   5e-68
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   231   1e-67
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   231   2e-67
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   233   2e-67
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   230   7e-67
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   229   7e-67
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   229   1e-66
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   229   1e-66
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   228   2e-66
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   226   1e-65
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   228   1e-65
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   225   2e-65
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   223   2e-64
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   222   1e-63
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   220   2e-63
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   219   2e-63
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     221   3e-63
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      219   4e-63
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      219   5e-63
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   218   1e-62
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   218   1e-62
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     212   2e-62
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     211   3e-62
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   217   5e-62
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                216   6e-62
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   216   8e-62
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   215   3e-61
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   213   6e-61
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   213   1e-60
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   213   1e-60
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    211   2e-60
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   212   2e-60
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              210   8e-60
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   206   1e-58
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   207   1e-58
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              206   2e-58
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            203   1e-57
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   202   1e-56
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   201   3e-56
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   200   7e-56
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   197   6e-55
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   197   1e-54
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   196   1e-54
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   197   1e-54
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   197   2e-54
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   197   2e-54
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             184   2e-54
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   195   2e-54
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   196   2e-54
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   195   3e-54
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   194   3e-54
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   194   9e-54
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   193   3e-53
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   192   5e-53
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   191   2e-52
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   189   1e-51
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   188   1e-51
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   182   2e-49
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   171   7e-49
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   179   3e-48
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   178   4e-48
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   176   4e-47
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   175   1e-46
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   173   4e-46
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   170   5e-45
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   168   2e-43
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   156   3e-43
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   163   7e-42
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     145   3e-40
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   153   2e-39
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   155   2e-39
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   152   5e-38
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   136   1e-36
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   146   5e-36
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   142   1e-35
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   144   2e-35
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   141   1e-34
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   141   2e-34
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   139   6e-34
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   139   7e-34
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    132   4e-33
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   134   5e-32
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     125   1e-31
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   129   1e-30
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   126   1e-29
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   125   3e-29
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   125   4e-29
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   124   8e-29
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   124   9e-29
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   123   1e-28
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   122   2e-28
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   119   3e-27
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         106   2e-25
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}         103   5e-25
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      99   4e-24
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    78   7e-15
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              56   3e-09
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    40   0.010
Skud_5.282 Chr5 complement(451145..452359) [1215 bp, 404 aa] {ON...    38   0.054
CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {...    38   0.069
TDEL0E01790 Chr5 (343205..344911) [1707 bp, 568 aa] {ON} Anc_4.1...    37   0.11 
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    37   0.18 
TPHA0F00170 Chr6 (21183..22853) [1671 bp, 556 aa] {ON} Anc_4.5 Y...    35   0.60 
Smik_6.139 Chr6 (225355..227079) [1725 bp, 574 aa] {ON} YGR055W ...    35   0.65 
SAKL0H26048g Chr8 complement(2292824..2294482) [1659 bp, 552 aa]...    35   0.84 
TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {O...    34   1.4  
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    34   1.5  
YGR055W Chr7 (599417..601141) [1725 bp, 574 aa] {ON}  MUP1High a...    33   2.0  
Suva_7.337 Chr7 (574716..576443) [1728 bp, 575 aa] {ON} YGR055W ...    33   3.2  
YPL162C Chr16 complement(243206..244027) [822 bp, 273 aa] {ON} P...    32   4.3  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    32   6.2  
TBLA0D02060 Chr4 complement(519297..521225) [1929 bp, 642 aa] {O...    32   6.3  
KNAG0B05820 Chr2 (1144434..1146164) [1731 bp, 576 aa] {ON} Anc_4...    32   6.8  
Skud_7.353 Chr7 (586707..588431) [1725 bp, 574 aa] {ON} YGR055W ...    32   7.2  
Sklu_YGOB_Anc_4.195 Chr2 (423552..424091,424095..425261) [1707 b...    32   7.4  
Suva_16.148 Chr16 complement(252413..253243) [831 bp, 276 aa] {O...    31   8.1  

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/617 (97%), Positives = 600/617 (97%)

Query: 1   MIDTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP 60
           MIDTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP
Sbjct: 1   MIDTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP 60

Query: 61  PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXX 120
           PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMS        
Sbjct: 61  PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTG 120

Query: 121 XXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180
                    AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA
Sbjct: 121 LLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180

Query: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240
           LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY
Sbjct: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240

Query: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV 300
           AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV
Sbjct: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV 300

Query: 301 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360
           STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS
Sbjct: 301 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360

Query: 361 SELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420
           SELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR
Sbjct: 361 SELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420

Query: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480
           QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL
Sbjct: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480

Query: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA 540
           ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA
Sbjct: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA 540

Query: 541 DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQ 600
           DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQ
Sbjct: 541 DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQ 600

Query: 601 EKLRNGPVWRRVYDFWC 617
           EKLRNGPVWRRVYDFWC
Sbjct: 601 EKLRNGPVWRRVYDFWC 617

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/614 (72%), Positives = 521/614 (84%), Gaps = 7/614 (1%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSA-----ERNYELPTSSTTHSRFRNFIDSFKPPET 63
              +  N+ T+ S   + ++  D D       E   E   S+    RF  FIDSF+  E 
Sbjct: 6   NNKFTTNNYTEKSDSIDPIEQGDSDLQVTVLDEEKSEF--SNGLRGRFDEFIDSFRRAED 63

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
              +  +MNPILSH+SVFD A VEIS VD+++NEKLKKTIQPRHV+M++           
Sbjct: 64  VRILPNEMNPILSHESVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLV 123

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                 +HAGPAGL+IGYAIM++CIYC++QAVGEMAVNYLTL+GGF+AYPGFL+DP LNF
Sbjct: 124 GNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNF 183

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAET 243
           +++WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFY+L++ INIFGGARGYAE 
Sbjct: 184 AVSWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEA 243

Query: 244 EFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTL 303
           EF CN CKILMM GFFILGI++ICGGAGN GFIG +YW  PGAFRG +G NRFKG+VSTL
Sbjct: 244 EFFCNVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAFRGDNGINRFKGIVSTL 303

Query: 304 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL 363
           VTAAF+FG TEFLAITASEQ+NPRKAIPSAAKKVIYRAL+IY+ SIIIVG LVPY+SSEL
Sbjct: 304 VTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSEL 363

Query: 364 LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGY 423
           LGSS  ATKASPYV+AV++HG+RVVPHFINAVILISVFSVADSAFYSSSR+LLTLARQG+
Sbjct: 364 LGSSGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGF 423

Query: 424 APKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICL 483
           APK+FT+VD+ GRP+LGF+VGA+IA+++FCACSSKE +VFNWLL+ISGLS+VFTWA+I L
Sbjct: 424 APKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISL 483

Query: 484 SHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQ 543
           SHIRFRRAMKVQGRS+DEIG+KSQ GVWGS YAFVMMIL++IGQ WVGIVPVGE SAD  
Sbjct: 484 SHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAV 543

Query: 544 AFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKL 603
           +FFQ YLAMPVFIVLY GYKIW RDWRLFIRAK+IDLI+HRHI+DPE+LRQER+E +E+ 
Sbjct: 544 SFFQAYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERA 603

Query: 604 RNGPVWRRVYDFWC 617
           RN P+WR++Y+FWC
Sbjct: 604 RNAPLWRKIYNFWC 617

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/578 (65%), Positives = 460/578 (79%), Gaps = 14/578 (2%)

Query: 45  STTHSRF----RNFIDSFKP-PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKL 99
           + +HS+     ++F+DSFK   +  +  E + N I           ++  Q +D+LN +L
Sbjct: 30  NESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEI---------NNIKSDQFNDKLNNQL 80

Query: 100 KKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMA 159
           +KTIQPRHV+M+S                  +AGPAGL+IGY IMASCIYCIIQA GEMA
Sbjct: 81  QKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMA 140

Query: 160 VNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADI 219
           VNYLTL+GGFN YP FLVD A NF++AW+YCIQW CVCPLELVTASMTI+YW  KV+ D+
Sbjct: 141 VNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDV 200

Query: 220 FVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGK 279
           FV IFY+L++AIN+FGGARGYAE EF  N CKILM+ GFFILGI++ICGGAG  G+IG  
Sbjct: 201 FVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVS 260

Query: 280 YWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 339
           YW +PGAFRG     RFKG+VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY
Sbjct: 261 YWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320

Query: 340 RALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILIS 399
           RAL IY+ SIIIVG LVPY+S ELLGS S+ TKASPYV+AV++HG+R+ PHFINAVILIS
Sbjct: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380

Query: 400 VFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKE 459
           V SVA+S+FYSSSRMLLTLA+QGYAPK+FT++DR GRP  G +  +++A +AFCA S KE
Sbjct: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440

Query: 460 TEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVM 519
           TEVF+WLLAISGLSQVFTW  ICLSHIRFRRAMK+QGRS++E+GYKSQVGVWGS YA  +
Sbjct: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500

Query: 520 MILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDID 579
           M LI+IGQ WV + P+    A++  FF++YLAMP+ ++ Y GYK WK+DW LFIRAKDID
Sbjct: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560

Query: 580 LISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           LISHRHI+D ++L+QE+ +Y+E L+NG +W ++Y FWC
Sbjct: 561 LISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/632 (59%), Positives = 468/632 (74%), Gaps = 22/632 (3%)

Query: 7   SSKESYEKNDITKSSAKF------NDVDVIDIDSAERNYELPT---SSTTHSRFRNFIDS 57
           SSK  YE  D+  SS +       N+V+  + DS + +   P         S  R F DS
Sbjct: 3   SSKSPYELKDLKNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHNTSALRRFFDS 62

Query: 58  FKPPETT--HHIET-DMNPILSHQSVFDDAKVEISQVDDELN---------EKLKKTIQP 105
           FK  + +    +ET  MN + S  S     + E+ + +   N         + LKKTIQP
Sbjct: 63  FKKADQSAEERVETAQMNDLASAISPSSRQRQELEKNESSDNIGARTGNKSDSLKKTIQP 122

Query: 106 RHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTL 165
           RHV+M++                  HAGPAGL+IGY IM S +YCIIQA GEMA+ Y  L
Sbjct: 123 RHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNL 182

Query: 166 VGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFY 225
            GG+NAYP FLVD    F++AW+YC+QW CVCPLELVTASMTI+YWTT VN D+FV+IFY
Sbjct: 183 TGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFY 242

Query: 226 ILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPG 285
           +LV+ INIFG ARGYAE EF  N CKILMM GFFILGI+I  GGAGNDGFIGGKYW DPG
Sbjct: 243 VLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPG 301

Query: 286 AFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIY 345
           AF G    +RFKGVV+TLVTAAF+FG +EF+AIT +EQ+NPRKA+P AAK++IYR L ++
Sbjct: 302 AFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLF 361

Query: 346 LASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVAD 405
           LA+II++G LVPY+S++LLGSS   TKASPYV+AV++HGVRVVPHFINAVIL+SV S+A+
Sbjct: 362 LATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMAN 421

Query: 406 SAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNW 465
           S+FYSS+R+LLTL+ QGYAP+VFT++D+ GRP +   V A+  V+AFCA S KE +VF W
Sbjct: 422 SSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTW 481

Query: 466 LLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMI 525
           LLAISGLSQ+FTW  ICLSHIRFRRAMKVQGRS+ E+G++SQ GVWGS YA +MMILI+I
Sbjct: 482 LLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILI 541

Query: 526 GQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
           GQ WV I P+GEG  D QAFF++YLAMP+ I LY+GYKIWK+DW+LFIRA  IDLISHR 
Sbjct: 542 GQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQ 601

Query: 586 IHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           I D E+++QE EE++E+L+NGP W+RV  FWC
Sbjct: 602 IFDEELIKQEDEEFRERLKNGPCWKRVVAFWC 633

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/629 (61%), Positives = 482/629 (76%), Gaps = 25/629 (3%)

Query: 12  YEKNDITKSSAKFNDVDVIDIDS---AERNYELPTSS--------------TTHSR---- 50
           YE ND+ K S K ++ +  + +    A+ + +LP+S+              T+HSR    
Sbjct: 15  YEMNDLKKKS-KTSEFETTENEVEYFAQTDSQLPSSTLSNDFEPISQDQNTTSHSRTRAK 73

Query: 51  FRNFIDSFK--PPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHV 108
           F+NFIDSFK    E    +E D+           +   + ++V  + +E+LK +I+PRHV
Sbjct: 74  FQNFIDSFKRADKEQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGK-SEELKHSIKPRHV 132

Query: 109 VMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGG 168
           +M+S                 A++GPAGLVIGYAIM SCIYCIIQA GEMAV Y  L+GG
Sbjct: 133 IMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGG 192

Query: 169 FNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILV 228
           FN+YP FL++PAL FS+AW+YCIQW CVCPLELVTASMTI+YWTTKV+ D+FV+IFY+L+
Sbjct: 193 FNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLI 252

Query: 229 LAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR 288
           + IN+ GGA GYAE EF  NSCKILM++GFFILGI++ICGGAG+DG+IGG+YW DPGAFR
Sbjct: 253 ILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFR 312

Query: 289 GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLAS 348
           G    +RFKGVVSTLV AAF+FG +E + +TASEQSNPRKAIPSAAKK+IYR + IYL S
Sbjct: 313 GEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGS 372

Query: 349 IIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAF 408
           ++IVG LVP++S +LLGSS    KASPYVLAVSTHGVRVVPHFINAVIL+SV SVA+SAF
Sbjct: 373 VVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAF 432

Query: 409 YSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLA 468
           YSSSR+LL LA QGYAPK+F +VDR GRP++G  V A++ V++FCA S KE +VF WLLA
Sbjct: 433 YSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLA 492

Query: 469 ISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQC 528
           ISGLSQ+FTW+ ICLSHIRFRRAM VQGRS+ EIG+KSQ GVWGS YAF+MM+LI+I Q 
Sbjct: 493 ISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQF 552

Query: 529 WVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHD 588
           WV I P+GEG  DVQAFF++YLA P+ I LY GYKI+ +DWRLFIRAKDIDL  +R + D
Sbjct: 553 WVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFD 612

Query: 589 PEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            E++RQE EEY+EK+RN P+W+++Y+FWC
Sbjct: 613 EELIRQEEEEYKEKMRNAPIWQKIYEFWC 641

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/632 (59%), Positives = 465/632 (73%), Gaps = 22/632 (3%)

Query: 7   SSKESYEKNDITKSSAKF------NDVDVIDIDSAERNYELPT---SSTTHSRFRNFIDS 57
           SS   YE  D+  SS +       N+++  + DS +R  + P         S  R F+DS
Sbjct: 3   SSTSPYELKDLKNSSTEVHAAEQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDS 62

Query: 58  FKPPETTHHIETD---MNPILS---------HQSVFDDAKVEISQVDDELNEKLKKTIQP 105
           FK  +     E +   MN + S         H+   D+   +I+      ++ LKKTIQP
Sbjct: 63  FKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQP 122

Query: 106 RHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTL 165
           RHV+M++                  HAGPAGL+IGYAIM S +YCIIQA GEMA+ Y  L
Sbjct: 123 RHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNL 182

Query: 166 VGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFY 225
            GG+NAYP FLVD    F++AW+YC+QW CVCPLELVTASMTI+YWTT VN D+FV+IFY
Sbjct: 183 TGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFY 242

Query: 226 ILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPG 285
           +LV+ INIFG ARGYAE EF  N CKILMM GFFILGI+I  GGAGNDG+IGGKYW +PG
Sbjct: 243 VLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPG 301

Query: 286 AFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIY 345
           AF G    +RFKGVV+TLVTAAF+FG +EF+AIT +EQSNPRKAIP AAK++IYR L ++
Sbjct: 302 AFNGVHAIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLF 361

Query: 346 LASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVAD 405
           LA+IIIVG LVPY+S +LLGSS   TKASPYV+A+++HGVRV PHF+NAVIL+SV S+A+
Sbjct: 362 LATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMAN 421

Query: 406 SAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNW 465
           S+FYSS+R+ LTL+ QGYAPK+F+++DR GRP +   V A+ AV+AFCA S KE +VF W
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTW 481

Query: 466 LLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMI 525
           LLAISGLSQ+FTW  ICLSHIRFRRAMKVQGRS+ E+G+KSQ GVWGS Y+ +MMILI+I
Sbjct: 482 LLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILI 541

Query: 526 GQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
           GQ WV I P+GEG  D QAFF++YLAMP+ IVLY+GYK+W +DW+LFIRA  IDL SHR 
Sbjct: 542 GQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQ 601

Query: 586 IHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           I D E+++QE +EY+E+LR GP WRRV  FWC
Sbjct: 602 IFDEELIKQEDDEYRERLRTGPYWRRVLAFWC 633

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/606 (63%), Positives = 466/606 (76%), Gaps = 7/606 (1%)

Query: 17  ITKSSAKFNDV---DVIDIDSAERNYELPTS--STTHSRFRNFIDSFKPPETTHHIETDM 71
           +T+ SA  N+V   + +   S+   Y L +   + +++RFR FIDSFK  E       D 
Sbjct: 24  VTEISAIDNEVTYFENVKQGSSNSTYSLESDHHAASNTRFRRFIDSFKKAEGPQPGSLDH 83

Query: 72  NPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAH 131
           + +     +    + E  + DD    +LKKTI+PRHVVM+S                 A+
Sbjct: 84  DVLAGDSDIEGKPRTEPEKDDDA--RELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLAN 141

Query: 132 AGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCI 191
           +GPAGLVIGYAIM SCIYCIIQA GE+AV Y  L GGFNAYP  L+DPA  F++AW+YCI
Sbjct: 142 SGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCI 201

Query: 192 QWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCK 251
           QW CVCPLELVTASMTI+YWTTKV+ D+FV+IFY L+L IN+ GGA GYAE EF  NS K
Sbjct: 202 QWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFK 261

Query: 252 ILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFG 311
           ILM+ GFFILGIV+ICGGAGNDG+IG + W +PG+FRG    +RFKGVVSTLV AAF+FG
Sbjct: 262 ILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFRGDKPVDRFKGVVSTLVNAAFAFG 321

Query: 312 QTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAAT 371
            +EFL +TASEQSNPRKAIPSAAKK++YR + IYL S+ IVG LVPYDS +LLGSS AAT
Sbjct: 322 MSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAAT 381

Query: 372 KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431
           KASPYVLA+S HGVRVVPHFINAVIL+SV SV +SAFYSSSR LL+L++ GYAP    +V
Sbjct: 382 KASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYV 441

Query: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491
           DR GRP   + V A++ V+AFCA S KE +VF WLLAISGLSQ+FTW  ICLSH+RFRRA
Sbjct: 442 DRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRA 501

Query: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551
           M+VQGRS+ E+G+KSQVG++GS Y+ VMM+LI+I Q W  +VPVGEG  DVQAFF++YLA
Sbjct: 502 MRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLA 561

Query: 552 MPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRR 611
           MP+FIVLY G+KIWK+DWRLFIRA+DIDL+SHR I D E+L+QE EEY+ KLR+GP+WRR
Sbjct: 562 MPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRKLRDGPMWRR 621

Query: 612 VYDFWC 617
           VYDFWC
Sbjct: 622 VYDFWC 627

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/632 (59%), Positives = 461/632 (72%), Gaps = 22/632 (3%)

Query: 7   SSKESYEKNDITKSSAKF------NDVDVIDIDSAERNYELPT---SSTTHSRFRNFIDS 57
           SSK  YE  D+  SS +       N+++  +  S +R    P         S  R F DS
Sbjct: 3   SSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFFDS 62

Query: 58  FKPPETTHHIE---TDMNPILSHQSVFDDAKVEISQVDDELN---------EKLKKTIQP 105
           FK  +     E   T MN + S  S       E+ + +   N         + LKKTIQP
Sbjct: 63  FKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQP 122

Query: 106 RHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTL 165
           RHV+M++                  HAGPAGL+IGYAIM S +YCIIQA GEMA+ Y  L
Sbjct: 123 RHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNL 182

Query: 166 VGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFY 225
            GG+NAYP FLVD    F++AW+YC+QW CVCPLELVTASMTI+YWTT VN D+FV+IFY
Sbjct: 183 TGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFY 242

Query: 226 ILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPG 285
           +LV+ INIFG ARGYAE EF  N CKILMM GFFILGI+I  GGAGNDGFIGGKYW DPG
Sbjct: 243 VLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPG 301

Query: 286 AFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIY 345
           AF G    +RFKGV +TLVTAAF+FG +EF+AIT +EQSNPRKAIP AAK++IYR L ++
Sbjct: 302 AFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLF 361

Query: 346 LASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVAD 405
           LA+II++G LVPY+S +LLGS+   TKASPYV+AV++HGVRVVPHFINAVIL+SV S+A+
Sbjct: 362 LATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMAN 421

Query: 406 SAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNW 465
           S+FYSS+R+ LTL+ QGYAPKVF+++DR GRP +   V A+ AV+AFCA S KE +VF W
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTW 481

Query: 466 LLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMI 525
           LLAISGLSQ+FTW  ICLSH+RFRRAMKVQGRS+ E+G+KSQ GVWGSAYA +MMILI+I
Sbjct: 482 LLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILI 541

Query: 526 GQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
            Q WV I P+GEG  D QAFF++YLAMP+ I LY+GYK+W +DW+LFIRA  IDL SHR 
Sbjct: 542 AQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQ 601

Query: 586 IHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           I D E+++QE EEY+E+LRNGP W+RV  FWC
Sbjct: 602 IFDEELIKQEDEEYRERLRNGPYWKRVVAFWC 633

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/632 (59%), Positives = 463/632 (73%), Gaps = 22/632 (3%)

Query: 7   SSKESYEKNDITKSSAKF------NDVDVIDIDSAERNYELPT---SSTTHSRFRNFIDS 57
           SSK  YE+ D+  SS +       N+++  + DS +R    P         S  R F DS
Sbjct: 3   SSKSPYEQKDLKNSSTEIHATEQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDS 62

Query: 58  FKPPETTHHIETD---MNPILS--HQSVFDDAKVEISQVDDELNE-------KLKKTIQP 105
           FK  +     E++   MN + S    S  +   +E +   D++N         LKKTIQP
Sbjct: 63  FKRADQGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQP 122

Query: 106 RHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTL 165
           RHV+M++                  HAGPAGL+IGYAIM S +YCIIQA GE+A+ Y  L
Sbjct: 123 RHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNL 182

Query: 166 VGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFY 225
            GG+NAYP FLVD    F++AW+YC+QW CVCPLELVTASMTI+YWTT VN D+FV+IFY
Sbjct: 183 TGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFY 242

Query: 226 ILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPG 285
           +LV+ INIFG ARGYAE EF  N CKILMM GFFIL I+I  GGAGNDGFIGGKYW DPG
Sbjct: 243 VLVITINIFG-ARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPG 301

Query: 286 AFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIY 345
           AF G    +RFKGVV+TLVTAAF+FG +EF+AIT +EQSNPRKAIP AAK++IYR L ++
Sbjct: 302 AFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLF 361

Query: 346 LASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVAD 405
           LA+II++G LVPY+S +LLGS    TKASPYV+A+++HGVRVVPHF+NAVIL+SV S+A+
Sbjct: 362 LATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMAN 421

Query: 406 SAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNW 465
           S+FYSS+R+ LTL+ QGYAPK F+++DR GRP +   V A+ AV+AFCA S KE +VF W
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTW 481

Query: 466 LLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMI 525
           LLAISGLSQ+FTW  IC SHIRFRRAMKVQGRS+ E+G+KSQ GVWGS YA +MM+LI+I
Sbjct: 482 LLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILI 541

Query: 526 GQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
           GQ WV I P+GEG  D QAFF++YLAMP+ I LY+GYKIW +DW+LFIRA  IDL SHR 
Sbjct: 542 GQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQ 601

Query: 586 IHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           I D E+++QE EEY+E+LRNGP W+RV  FWC
Sbjct: 602 IFDEELIKQEDEEYRERLRNGPYWKRVAAFWC 633

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/637 (59%), Positives = 465/637 (72%), Gaps = 30/637 (4%)

Query: 7   SSKESYEKNDITKSS---------------------AKFNDVDVIDIDSAERNYELPTSS 45
           S++  YE  +ITK+S                     A  ND D  D +   +   LP+ +
Sbjct: 16  STESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSDS-DFEYNGKKKILPSFN 74

Query: 46  TTHSRFRNFIDSFKPPE-----TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLK 100
                 R  IDSF+  E     T   IE ++   LS  S   D   + +   +E ++ L+
Sbjct: 75  IKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDP--QFAPHAEEKDDHLQ 132

Query: 101 KTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAV 160
           KTI+PRHV++MS                   AGP GLVIGYAIM SC+YCIIQA GEMAV
Sbjct: 133 KTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAV 192

Query: 161 NYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIF 220
            Y  L G FNAYP FLVD A  FS+AW+YC+QW CV PLELVTASMTIQYWTT VNAD+F
Sbjct: 193 AYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVF 252

Query: 221 VLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKY 280
           V+IFY+L++ IN+FG A+GYAE EF  NSCK+LMM GFFIL IVI  GGAGNDG+IG KY
Sbjct: 253 VVIFYVLIIFINVFG-AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKY 311

Query: 281 WRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 340
           W +PGAFRG    +RFK V+ST  TAAF+FG +EF+AI ASEQSNPR+AIPSAAK +IYR
Sbjct: 312 WHNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYR 371

Query: 341 ALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISV 400
            L I+L SI +VG LVPY+S+EL+GS SAATKASPYV+AV++HGVRVVPHFINAVIL+SV
Sbjct: 372 ILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSV 431

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
            SVA+SAFYSS R+L +L++QGYAP  F ++DR GRP+   ++ A+ +V+AFCACSSKE 
Sbjct: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
           +VF WLLAISGLSQ+FTW  IC+SHIRFRRAMKVQGRS+DEIG+KSQVGVWGS+YA +MM
Sbjct: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551

Query: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
            L +I + WV I P+GE   D Q FF++YLAMP+ IVLY GYKI KRDW+LFIRAKDIDL
Sbjct: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDL 611

Query: 581 ISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +SHR I+D E+++QE EE++E+LRNGP W++V  FWC
Sbjct: 612 VSHRKIYDGELIKQEEEEFKERLRNGPFWKKVVAFWC 648

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/634 (58%), Positives = 466/634 (73%), Gaps = 29/634 (4%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSR--FRNFIDSFKPPETTH- 65
           KE   K     S  + N+V+  + ++ E+  E       H R  F  FIDSF+  E +H 
Sbjct: 34  KEIQPKEKENASIERENEVEYFE-NTMEKTMENMEYKGDHQRSYFHRFIDSFRRAEGSHP 92

Query: 66  ---------------------HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQ 104
                                 ++ ++NP  S+ +V  D   + SQ  +   E LKK+I+
Sbjct: 93  NSPDSTNLNGSTPISTKDSSSRLDNELNPKSSYITV--DGIKQSSQEQEPKQENLKKSIK 150

Query: 105 PRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLT 164
           PRH VMMS                  +AGP GL+IGYAIM SC+YCIIQA GE+AV Y  
Sbjct: 151 PRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSD 210

Query: 165 LVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIF 224
           L+GGFN YP FLVDPA+ FS+AW++C+QW CVCPLELVTASMTI+YWT KVNAD+FV+IF
Sbjct: 211 LIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIF 270

Query: 225 YILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDP 284
           Y+L+L INIFG A+GYAE +F  N CKILM+ GFFIL I+I CGGAG DG+IG +YWRDP
Sbjct: 271 YVLILVINIFG-AKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDP 329

Query: 285 GAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLI 344
           GAFRG     RFKGVV+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR L +
Sbjct: 330 GAFRGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFV 389

Query: 345 YLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVA 404
           +LAS+ +VG LVPY S +LLG++ +ATKASPYV+AVS+HGVRVVPHFINAVIL+SV SVA
Sbjct: 390 FLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVA 449

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           +SAFY+SSR+L++LA+QG APK F ++DR GRP++  +V AV  V+AFCA S KE +VF 
Sbjct: 450 NSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFT 509

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           WLLAISGLSQ+FTW  ICLSHIRFR+ MKVQGRS+ E+GYKSQVGVWGSAYA V+M+L +
Sbjct: 510 WLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLAL 569

Query: 525 IGQCWVGIVPV-GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISH 583
           IGQ WV I P+ G+     Q+FF++YLAMP+ I LY+ YK+WKRDW LFI A  IDL+SH
Sbjct: 570 IGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVSH 629

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           R+I D E+L+QE EEY+++LRNGP W+RV DFWC
Sbjct: 630 RNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFWC 663

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/636 (58%), Positives = 462/636 (72%), Gaps = 31/636 (4%)

Query: 9   KESYEKNDITKSSAKFNDVDVID--IDSAERNYELPTSSTTHSRFRNFIDSFKPPETTH- 65
           KE   K     S A  N+V+  +  ++    N E        S  R FIDSFK  E +H 
Sbjct: 30  KEIQAKEREINSIAPENEVEYFENTMEKTMENLEYEGDRKA-SHLRRFIDSFKRAEGSHP 88

Query: 66  -----------------------HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKT 102
                                   ++ ++NP  S   V +    + SQ  D+  E LKKT
Sbjct: 89  NSPDSSNSIGGGATPISTNDSSSQLDNELNPKGSF--VTESGIKQPSQEQDQNQENLKKT 146

Query: 103 IQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNY 162
           I+PRH+VMMS                  +AGPAGLVIGYAIM SCIYCIIQA GE+AV Y
Sbjct: 147 IKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIY 206

Query: 163 LTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVL 222
             L+GGFN YP FLVDPAL FS+AW+YC+QW CVCPLELVTASMTI+YWT KV+ D+FV+
Sbjct: 207 SDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVV 266

Query: 223 IFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWR 282
           IFY+L++ IN+FG A+GYAE +F  N CKILM+IGFFIL I+I CGGAG DG+IG +YW 
Sbjct: 267 IFYVLIIVINVFG-AKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWH 325

Query: 283 DPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 342
           +PGAFRG+ G  RFKGVV+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR L
Sbjct: 326 NPGAFRGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRIL 385

Query: 343 LIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFS 402
            ++L S+++VG LVPY S +LLG+S +ATKASPYV+AV++HGVRVVPHFINAVIL+SV S
Sbjct: 386 FVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLS 445

Query: 403 VADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEV 462
           VA+ AFYSSSR+L++LA+QG APK F ++DR GRP++  LV ++  ++AFCA S KE +V
Sbjct: 446 VANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDV 505

Query: 463 FNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMIL 522
           F WLLAISGLSQ+FTW  ICLSHIRFRRAMKVQGRS+ E+GYKSQVG+WGS YA VMM+L
Sbjct: 506 FTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVL 565

Query: 523 IMIGQCWVGIVPVGEGSA-DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581
            +I Q WV I P+G G     Q+FF++YLAMP+ I LY+ YK+WK+DW LFI A  IDL+
Sbjct: 566 ALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLV 625

Query: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           + R I D E+L+QE EEYQEKLRNGP W+RV DFWC
Sbjct: 626 TDRQIFDEELLKQEDEEYQEKLRNGPYWKRVVDFWC 661

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/635 (60%), Positives = 469/635 (73%), Gaps = 26/635 (4%)

Query: 8   SKESYEKNDITKSSAKFN-----DVDVID--IDSAERNYELPTSSTTHSRF-RNFIDSFK 59
           +K  YE  D+   SA        +V+ +D  I+++     +    T    F R+FIDSFK
Sbjct: 4   TKAPYELKDLKSGSAVITSTTDREVEYLDDQINNSYDESSVRNRKTKEGTFVRSFIDSFK 63

Query: 60  PPETT----HHIETDMNPILSHQSV--------FDDA-KVEISQVD----DELNEKLKKT 102
             +      H ++ D+   +S  S+        FDDA    IS+ +    +E +E LKKT
Sbjct: 64  RADRNSNPLHDLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKT 123

Query: 103 IQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNY 162
           I+PRHV+M+S                 + AGPA LVIGYAIM +C+YCIIQA GE+AV Y
Sbjct: 124 IKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVY 183

Query: 163 LTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVL 222
             L GGFNAYP FLVDPAL FS+AW+YC+QW CVCPLELVTASMTI+YWTTKV+ D+FV+
Sbjct: 184 SDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVV 243

Query: 223 IFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWR 282
           IFY+L++AIN FG ARGYAE EF  N CK+LMM GFFILGI+I  GGAGNDG++G KYW 
Sbjct: 244 IFYVLIIAINTFG-ARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWH 302

Query: 283 DPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 342
           DPGAF G    +RFKGV+ T VTAAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR +
Sbjct: 303 DPGAFNGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIV 362

Query: 343 LIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFS 402
            I+LASI ++G LVPY+S +LLGS  +  KASPYV+AVS+HGVRVVPHFINAVIL+SV S
Sbjct: 363 CIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLS 422

Query: 403 VADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEV 462
           V +SAFYSSSR+LL+LA+QGYAPK F +VDR GRP    L+ A+  V+AFCA S KETEV
Sbjct: 423 VGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEV 482

Query: 463 FNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMIL 522
           F+WLLAISGLSQ+FTW  IC+SHIRFRRAM+VQGRS+ E+GY SQ GV+GSAYA +M+ L
Sbjct: 483 FSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFL 542

Query: 523 IMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLIS 582
            +I Q WV I P+GEG  D + FFQ+YLAMP+ I  Y GY++WKRDW+LFIRAKDIDL +
Sbjct: 543 ALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIRAKDIDLDT 602

Query: 583 HRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           HR I D  ILRQE EEY+EKLRNGP+WRR   FWC
Sbjct: 603 HRQIFDENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/634 (58%), Positives = 467/634 (73%), Gaps = 29/634 (4%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYE-LPTSSTTHSRF-RNFIDSFKPPETTHH 66
           KE   K     S    N+++  + ++ E+N E +      H+ + R FIDSFK  E +H 
Sbjct: 34  KEIQPKEKEIGSIEPENEIEYFE-ETVEKNIESMEYQGENHASYLRRFIDSFKRAEGSHA 92

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELN----------------------EKLKKTIQ 104
             +D +   +   +F +     SQ+D+ELN                      E LKK+I+
Sbjct: 93  NSSDSSNSNTTTPIFTNDSS--SQLDNELNRKSSYITVDGIKQAPQEQEQKQENLKKSIK 150

Query: 105 PRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLT 164
           PRH VMMS                  +AGP GL+IGYAIM SC+YCIIQA GE+AV Y  
Sbjct: 151 PRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSD 210

Query: 165 LVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIF 224
           L+GGFN YP FLVDPAL FS+AW++C+QW CVCPLELVTASMTI+YWT KV+ D+FV+IF
Sbjct: 211 LIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIF 270

Query: 225 YILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDP 284
           Y+L++ IN+FG A+GYAE +F  N CKILM+IGFFIL I+I CGGAG DG+IG KYWRDP
Sbjct: 271 YVLIIVINVFG-AKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDP 329

Query: 285 GAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLI 344
           GAFRG     RFKG+V+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR L +
Sbjct: 330 GAFRGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFV 389

Query: 345 YLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVA 404
           +LAS+ +VG LVPY S +LLG++ +ATKASPYV+AVS+HGVRVVPHFINAVIL+SV SVA
Sbjct: 390 FLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVA 449

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           +SAFY+SSR+L++LA+QG APK F ++DR GRP++  LV A+  V+AFCA S KE +VF 
Sbjct: 450 NSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFT 509

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           WLLAISGLSQ+FTW  ICLSHIRFRRAMKVQGRS+ E+GYKSQVGVWGSAYA +MM+L +
Sbjct: 510 WLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLAL 569

Query: 525 IGQCWVGIVPVGEGSA-DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISH 583
           I Q WV I P+G G     Q+FF++YLAMP+ I LY+ +K+WK DW LFI A  +DL+SH
Sbjct: 570 IAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSH 629

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           R+I D E+L+QE EEY+E+LRNGP W+R+ DFWC
Sbjct: 630 RNIFDEELLKQEDEEYKERLRNGPYWKRIVDFWC 663

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/634 (59%), Positives = 462/634 (72%), Gaps = 29/634 (4%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTH--SRFRNFIDSFKPPETTHH 66
           KE   K     S    N+V+  +  + E+  E       H  S  R FIDSF+  E +H 
Sbjct: 34  KEIQPKEKQIGSIEPENEVEYFE-KTVEKTIENMEYEGEHHASYLRRFIDSFRRAEGSHA 92

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELN----------------------EKLKKTIQ 104
              D +   S+ +     K   SQ+D+ELN                      E LKK+I+
Sbjct: 93  NSPDSSN--SNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIK 150

Query: 105 PRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLT 164
           PRH VMMS                  +AGP GL+IGYAIM SC+YCIIQA GE+AV Y  
Sbjct: 151 PRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSD 210

Query: 165 LVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIF 224
           L+GGFN YP FLVDPAL FS+AW++C+QW CVCPLELVTASMTI+YWTT VN D+FV+IF
Sbjct: 211 LIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIF 270

Query: 225 YILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDP 284
           Y+L++ IN+FG A+GYAE +F  N CKILM++GFFIL I+I CGGAG DG+IG KYWRDP
Sbjct: 271 YVLIVVINVFG-AKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDP 329

Query: 285 GAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLI 344
           GAFRG     RFKGVV+T VTAAF+FG +E LA+TASEQSNPRKAIPSAAKK+IYR L +
Sbjct: 330 GAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFV 389

Query: 345 YLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVA 404
           +LAS+ +VG LVPY S +LLG++ +ATKASPYV+AVS+HGVRVVPHFINAVIL+SV SVA
Sbjct: 390 FLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVA 449

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           + AFY+SSR+L++LA+QG APK F ++DR GRP+   LV A+  V+AFCA S KE +VF 
Sbjct: 450 NGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFT 509

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           WLLAISGLSQ+FTW  ICLSHIRFRRAMKVQGRS+ E+GYKSQVGVWGSAYA +MM+L +
Sbjct: 510 WLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLAL 569

Query: 525 IGQCWVGIVPVGEGSA-DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISH 583
           I Q WV I P+G G     Q+FF++YLAMP++I LY+ YK+WK+DW LFI A  +DL+SH
Sbjct: 570 IAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSH 629

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           R+I D E+L+QE EEY+E+LRNGP W+RV DFWC
Sbjct: 630 RNIFDEELLKQEDEEYKERLRNGPYWKRVLDFWC 663

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/618 (62%), Positives = 476/618 (77%), Gaps = 17/618 (2%)

Query: 10  ESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIET 69
           E +E   I +     +D  +   +  E+N   PTS     R RNFIDSFKP E  +  E 
Sbjct: 57  EYFENTKIQEGG--IDDSTITQTNDYEQNITKPTS-----RVRNFIDSFKPAEVKNSPEK 109

Query: 70  DMNPILSHQSVFDDAKVEISQVD----------DELNEKLKKTIQPRHVVMMSXXXXXXX 119
           D   I S++ + D+  + +S +D          +  +++LKKTI+PRHV+M+S       
Sbjct: 110 DTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISLGTGIGT 169

Query: 120 XXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDP 179
                       AGPAGL++G+ IM +C+YCIIQAVGEMAV Y  LVGGFNAYP FLVDP
Sbjct: 170 GLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYPSFLVDP 229

Query: 180 ALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARG 239
           A  FS+AW+Y +QW CVCPLELVTASMTI+YWTTKV+ D+FV+IFY+L+LAINI GGA G
Sbjct: 230 AFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINIVGGAAG 289

Query: 240 YAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGV 299
           YAE EFI NSCKILMMIGFFILGI+IICGGAGNDG+IGGKYW +PGAFRG    +RFKGV
Sbjct: 290 YAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRGEHAIDRFKGV 349

Query: 300 VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYD 359
           ++TLV AAF+FG +EF+ +TASEQSNPRKAIPSAAKK++YR + ++LASI IVG LVPYD
Sbjct: 350 MATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYD 409

Query: 360 SSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLA 419
           S +LLGSS    KASPYVLAVSTHGV+VVPHFINAVILISV SVA+SAFYSSSRMLL+LA
Sbjct: 410 SDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLA 469

Query: 420 RQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWA 479
            QGYAPK+F ++DR GRP +G  + ++  V+AFCA S KE EVF WLLAISGLSQ+FTW 
Sbjct: 470 EQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWI 529

Query: 480 LICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGS 539
            IC+SH+RFRRAM VQG+SI E+G++SQVG WGS+YA +MM+ I+I Q WV I P+GEG 
Sbjct: 530 AICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGK 589

Query: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599
            D + FF++YLAMP+ + LY GYKI+ ++W +FIRAKDIDL+SHR+I D EI++QE EEY
Sbjct: 590 LDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHRNIFDEEIIKQEEEEY 649

Query: 600 QEKLRNGPVWRRVYDFWC 617
           +EKLRNGP+WRRVYDFWC
Sbjct: 650 REKLRNGPMWRRVYDFWC 667

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/624 (61%), Positives = 479/624 (76%), Gaps = 19/624 (3%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDI-------DSAERNYELPTSSTTHSR-------FRNF 54
           KE  +K D   S+ + N+++  +         + E  Y+  T ST+  +       FR+F
Sbjct: 15  KEVNKKQDYNVSTEQENEIEYFETLKGKNAATTREEEYDFTTDSTSGRKRHGVKGYFRDF 74

Query: 55  IDSFKPPETTH-HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSX 113
           IDSFKP E    H   DM  +       +  K +    + +  +KLKKTIQPRHV+++S 
Sbjct: 75  IDSFKPAENPQPHTNLDMELVGVTSETIEQHKKD----EGDTGDKLKKTIQPRHVILISL 130

Query: 114 XXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYP 173
                           A AGPAGLVIGY IM S IYCIIQA GEMAVNYLTLVGGFNAYP
Sbjct: 131 GTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYP 190

Query: 174 GFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINI 233
            FL+DP  +F+ AW+YC+QW CVCPLELVTASMTI+YWTTKV+ D+FV+IFY+ +L INI
Sbjct: 191 TFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINI 250

Query: 234 FGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGP 293
            GGARGYAE EFI NSCKILMMIGFFILGI+IICGGAG DG+IGG+YW DPGAFRG    
Sbjct: 251 LGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGERAV 310

Query: 294 NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVG 353
           +RFKGVV+TLVTAAFSFGQ+EF+A+TASEQSNPR+AIPSAAKK+IYRAL IYLASII++G
Sbjct: 311 DRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLG 370

Query: 354 LLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSR 413
            LVPY+SS+LLG+ S   KASPYVLAV+ HGVRVVPHFINAVI+ISV SV++SAFYSS R
Sbjct: 371 FLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPR 430

Query: 414 MLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLS 473
           MLLTL++QG+APK+F++VDR GRP++G +V ++ AV+AFCA S KE +VF WLLA+SGLS
Sbjct: 431 MLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLS 490

Query: 474 QVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIV 533
           Q+FTW  ICLSH+RFRRAM VQGRS+ E G+ SQVG++GSAY+F ++ LI++GQ WV + 
Sbjct: 491 QIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALK 550

Query: 534 PVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILR 593
           PVG    D  +FF++YLA P++I LY+GYK + +DWRL+I+++DIDL++HR I+D +ILR
Sbjct: 551 PVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDILR 610

Query: 594 QEREEYQEKLRNGPVWRRVYDFWC 617
           QEREE  E+L+NGP W+R Y FWC
Sbjct: 611 QEREEETERLKNGPYWKRAYSFWC 634

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/630 (58%), Positives = 460/630 (73%), Gaps = 22/630 (3%)

Query: 8   SKESYEK-----NDITKSSAKFND---VDVIDIDSA-ERNYELPTSSTTHSRFRNFIDSF 58
           SK+ Y+         T S+ ++ D   VD ++ID   +   E           R FIDSF
Sbjct: 33  SKKGYDNLGSGSRGATTSAVEYFDKENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSF 92

Query: 59  K----PPETTHHI----ETDMNPILSHQSV--FDDAKVEISQVDDELNEKLKKTIQPRHV 108
           K     P   H++    E D+   +S  S+    +      Q+  E  E LKK+I+PRHV
Sbjct: 93  KRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFE-EEALKKSIKPRHV 151

Query: 109 VMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGG 168
           VM+S                  +AGPAGLVIGYAIM SCIYCIIQA GEMAV Y  L+GG
Sbjct: 152 VMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGG 211

Query: 169 FNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILV 228
           FN YP  LVDP   F++AW+YC+QW CVCPLELVT S+TI+YWTT VN D FV+IFY+++
Sbjct: 212 FNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVI 271

Query: 229 LAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR 288
           + I IFG ARGYAE EF  N CKILM+IGF+ILGI+I  GGAGNDG++G KYW DPGAFR
Sbjct: 272 IFIQIFG-ARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFR 330

Query: 289 GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLAS 348
           G++G  RFKG+++T V+AAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR + I++ +
Sbjct: 331 GTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGT 390

Query: 349 IIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAF 408
           I ++G LVP+DS +L+G+  +ATKASPYVLA+S HGVRVVPHFINAVILISVFSVA+SAF
Sbjct: 391 IALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAF 450

Query: 409 YSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLA 468
           YSSSR+LL LA+QGYAPK F +VDR GRP       A+  V+AFCA S KE +VF WLLA
Sbjct: 451 YSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLA 510

Query: 469 ISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQC 528
           ISGLSQ+FTW  IC+SHIRFRRAM VQGRS+ EIG+K+Q+GV+GS YA +MM+L +I Q 
Sbjct: 511 ISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQF 570

Query: 529 WVGIVPVG-EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIH 587
           WV I P+G  G  D + FF++YLAMP+ I  Y GYK+WKRDWRLFIRAKDIDL S+R + 
Sbjct: 571 WVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVF 630

Query: 588 DPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           D E+L+QE EEY+EKL+NGP+W+RV DFWC
Sbjct: 631 DEELLKQEDEEYKEKLKNGPMWKRVVDFWC 660

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/539 (65%), Positives = 423/539 (78%), Gaps = 1/539 (0%)

Query: 79  SVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
           +   D ++   Q  ++ N +L++TI+PRHV+MMS                 A AGPA LV
Sbjct: 139 TTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLV 198

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           IGY IM +CIYCIIQA GEMAV Y  L G FN +P FLVDP  NF++AW+YCIQW CVCP
Sbjct: 199 IGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCP 258

Query: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGF 258
           LELVTASMTIQYWTTKV+ D+FV+IFY+L+L IN FG A+GYAE EFI N+CK+LM+ GF
Sbjct: 259 LELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFG-AKGYAEAEFIFNTCKVLMICGF 317

Query: 259 FILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318
           FIL I I  G AG DG+IG KYW DPGAFRG     RFKGV+ T VTAAF+FG TEF+A+
Sbjct: 318 FILAICIDTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIAL 377

Query: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVL 378
           TA+EQSNPRKAIPSAAKK+IYR L+I+L +II++G LVPYDS +LLGS  +ATKASPYVL
Sbjct: 378 TAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVL 437

Query: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438
           A+S HGVRV  HF+NAVILISV SV +SAFYSSSR+L++LA+QG APK+F +VDR GRP 
Sbjct: 438 AISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPL 497

Query: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498
           +     AVIAV+AFCA S KETEVF WL+AI+GLSQ+FTW  ICLSH+RFRRAMKVQGRS
Sbjct: 498 IAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRS 557

Query: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVL 558
           + E+GY SQ G+ GS YA +MMIL +I Q WV +VP+G  + D  +FF +YLAMP+ IV 
Sbjct: 558 LGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVF 617

Query: 559 YLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           Y GYKIWKRDWRLFIRAKDIDLISHR I+D E+LRQE EEY+EKLRNGP W+RV  FWC
Sbjct: 618 YFGYKIWKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEEYREKLRNGPKWKRVAAFWC 676

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/637 (59%), Positives = 470/637 (73%), Gaps = 33/637 (5%)

Query: 6   GSSKESYEKNDITKSSAKFNDVDVIDIDSA--ERNY----ELPTSSTTHSRFRNFIDSFK 59
           G++  + ++N I     K ND    D  S+   R Y    +    +T  SR RNF+DSFK
Sbjct: 51  GTASITEQENIIEYFGEKSND----DTSSSPVTRQYVSGADFEEHTTKPSRIRNFMDSFK 106

Query: 60  PPE--------TTHHIETDM-NPILSHQS-------VFDDAKVEISQVDDELNEKLKKTI 103
             E           + E+D+ N IL ++           DA++     D+  +++LKKTI
Sbjct: 107 RAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQIN----DNSKSDELKKTI 162

Query: 104 QPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYL 163
           +PRHV+M+S                   AGPAGL+IG+ IM SC+YCIIQAVGE+AV Y 
Sbjct: 163 KPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYS 222

Query: 164 TLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLI 223
            LVGGFNAYP FLVD A  F++AW+Y IQW CVCPLELVTASMTI+YWTTKV+ DIFV+I
Sbjct: 223 DLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIFVII 282

Query: 224 FYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRD 283
           FYIL++ IN+ GGA GYAE EFI NSCKI+MMIGFFILGI +ICGGAG DG+IG KYW D
Sbjct: 283 FYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHD 342

Query: 284 PGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALL 343
           PGA RG     RFKG ++TLV AAF+FG +EF+ +TASEQSNPRKAIPSAAKK+IYR L 
Sbjct: 343 PGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILC 402

Query: 344 IYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSV 403
           ++L+SI IVG LVPY+S +LLGS+ +  KASPYVLA+STHGVRVVPHFINAVILISV SV
Sbjct: 403 MFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILISVLSV 462

Query: 404 ADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVF 463
           A+SA+YSSSRMLL+LA QGYAPK+++++DR GRP +G    A+  V+AFCA S KE EVF
Sbjct: 463 ANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVF 522

Query: 464 NWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILI 523
            WLLAISGLSQ+FTW  IC+SHIRFRRAM VQGRSI E+G++SQVG +GSAYA +MM +I
Sbjct: 523 VWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMI 582

Query: 524 MIGQCWVGIVPVGEG---SADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
           +I Q WV +VP+        D + FF++YLAMP+ +  Y GYKIWK+DW+LFIRAK+IDL
Sbjct: 583 LIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAKNIDL 642

Query: 581 ISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           ISHR+I D E+++QE +EY+E+LR GP WRRVYDFWC
Sbjct: 643 ISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/627 (59%), Positives = 456/627 (72%), Gaps = 29/627 (4%)

Query: 15  NDITKSSAKFNDVDVIDIDSAERNYELP--------TSSTTH----SRFRNFIDSFKPPE 62
           +D   +SA FND     +   E  Y  P        TS+T +    S+FR F+DSFK  E
Sbjct: 2   SDFKDNSADFND----KVSDKEVEYMSPREVSVTPETSATPNTPAPSQFRRFVDSFKRAE 57

Query: 63  TTHHIE-TDMNPILSHQSVFD-------DAKVEISQV----DDELNEKLKKTIQPRHVVM 110
             ++ E T            D       D +V+ +QV     ++ N++LK+TI+PRHV++
Sbjct: 58  QQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVIL 117

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           +S                  +AGPAGL+IGY+IM +C+YCIIQA GE+AV+Y +L GGFN
Sbjct: 118 ISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFN 177

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
            YP FLVDPA  FS+AW+YCIQW CVCPLELVTASMTI+YWTT VNADIFV IFY+L++ 
Sbjct: 178 VYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIV 237

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS 290
           IN FG ARGYAE EF  N CKILMMIGFFILGIVI  GGAGNDG+IG +YW  PGAF G 
Sbjct: 238 INTFG-ARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGD 296

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
              + FKG+++T+VTAAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR L I+L SI 
Sbjct: 297 RPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSIT 356

Query: 351 IVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYS 410
           +VG LVPYDS +L+GS  +ATKASPYVLAVSTHGV+VVPHFINAVIL+SV SV +SAFYS
Sbjct: 357 LVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYS 416

Query: 411 SSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAIS 470
           SSR+L +LA+QG APK F +VDR GRP    +   V A+++FCA S KE +VF WLLAIS
Sbjct: 417 SSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAIS 476

Query: 471 GLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWV 530
           GLSQVFTW  ICLSHIRFR+AM VQ RS+ EIG+K+Q GVWGS Y   M+++I+I Q WV
Sbjct: 477 GLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWV 536

Query: 531 GIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPE 590
            I P+GEG  D Q FF++YLAMP+ I+ Y+GYKIWK+DW LFIRA +IDL  HR I D E
Sbjct: 537 AIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEE 596

Query: 591 ILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +L+QE EEY+EKL+NG   +R+  FWC
Sbjct: 597 LLKQEDEEYREKLKNGGYLKRIAAFWC 623

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/642 (57%), Positives = 445/642 (69%), Gaps = 31/642 (4%)

Query: 6   GSSKESYEKNDITKSSAKFNDVDVIDIDSAERNY---------------EL-PTSSTTHS 49
           GSS E  E  D   +S K +    ID +  E  Y               +L P+     S
Sbjct: 7   GSSNEHIELQDYKGNSEKNSTTVYIDSNENEVEYLSDKDASTSADYTYKDLNPSDKKKKS 66

Query: 50  RFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQ--------------VDDEL 95
             + FIDSFK P   +    D   +   Q++ +     +S                D   
Sbjct: 67  NIKRFIDSFKQPIRPNSDYIDAAELDYEQALENGITTSVSPSAPNLRKLNQLRTPTDAND 126

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           N+ LK+TI+PRHVVM+S                  +AGPAGLVIGY+IM S IYCIIQA 
Sbjct: 127 NKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQAT 186

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA+ Y  L GG+N YP FLV+    F+IAW+YCIQW  VCPLELVTAS+TI+YWTT V
Sbjct: 187 GEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTSV 246

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           N+DIFV IFY L++ IN+FG A+GYAE EF CN CK+LMMIGFFIL I I  GGAGNDG+
Sbjct: 247 NSDIFVAIFYALIIIINVFG-AKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 276 IGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 335
           +GG YW  PGAFRG    + FKG+  TLVTAAF++G TEFLA+TA+EQSNPR AIPSAAK
Sbjct: 306 LGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAK 365

Query: 336 KVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAV 395
           KV+YR + +YL SI+++G LVP+DS+ LLGS  +AT ASPYVLA S HGVRVVPHFINAV
Sbjct: 366 KVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPHFINAV 425

Query: 396 ILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCAC 455
           ILISV SV +SAFYSSSR+L++LARQGYAPK F ++DR GRP+   L+ A+  V+AFCA 
Sbjct: 426 ILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAA 485

Query: 456 SSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAY 515
           S KETEVF WLLAISGLSQ+FTW  ICLSHIRFR AMKVQGRS+ E+GY +Q GVWGS Y
Sbjct: 486 SPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWY 545

Query: 516 AFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRA 575
           A  MM LI I Q WV I P+G G    Q FF++YLAMP+ IVLYLGYKI+ +DW L I+A
Sbjct: 546 ALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIKA 605

Query: 576 KDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +DIDL SHR I D ++L++E  EY+++L+NGP WRRV DFWC
Sbjct: 606 EDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFWC 647

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/610 (60%), Positives = 458/610 (75%), Gaps = 19/610 (3%)

Query: 25  NDVDVIDIDSAERNYELPTSSTTHSR-------FRNFIDSFKPPETTHH-----IETDMN 72
           N+V+    +    N   P  +T  +        F NFID F+  +T H+     +E ++ 
Sbjct: 35  NEVEYFSGEPQGTNESEPHGNTGRNDGSAKGNIFVNFIDGFRR-QTNHNSAAEDLENELT 93

Query: 73  PILSHQSVFDDAKVEISQVDDELN-----EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXX 127
             +S  ++ D  K   S   DEL      E LKK+I+PRHVVM+S               
Sbjct: 94  TCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAK 153

Query: 128 XXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187
               AGPAGL IGYAIM SCIYCIIQA GEMAV Y  LVGGFNAYP FLV P L F++AW
Sbjct: 154 ALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAW 213

Query: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247
           +Y +QW CVCPLELVTASMTI+YWTTKVN D+FV+IFY L++ IN+FG ARGYAE EF  
Sbjct: 214 VYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFYFLIIVINVFG-ARGYAEAEFFF 272

Query: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAA 307
           N CK+LM+ GFFILGI+I CGGAGNDG+IGGKYW DPGAFRG    +RFKGV +TLVTAA
Sbjct: 273 NCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAFRGDKAIDRFKGVAATLVTAA 332

Query: 308 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS 367
           F+FG +EF+A+TASEQSNPRKAIP+AAKK++YR ++I+L SII+VG LVP++S +L+GS 
Sbjct: 333 FAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSD 392

Query: 368 SAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKV 427
           S+ TKASPYV+A+S+HGVRVVPHF+NAVIL+SV SV +SAFYSSSR+L++L++QGYAPK 
Sbjct: 393 SSKTKASPYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKF 452

Query: 428 FTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIR 487
           F ++DR GRP+   ++GA+ AV+AFCA SSKE +VF WLLAISGLSQ+FTWA ICLSHIR
Sbjct: 453 FNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIR 512

Query: 488 FRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQ 547
           FRRAM VQGRS+ EIG+KS++GVWGS YA  MM L++I Q WVG+ P+G    D Q+FF+
Sbjct: 513 FRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFE 572

Query: 548 DYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGP 607
            YLAM + I  Y+GY  WK+DW LFIRAKDIDL  HR I D ++LRQE EE +EKLRNGP
Sbjct: 573 SYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGP 632

Query: 608 VWRRVYDFWC 617
           +W+R+ +FWC
Sbjct: 633 LWKRILNFWC 642

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/577 (61%), Positives = 431/577 (74%), Gaps = 2/577 (0%)

Query: 42  PTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKK 101
           P    T    R F+DSF+  E       D+   L        +K    Q + + +  L+K
Sbjct: 62  PLFGITKPHVRKFVDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQK 121

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
           +I+PRHV+MMS                 + AGP  LVIGY IM SC+YCIIQA GEMAV 
Sbjct: 122 SIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVC 181

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFV 221
           Y  L G FNAYP FLVD  + F +AW+YC+QW CV PLELVTASMTI YWTTKVN+D+FV
Sbjct: 182 YSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFV 241

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281
           +IF++L+  IN FG A+GYAE EF  NSCK+LMM GFFIL IVI  GGAGNDG+IG KYW
Sbjct: 242 VIFFVLITLINTFG-AKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYW 300

Query: 282 RDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 341
            +PGAFRG    +RFK V+ST  TAAF+FG +EF+AI ASEQSNPR+AIPSAAK +IYR 
Sbjct: 301 HNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRI 360

Query: 342 LLIYLASIIIVGLLVPYDSSELLGSSSAATKAS-PYVLAVSTHGVRVVPHFINAVILISV 400
           L I+L SI +VG LVPYDS+ELLGS  +A+  + PYV+AV++HGVRVVPHFINAVIL+SV
Sbjct: 361 LFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSV 420

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
            SVA+SA+YSS R+L +LA+QGYAPK F ++DR GRP+   LV  +  V+AFC+CS KE 
Sbjct: 421 LSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEE 480

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
           +VF WLL+I+GLSQ+FTW  ICLSHIRFRRAMKVQGRS+DEIG+KSQVGVWGS YA +MM
Sbjct: 481 DVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMM 540

Query: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
           IL +I + WV I P+GE   D Q FF++YLAMP+ IVLY GYKI+K+DW+LFIRAKDIDL
Sbjct: 541 ILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDL 600

Query: 581 ISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           ISHR I D E++RQE EEY+EKLRNGP W+RV  FWC
Sbjct: 601 ISHRTIFDGELVRQEEEEYKEKLRNGPKWKRVVAFWC 637

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/609 (57%), Positives = 444/609 (72%), Gaps = 18/609 (2%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIE 68
           KE+     +  S    N+ D ++  S + N          + FR F +SFK    ++   
Sbjct: 23  KENNPGAVVGSSDFTNNETDYLEKTSVQ-NSGFEYLENEGNLFRRFANSFKRAPGSN--- 78

Query: 69  TDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXX 128
              NP           K + S   D+ + KLKKTI+ RHVVM+S                
Sbjct: 79  ---NP----------DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKA 125

Query: 129 XAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWI 188
             + GPAGLVIGYAIM SC+YCIIQA GE+AV Y +L GGFNAYP  L+DPAL FS+AW+
Sbjct: 126 LRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWV 185

Query: 189 YCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICN 248
           YC+QW CV PLELVTAS+TI+YWTT VN DIFV IFY++++ IN+FG ARGYAE EF  N
Sbjct: 186 YCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVVIITINVFG-ARGYAEAEFFFN 244

Query: 249 SCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAF 308
           + K+LM+ GF ILGI++ CGGAGNDG+IGGKYW DPG+F G    + FKGVVSTLVTAAF
Sbjct: 245 TFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSFSGDKPIDHFKGVVSTLVTAAF 304

Query: 309 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSS 368
           +FG TEF+A+TA+EQ+NPRK+IPSAAKK++YR L++Y+ SII++G LVP++S EL+GS  
Sbjct: 305 AFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGG 364

Query: 369 AATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428
           +AT ASPYV+A+++HGV+VVPH INAVIL+SV S+ +SAFYSSSR+LLTLA QGYAP   
Sbjct: 365 SATHASPYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFL 424

Query: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488
            +VDR GRP+L  ++ +V  +++F A S KE  VF WLLAISGLSQ+FTW+ ICLSHIRF
Sbjct: 425 KYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRF 484

Query: 489 RRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQD 548
           RRAMKVQGRS+ E+G+KSQVGVWGS YA  MM+LI+IGQ W  I P+GEG  D +AFF++
Sbjct: 485 RRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFEN 544

Query: 549 YLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPV 608
           YLAMP+ I LY GYK+WKRDW L+I A  IDLIS+R I D ++L+QE  EY+EKLRN   
Sbjct: 545 YLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEYREKLRNSGW 604

Query: 609 WRRVYDFWC 617
            RR  +FWC
Sbjct: 605 LRRAAEFWC 613

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/636 (59%), Positives = 470/636 (73%), Gaps = 28/636 (4%)

Query: 9   KESYEKNDITKS----SAKFNDVDVIDI----DSAERN-YELPTSSTTHSRFRNFIDSFK 59
           K  YE +D        S++ N+V+ +D     DS+  N  + PTS+     F++F+DSF+
Sbjct: 5   KSGYEMSDTKAEAHVFSSQENEVEYLDSQLNGDSSSNNSIKEPTSTGAKGHFKSFVDSFR 64

Query: 60  ----PPETTHHIETDMNPILSHQSVF--------DD------AKVEISQVDDELNEKLKK 101
                    H +E D+   +SH S+         DD      A  E  +V++  ++ L+K
Sbjct: 65  RGDHAKNALHDLENDITTSISHASLVHAVSKAREDDEIMQSVASAEHRKVNNTESDDLQK 124

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
           TI+PRHV+M+S                 + AGPA LVIGY+IM SC+YCIIQA GEMAV 
Sbjct: 125 TIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVV 184

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFV 221
           Y  L GGFN YP FL+DPAL FS+AW+YC+QW CVCPLELVTAS+TI+YWTTKV+ D+FV
Sbjct: 185 YSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTKVDPDVFV 244

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281
           +IFY+L+++IN+FG ARGYAE EF  N CK+LMMIGFFILGI+I  GGAGNDG++G KYW
Sbjct: 245 IIFYVLIISINVFG-ARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYW 303

Query: 282 RDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 341
            +PGAFRG    +RFKGV+ T V AAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR 
Sbjct: 304 HEPGAFRGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRI 363

Query: 342 LLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVF 401
           +LI+L SII++G LVPYDS +LLGSS +  KASPYVLAVS HGVRVVPHFINAVIL+SV 
Sbjct: 364 VLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPHFINAVILLSVL 423

Query: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461
           SV +SAFYSSSR+LL+L++QGYAPK F +VDR GRP+   L+ A+  V+AFCA S KET+
Sbjct: 424 SVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETD 483

Query: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521
           VFNWLLAISGLSQ+FTW  IC+SH+RFR AMKVQGRSI E+G+ SQ GV+GS YA  MMI
Sbjct: 484 VFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMI 543

Query: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581
           L ++ Q WV I P+ EG  D Q FFQ YLAMP+ I LY GYK++ RDW+L+I+A  IDLI
Sbjct: 544 LALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLI 603

Query: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           SHR I D  IL+QE EEY+EKLRNGP WRR+ DFWC
Sbjct: 604 SHRQIFDENILKQEDEEYKEKLRNGPAWRRIADFWC 639

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/593 (59%), Positives = 442/593 (74%), Gaps = 18/593 (3%)

Query: 25  NDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDA 84
           N+ D ++  S + N +        + FR F +SFK    ++      NP           
Sbjct: 39  NETDYLEKTSVQ-NSDFEYLENEGNLFRRFANSFKRAPGSN------NP----------D 81

Query: 85  KVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIM 144
           K + S   D+ + KLKKTI+ RHVVM+S                  + GPAGLVIGYAIM
Sbjct: 82  KEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIM 141

Query: 145 ASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTA 204
            SC+YCIIQA GE+AV Y +L GGFNAYP  L+DPAL FS+AW+YC+QW CV PLELVTA
Sbjct: 142 GSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTA 201

Query: 205 SMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIV 264
           S+TI+YWTT VN DIFV IFY+L +AIN+FG ARGYAE EF  N+CK+LM+ GFFILGI+
Sbjct: 202 SITIKYWTTSVNPDIFVAIFYVLTIAINVFG-ARGYAEAEFFFNTCKVLMITGFFILGII 260

Query: 265 IICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQS 324
           + CGGAGNDG+IGGKYW DPG+F G    + FKGVVSTLVTAAF+FG TEF+A+TA+EQ+
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSFSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQA 320

Query: 325 NPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHG 384
           NPRK+IPSAAKKV+YR ++I+L SI +VG LVP++S EL+GS  +AT ASPYV+A+++HG
Sbjct: 321 NPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHG 380

Query: 385 VRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVG 444
           V+VVPHFINAVIL+SV SV +SAFYSSSR+LL+LA QGYAP    +VDR GRP+L  ++ 
Sbjct: 381 VKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIIS 440

Query: 445 AVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGY 504
           AV  +++F A S KE  VF WLLAISGLSQ+FTW+ ICLSHIRFRRAMKVQGRS+ E+G+
Sbjct: 441 AVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGF 500

Query: 505 KSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKI 564
           KSQVGVWGS YA  MM+LI+IGQ W  I P+GEG  D +AFF++YLAMP+ I LY GYK+
Sbjct: 501 KSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKV 560

Query: 565 WKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           WKRDW L+I A  IDLIS+R I D ++L+QE  E++EKLRN    RR  +FWC
Sbjct: 561 WKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEFREKLRNSGWLRRAAEFWC 613

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/594 (60%), Positives = 440/594 (74%), Gaps = 25/594 (4%)

Query: 48  HSRFRNFIDSFKPPETTHHIET--DMNPI--LSHQSVFDDAKVEISQV---DDEL----- 95
           + RFRN++DSFK  ET +   +  D N +   S Q   +D + + S +   DDEL     
Sbjct: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV 134

Query: 96  ------------NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAI 143
                       N +LK+TI+PRHV+MMS                 A AGPA LVIGY I
Sbjct: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGI 194

Query: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203
           M +C+YCIIQA GE+AV Y  + G FN +P FLVDP  NF++AW+YCIQW CVCPLELVT
Sbjct: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254

Query: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263
           +SMTI+YWTTKV+ D+FV+IFY+L+L IN FG A+GYAE EF  N CK++MMIGFFI+ I
Sbjct: 255 SSMTIKYWTTKVDPDVFVVIFYVLILLINFFG-AKGYAEAEFFFNCCKVMMMIGFFIMAI 313

Query: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323
            I  G AG DG+IG KYW DPGAFRG     RFKGV+ T VTAAF+FG TEF+A+TA+EQ
Sbjct: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQ 373

Query: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383
           SNPRKAIPSAAKKV YR LLI+L SII++G LVPY+S +L+GSSS    ASPYVLA S H
Sbjct: 374 SNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLH 433

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           GV VV HFINAVIL+SV SVA+SAFYSSSR+LL LA+ GYAPK F +VDR GRP    L 
Sbjct: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
            A+IAV+AFCA S KET+VF WLLAISGLSQ+FTW  IC+SHIRFRR M+VQGRS+ E+G
Sbjct: 494 AAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           +++Q GV GS YA +M+ L ++ Q WV +VP+   + D + FFQ+YLAMP+ + LY+G+K
Sbjct: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613

Query: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +W+RD+RLFIRAK+IDLISHR I D E+LRQE EEY+EKLRNGP W+RV DFWC
Sbjct: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/636 (57%), Positives = 458/636 (72%), Gaps = 23/636 (3%)

Query: 3   DTPGSSKESYEKNDITKSSAK-FNDVDVIDI--------DSAERNYELPTSS-------- 45
           D   +S   YE  D +K   + FND++  +I        D +  N +L  +         
Sbjct: 11  DFIDNSNVEYELKDASKLRRRSFNDLENENIVEYFGKSTDQSSSNEDLSYAGRKKWYELG 70

Query: 46  TTHSRFRNFIDSFKPPET----THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKK 101
                 + FIDSFK  E     T H+ET++   LS  S     + +++    E +  L+K
Sbjct: 71  VKEPHLKRFIDSFKRAEEGTEETKHMETELTTTLSPLSA-AIKEHDVAITSKEEDAHLRK 129

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
           +IQPRHV+M S                   AGPAGLVIGYAIM +C+YCIIQA GEMAV+
Sbjct: 130 SIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVS 189

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFV 221
           Y  L G FNAYP FLVD    F++AW+YCIQW CV PLELVTASMTI YWTTKVN DIFV
Sbjct: 190 YSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDIFV 249

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281
           +IFY+L++ IN+FG A+GYAE +F  N+CK+LM+ GFFIL I+I  GGAG  G+IG KYW
Sbjct: 250 VIFYVLIILINVFG-AKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYW 308

Query: 282 RDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 341
            DPGAFRG    +RFK V++T  TAAF+FG +EF+AI ASEQSNPR+AIPSAAK +IYR 
Sbjct: 309 HDPGAFRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRI 368

Query: 342 LLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVF 401
           L I+L+SI +VG LVPYDSSEL+GS S  TKASPYVLA+S+HGVRVVPHFINAVIL++V 
Sbjct: 369 LFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVL 428

Query: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461
           SV++SAFYSS R+L +L++QGYAP+ F ++DR GRP+   ++  +  ++AFCACSSKE E
Sbjct: 429 SVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEE 488

Query: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521
           VF WLLAISGLSQ+FTW  ICLSHIRFRRAM VQGRSI E+G++SQ+GVWGS YA  M+ 
Sbjct: 489 VFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLF 548

Query: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581
           L +I + WV I P+GE   D ++FF++YLAMP+ IV Y GYKI+ RDW+LFIRAK+IDLI
Sbjct: 549 LALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLI 608

Query: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +HR+I D EI+RQE EEY+E+L+NGP W+R+  FWC
Sbjct: 609 THRNIFDAEIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/626 (55%), Positives = 443/626 (70%), Gaps = 33/626 (5%)

Query: 10  ESYEKNDITKSSAK---FNDVDVIDID----SAERNYELPTSSTTHS------RFRNFID 56
           +SYE +D+ K   K    +D++  D +    S + N +  +SS   S        R F+D
Sbjct: 17  DSYELSDVKKPDGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESPAKKKSNLRRFVD 76

Query: 57  SFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXX 116
           SFK  E     +  +N + + +      + E++ V+D     LK+TI+PRHV+M+S    
Sbjct: 77  SFKRAEHMIPADDKINEMTTAEP-----EAEMASVED----NLKQTIKPRHVIMISLGTG 127

Query: 117 XXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFL 176
                          AGPAGLV GYAIM +C+YCIIQ+ GEMAV Y  L GGFNAYP  L
Sbjct: 128 IGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTML 187

Query: 177 VDPALNFSIAWIYCIQWFCVCPLELVTASM-----TIQYWTTKVNADIFVLIFYILVLAI 231
           V+P       W+ C        ++ ++  +       +YWTT+V+ D+FV+IFY+L++ I
Sbjct: 188 VEPGF-----WVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVI 242

Query: 232 NIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSD 291
           N+FG ARGYAE EF  N CK+LMM GFFILGI+I  GGAGNDG++G  YWR+PGAFRG  
Sbjct: 243 NVFG-ARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAFRGDK 301

Query: 292 GPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIII 351
           G + FKGVV+TLVTAAF+FG TEF+A+TA+EQSNPRKAIPSAAKKV+YR +L+YL SII+
Sbjct: 302 GIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIIL 361

Query: 352 VGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSS 411
           +G LVP+ S ELLGS SAAT ASPYV+AV++HGVRVVPHFINAVIL+SV SV +SAFYSS
Sbjct: 362 IGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSS 421

Query: 412 SRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISG 471
           SR+LL+L++QGYAPK F +VDR GRPS   +V A+  V+AFCA S KETEVF WLLAISG
Sbjct: 422 SRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISG 481

Query: 472 LSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVG 531
           LSQ+FTW  ICLSHIRFR AMK QGRS+ E+G+K+Q G+WGS Y+  +MIL +IGQ WV 
Sbjct: 482 LSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVA 541

Query: 532 IVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEI 591
           I P+G      + FF++YLAMP+ I  Y GYKIWK+DW L+I+A+DIDLISHR I D E+
Sbjct: 542 IAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEEL 601

Query: 592 LRQEREEYQEKLRNGPVWRRVYDFWC 617
           L+QE  E +EKL+NGPVWRR+  FWC
Sbjct: 602 LKQEDYELKEKLKNGPVWRRIVAFWC 627

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/624 (53%), Positives = 442/624 (70%), Gaps = 24/624 (3%)

Query: 2   IDTPGSSKESYEKNDITKSSAKF----NDVDVIDIDSAERNYELPTSSTTHSRFRNFIDS 57
           I   GS  +  +K+D    S  F     + +  +   ++ + E    S+   RF+   DS
Sbjct: 13  ISPVGSDVKHNDKSDTIIQSEGFPSIEGEAEYYEKTFSQSDEEYAAKSSVWHRFK---DS 69

Query: 58  FKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEK---LKKTIQPRHVVMMSXX 114
           FK  +   HI T+++          +A++E++     L EK   LK+ I+PRHVVMMS  
Sbjct: 70  FKRAD---HINTNIH---------GNAELELNPSQSLLPEKGASLKRDIKPRHVVMMSLA 117

Query: 115 XXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPG 174
                          A  GPAGL IGYAIM SC+Y IIQA GE+AV Y TL G FN YP 
Sbjct: 118 TGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPS 177

Query: 175 FLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIF 234
           FLVDPA+ F+ A +YCIQW CV PLE+++A++TI+YW T +N +++ +IFY++++ IN+ 
Sbjct: 178 FLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMC 237

Query: 235 GGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN 294
           G A GYAE +F  N+CKILM  GFFILGI+I CGGAG+  +IGGKYW DPGAF G  G +
Sbjct: 238 GSA-GYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFNGDTGIS 296

Query: 295 RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGL 354
           RFK +VSTLVTAAF+FG +E +A+TASEQ+NPRKAIPSAAK+V+YR + IYLASII+VG 
Sbjct: 297 RFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGF 356

Query: 355 LVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRM 414
           LVPY+S EL+GS S++  +SPYV+AV++HGV+VVP FINAVILISV SV + +FYSSSR+
Sbjct: 357 LVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRI 416

Query: 415 LLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQ 474
           LL L+  GYAPK F +VDR GRP    +VGA++  + F + SS E  VF WL+A+SGLSQ
Sbjct: 417 LLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQ 476

Query: 475 VFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVP 534
           +FTW  IC+SH+RFR+AM+VQ RSI E+G++SQVGVWGS Y   MMIL+ IGQ WV + P
Sbjct: 477 LFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFP 536

Query: 535 V-GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILR 593
           V G   AD + FF +YLAMPVF+ LY G+KIWK+DWRL+I A +IDLISHR I D EIL+
Sbjct: 537 VGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEEILK 596

Query: 594 QEREEYQEKLRNGPVWRRVYDFWC 617
           QE EEY+ K+++  +W ++ +FWC
Sbjct: 597 QEDEEYKIKMKHASIWVKLSNFWC 620

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/616 (53%), Positives = 428/616 (69%), Gaps = 44/616 (7%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           +  ES EK  +  S  +++D  V+                  SRF+   +SFK      H
Sbjct: 20  TGSESIEKVSLPASDYQYHDGQVL------------------SRFQRLTNSFK--RAGEH 59

Query: 67  -----IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXX 121
                ++ +  P+   ++                  KLK+TI  RH+ M+S         
Sbjct: 60  GRGGDVDAEGQPVAPRET------------------KLKQTISSRHLFMISLGTGIGTGM 101

Query: 122 XXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPAL 181
                    + GPAGL IGYAIM SCIYCIIQA GEMAV+Y +L G FNAYP  L+DPAL
Sbjct: 102 LVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPAL 161

Query: 182 NFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYA 241
            FS+AW+YC+QW CV PLELVTA++TI+YWTT VN D+FV+IFY+L + +N+FG ARGYA
Sbjct: 162 GFSVAWVYCLQWLCVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFG-ARGYA 220

Query: 242 ETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVS 301
           E EF  N+CK+LM+ GFFILGI++ CGGAGNDG++GGKYW DPGA  G+   + FKG+++
Sbjct: 221 EAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIHHFKGIIA 280

Query: 302 TLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSS 361
           T+VTAAF+FG TEF+A+TA+EQ+NPR+AIPSAAKK++YR LLI+LA II++G LVPY+S 
Sbjct: 281 TMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSD 340

Query: 362 ELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQ 421
           EL+GS  +AT ASPYV+A+++HGV+VVPHFINAVIL+SV SV +SAFYSSSR+LL+L+ Q
Sbjct: 341 ELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQ 400

Query: 422 GYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALI 481
            YAP    ++DR GRP    LV  +  ++AF A S KE  VF WLLAISGLSQ+FTW  I
Sbjct: 401 HYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICI 460

Query: 482 CLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSAD 541
           C+SHIRFR+A+ VQG+S+ E+GYKSQ GV GS YA V+M  ++ GQ WV I PVG    D
Sbjct: 461 CVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLD 520

Query: 542 VQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQE 601
              FF++YLAMP+ I LY GY++WKRDW+L+I  + IDL+SHR + D ++L+QE  EY+E
Sbjct: 521 ANNFFENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEE 580

Query: 602 KLRNGPVWRRVYDFWC 617
            +RN     RV  FWC
Sbjct: 581 SIRNSGWLSRVAHFWC 596

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/599 (55%), Positives = 428/599 (71%), Gaps = 16/599 (2%)

Query: 19  KSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQ 78
           KS+     V+ I +   +  +       + SRFR F  +F   +            L   
Sbjct: 25  KSNTGSESVERISLPGDDYKFH---EDDSKSRFRRFARTFHRADG-----------LGDG 70

Query: 79  SVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
           +  +D +   ++V  +   KLK+TI  RHV MMS                  + GPAGLV
Sbjct: 71  ASGNDVEFG-AEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLV 129

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           IGYAIM SC+YCIIQA GE+AV+Y +L G FNAYP  L++ A  FS+AWIYC+QW CV P
Sbjct: 130 IGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLP 189

Query: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGF 258
           LELVTAS+TI+YWTT VN DIFV IFY+L++ +N+FG ARGYAE EF  N CK+LM+IGF
Sbjct: 190 LELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFG-ARGYAEAEFFFNCCKVLMIIGF 248

Query: 259 FILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318
           FILGI++ CGGAGNDG+IGG+YW +PGAF G+   + FKG++ST+VTAAF+FG TEF+A+
Sbjct: 249 FILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFIAL 308

Query: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVL 378
           TA+EQ+NPR+AIPSAAKKV+YR LLI+LA I+++G LVP++S EL+GS S+AT ASPYV+
Sbjct: 309 TAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVI 368

Query: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438
           AV++HGVRVVPHFINAVIL+SV SV +SAFYSSSR+LL LA Q YAP    F+DR+GRP 
Sbjct: 369 AVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPM 428

Query: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498
              LV  V  +++F A S KE  VF WLLAISGLSQ+FTW  IC+SHIRFR+A+ VQG+ 
Sbjct: 429 RAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKP 488

Query: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVL 558
           I E+GYKSQ GV GS YA  +M  I+IGQ WV I P+G    D  +FF++YLA+P+F+VL
Sbjct: 489 IGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVL 548

Query: 559 YLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           Y G+KIWKRDWRL+I  + IDL SHR   D E+L+QE  EY+E +RN    RR+  +WC
Sbjct: 549 YFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYWC 607

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/611 (53%), Positives = 428/611 (70%), Gaps = 24/611 (3%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFK---PPETTH 65
           +ES      TK+    N V + +    E  +   +  ++ S F  F+DSFK     +TT 
Sbjct: 44  QESSSAKKETKTDESNNAVLIQEKTQEETIHN--SDGSSRSPFGKFVDSFKRVDEKQTTS 101

Query: 66  HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXX 125
            +E+ +  +                     N  LK+TI+ RHV+++S             
Sbjct: 102 DLESGLGEVPGE------------------NSDLKQTIKKRHVLLISLGTGIGTGLLVGN 143

Query: 126 XXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSI 185
                 AGP GLVIGY+IM SC+YCIIQA GE+AV Y +L   FN YP FLVD A  F++
Sbjct: 144 AKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAV 203

Query: 186 AWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEF 245
           AW+YC+QW CVCPLELVTASMTI+YWTT VN DIFV IF++L++ IN FG ARGYAE EF
Sbjct: 204 AWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFG-ARGYAEAEF 262

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVT 305
             NSCK+LMM GFFILGI+I CGGAG  G+IG KYW  PGAF G+   + FKGV++T  T
Sbjct: 263 FFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYWHSPGAFNGNRPIDHFKGVMATFTT 322

Query: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365
           AAF+FG +EF+++TA+EQSNPRKAIP AAK +IYR L ++L+SI ++G LVPY+S  LLG
Sbjct: 323 AAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLG 382

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
           S S ATKASPYV+AV++HGVRVVPHFINAVIL+SV SV +SAFYSSSR+L +LA+QGYAP
Sbjct: 383 SGSDATKASPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAP 442

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           K+FT++D+ GRP +  +   +   +AFCA S KE +VF WLLAISGLSQ+FTW  IC+SH
Sbjct: 443 KMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISH 502

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAF 545
           +RFRRA+KVQG S+ EIG+KSQVG++GS YA  M+IL +I Q WV + P+G    D + F
Sbjct: 503 LRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNF 562

Query: 546 FQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRN 605
           FQ+YLAMP+ +VLY GYKI KRDW+ +I A  IDL+SHR + D +IL+QE  E +++ +N
Sbjct: 563 FQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKN 622

Query: 606 GPVWRRVYDFW 616
               R++ +F+
Sbjct: 623 LSTGRKIQEFF 633

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/601 (52%), Positives = 417/601 (69%), Gaps = 34/601 (5%)

Query: 19  KSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQ 78
           K+SA+ +D + ++ D               +RF+ F+ SFK                +H 
Sbjct: 41  KTSAQKSDFEYLEGDD--------------TRFKRFLSSFKR---------------AHG 71

Query: 79  SVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
           S   D +    Q  +  +E LK+TI+ RH++M+S                    GPAG  
Sbjct: 72  SGGTDTEGGGGQ--NAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSA 129

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           IG+ IM  C+YC+IQA GE+AV Y +L GGFNAYP FL+DPAL F+ AW+YC+QW CV P
Sbjct: 130 IGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFP 189

Query: 199 LELVTASMTIQYW--TTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMI 256
           LELVTAS+TI++W  +  VN DI+V IFY+L++ IN FG ARGYAE EF  NSCK+LMMI
Sbjct: 190 LELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVINFFG-ARGYAEAEFFFNSCKVLMMI 248

Query: 257 GFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFL 316
           GFFI+GI+I  G  G  G+IGGKYWRDPG+  G    + FKG+V+TLV AAFS G +EF+
Sbjct: 249 GFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEFV 308

Query: 317 AITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPY 376
           A+TA+EQ+NPRK+IP+AAKK+IY+  +++L S+I++G LVP DS EL+GS+ +    SPY
Sbjct: 309 ALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPY 368

Query: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436
           V+AV  HGV VVP FINAVIL+SV SV +SAFYSSSR+L +LA Q YAPK+F ++DR GR
Sbjct: 369 VIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGR 428

Query: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496
           P +  ++  +   + F A S KE EVF WLLAISGLSQ+FTW+ ICLSHIRFRRA+ VQG
Sbjct: 429 PLMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQG 488

Query: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFI 556
            S DE+G+K+Q G+ GS  + +MM+L +IGQ WV +VP+G    D ++FF  YLAMP+F+
Sbjct: 489 YSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFL 548

Query: 557 VLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFW 616
           + Y GYKIW +DWRLFIRA  IDL+SHR I D ++L+QE  EY+ KLRN  +W R+ +FW
Sbjct: 549 LFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANFW 608

Query: 617 C 617
           C
Sbjct: 609 C 609

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/614 (51%), Positives = 422/614 (68%), Gaps = 39/614 (6%)

Query: 4   TPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPET 63
           T   + E +EK  + KS  ++ + D                    ++FR F++SFK    
Sbjct: 32  TGSDTTEFFEKASVQKSDFEYFEGD-------------------ETKFRRFVNSFKKAPG 72

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
             + +  +                    D+  +EKLK+TI+PRHVVM+S           
Sbjct: 73  RENDQESLQ-------------------DNNKHEKLKQTIRPRHVVMISLGTGIGTGLLV 113

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                  + GP GL +G+ +M +C+YC+IQA GEMAVNY  L GGFNAYP FLVDP   F
Sbjct: 114 GTGKALYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGF 173

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAET 243
           + AW+YCIQW CV PLELVTAS+TI+YWTT +N DIFV +FY+L++ IN FG ARGYAE 
Sbjct: 174 ATAWLYCIQWLCVFPLELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFG-ARGYAEA 232

Query: 244 EFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTL 303
           EF  N+CK+LM+IGFFI+GI++  G AGNDG+IG KYWR+PG+F G    + FKGVVSTL
Sbjct: 233 EFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGGHTAIDHFKGVVSTL 292

Query: 304 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL 363
           V AAFS G +EF+A+TA+EQ+NPRK++PSAAKK++Y+  +++L S+ ++G LVP +SSEL
Sbjct: 293 VNAAFSLGCSEFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSEL 352

Query: 364 LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGY 423
           +GS+ ++   SPYV+AV++HGVRVVPHFINAVIL+SV SV +SAFYSSSR+LL+LA QGY
Sbjct: 353 MGSTDSSVHVSPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGY 412

Query: 424 APKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICL 483
           AP VF ++DR GRP +  +V   +  + F A S KE  VF WLLAISGLSQ+FTW  IC+
Sbjct: 413 APPVFKYIDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICI 472

Query: 484 SHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQ 543
           SHIRFR+A+ VQGR  D +G+K+Q GVWGS Y+ V+MIL  I Q W  ++P+G    + +
Sbjct: 473 SHIRFRKALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAE 532

Query: 544 AFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKL 603
           +FF+ YLA P+F+ LY GYKI+ ++W+LFI A+ IDL  HR I D ++L+QE  EY+ KL
Sbjct: 533 SFFEGYLAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYRAKL 592

Query: 604 RNGPVWRRVYDFWC 617
           R+  +W R+   WC
Sbjct: 593 RDSSMWHRIAALWC 606

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/594 (52%), Positives = 426/594 (71%), Gaps = 9/594 (1%)

Query: 24  FNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDD 83
           F+ V+V+   S        +  +    F  F+DSFK PE  ++    ++   +H+ V  +
Sbjct: 20  FDSVEVVKETSPR------SEGSRDGLFHRFVDSFKRPEEEYNGGDGIHS--THERVSGE 71

Query: 84  AKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAI 143
               ++  D   ++ LK+ I+PRHV+M+S                  + GPA L+IGYAI
Sbjct: 72  DFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAI 131

Query: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203
           +++ +YC+IQ+  E+A+ Y +L GGFNAYP  LVD A  FS++W+YC+QW C+ PLELVT
Sbjct: 132 VSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVT 191

Query: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263
           ASMTI+YW   +N D FV+IFY++++ IN F GA GYAE EF  N+CK+LM+IGFFILGI
Sbjct: 192 ASMTIKYWNDSINPDAFVVIFYVVLIVIN-FIGAAGYAEAEFFFNTCKVLMLIGFFILGI 250

Query: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323
           ++ CGGAGNDG++G  YW DPGAFRG++G NRFKG+V+ LV AAF++G  EF  +TA+EQ
Sbjct: 251 IVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310

Query: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383
            NP+K+I SA+KK++YR + IYL +  ++G LVPY+S ELLGS SAAT ASP+V+A+++H
Sbjct: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASH 370

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           GV+VVPH INAVIL+SV SVA+SA YSSSR+LL+L+ QG+APK+F +VDR GRP    LV
Sbjct: 371 GVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLV 430

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
             V  ++ F A S KE  VF WLLAISGLS++FTW  I LSH+RFRR+M VQGRS+DE+G
Sbjct: 431 SCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELG 490

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           Y+S  GVWG+ YA +M++LI+IGQ WV I PVG    D   FF++YLAMP+ I LYLGYK
Sbjct: 491 YQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550

Query: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +W RDWR+ I A ++DL+SHR I D EI++ E+ E +E+LR+    +R  +FWC
Sbjct: 551 LWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/632 (51%), Positives = 435/632 (68%), Gaps = 24/632 (3%)

Query: 5   PGSSKESYEKNDI------TKSSAKFNDVDVIDIDSAERNYE-------LPTSSTTHSR- 50
           P  +   YE  D+         S   N+V+  D     R Y         PT   +  R 
Sbjct: 3   PEDTITPYELQDVKGEAVSASRSPPDNEVEYFDKLGDARQYTSNLEGEGTPTEGVSRHRI 62

Query: 51  ----FRNFIDSFKPPETTHHI---ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTI 103
               FRNFIDSFK  ETT  I   E D+   +S Q       +   +V  +  E+LK+ I
Sbjct: 63  KNPLFRNFIDSFKRGETTARIADLENDLTTAVSPQLSNYHGSIPSDEVVIK-KEELKRDI 121

Query: 104 QPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYL 163
             RH+V M+                   AGPAGL+IGYA+M +C+YC+IQA GE+ V Y 
Sbjct: 122 NQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYA 181

Query: 164 TLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLI 223
            L+GGFNAYP  LV P+  FS+ WIY +QW C+ PLELVTAS+TI+YWTTKV+ D+FV+I
Sbjct: 182 NLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVFVVI 241

Query: 224 FYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRD 283
           FY+L+L IN FG ++GYAE +F  N  K+ M+ GFFILGIV+ CGGAG+DG++GGKYW +
Sbjct: 242 FYLLILLINFFG-SKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHN 300

Query: 284 PGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALL 343
           PGAFRG    + FKGV S  VT+AF+FG +EF+A++ASEQ+NPRK+IPSAAK ++YR + 
Sbjct: 301 PGAFRGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIW 360

Query: 344 IYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSV 403
           +YL SI I+G LVP+DS +L  SS    K SPYV+A++ HGV+VVPH INAVIL++V SV
Sbjct: 361 VYLTSITILGFLVPWDSPQLQPSSDG-KKTSPYVVAIAMHGVKVVPHLINAVILMAVLSV 419

Query: 404 ADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVF 463
           ++SAF+ SSR+LL+L+++GYAPK F +VDR GRP    L+ A+  V+ FCA S KET+VF
Sbjct: 420 SNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVF 479

Query: 464 NWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILI 523
           +WLLAISGLS +FT+  IC+SHIR R AMKVQGRS+ E+G++SQVG +GS YA ++++L 
Sbjct: 480 SWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVLS 539

Query: 524 MIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISH 583
           ++ + WV + P+GEG  D ++FF++YLA P+ IV Y GY IWK+D+R+FIR+KDIDL   
Sbjct: 540 LMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFK 599

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDF 615
           R + D ++++QE EEY E++RN P WR+V  F
Sbjct: 600 RQVFDEDLIKQEDEEYAEQMRNAPRWRKVIAF 631

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/596 (53%), Positives = 417/596 (69%), Gaps = 17/596 (2%)

Query: 23  KFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFD 82
            F+ V+V+  +S        + S +   FR F DSF+  E  +                D
Sbjct: 19  SFDSVEVLKEESPR------SDSRSDGLFRRFADSFRRHEAHNGGGG---------DGDD 63

Query: 83  DAKVEISQVDDELNEK-LKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGY 141
           +    ++ ++     K LK+ I+PRHV+M+S                  + GPA LVIGY
Sbjct: 64  EDHEGLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGY 123

Query: 142 AIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLEL 201
           AI++S +YC+IQ+  E+A+ Y +L GGFNAYP  LVD A  FS++W+YC+QW CV PLEL
Sbjct: 124 AIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLEL 183

Query: 202 VTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFIL 261
           VTASMTI+YW   +N D FV IFY++++AIN F GA GYAE EF  N CK+LM+IGFFIL
Sbjct: 184 VTASMTIKYWNQTINPDAFVTIFYVVLVAIN-FVGAAGYAEAEFFFNCCKVLMIIGFFIL 242

Query: 262 GIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITAS 321
           GI+I CGGAGNDG++G +YW DPGAFRGSD  NRFKG+V+ LV AAF++G  EF  +TA+
Sbjct: 243 GIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAA 302

Query: 322 EQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVS 381
           EQ NP+K+I SA+KK++YR L IY+ + I++G LVP++S ELLGS  +AT ASP+V+AV+
Sbjct: 303 EQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVA 362

Query: 382 THGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGF 441
           +HGVRVVPHFINAVIL+SV SVA+SA YSSSR+LL+L+ QG+AP+   +VDR GRP L  
Sbjct: 363 SHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCL 422

Query: 442 LVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDE 501
           LV  V  +++F A S KE  VF WLLAISGLS++FTW  I LSH+R RRAM VQGRS DE
Sbjct: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482

Query: 502 IGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLG 561
           +GY +  GVWG+ YA  M++ I++GQ WV I PVG    D   FF++YLAMP+ I LYLG
Sbjct: 483 LGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542

Query: 562 YKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           YKIW RDWRL I + ++DL++HR I D E+LR E+ E +E+LR+ P   R+ +FWC
Sbjct: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/621 (47%), Positives = 407/621 (65%), Gaps = 21/621 (3%)

Query: 1   MIDTPGSSKESYEKN---DITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDS 57
           M+D P  +    EKN   ++T  SA +N+ +     S  +  +  +  + +     F+DS
Sbjct: 1   MLD-PIVTSSKTEKNAEFEVT-DSALYNNFNTSTTASLSQEVKEHSEESRNGLVHRFVDS 58

Query: 58  FKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXX 117
           FK  E+  H+E             DD  +E      + N +LKK+++ RHVVMMS     
Sbjct: 59  FKRAES-QHLE-------------DDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGI 104

Query: 118 XXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLV 177
                         AGP  LVIGY +++   Y ++QA GEM V Y TL G FNAY    +
Sbjct: 105 GTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFI 164

Query: 178 DPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGA 237
             +  F+  WI+CIQW  V PLEL+T+SMTI+YW  K+N+D+F++IFY+ +L I+ FG  
Sbjct: 165 SKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFG-V 223

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFK 297
           + Y ETEFI +SCKILM+ GF IL +VI CGGAG DG+IGGKYWRDPG+F   +G  RFK
Sbjct: 224 KAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGNGATRFK 283

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G+   LVTA FSFG  E   ++ +EQSNPRK+ P AAK+ +YR L+IYL ++I++G  VP
Sbjct: 284 GICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVP 343

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           +++ +L+GS SAAT ASPYVLA S H VRVVPH INAVILISV SVA+SA Y++ R++ +
Sbjct: 344 HNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCS 403

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA+QGYAPK   ++DR GRP     V  ++ V+ F ACS +E + F WL AI+GLS++FT
Sbjct: 404 LAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFT 463

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W+ I LSHIRFR+AMKVQGRS+DE+GYK+  G+WGS Y     IL+ + Q WV + P+G 
Sbjct: 464 WSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGN 523

Query: 538 -GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQER 596
            G  + QAFF+ YLA P+++ +YLGY +++RD+        IDL  HR ++DPEI+RQE 
Sbjct: 524 GGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQEN 583

Query: 597 EEYQEKLRNGPVWRRVYDFWC 617
           EE +E+L+N   + R+Y+FWC
Sbjct: 584 EENKERLKNSSFFFRIYNFWC 604

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/570 (51%), Positives = 392/570 (68%), Gaps = 33/570 (5%)

Query: 51  FRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDEL--NEKLKKTIQPRHV 108
           FR+F+DSFK  +                   DD   ++   D+E   + K+KKTI+ RH+
Sbjct: 36  FRDFVDSFKKKQ-------------------DD---DVVGYDEETGTSSKMKKTIKSRHL 73

Query: 109 VMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGG 168
           +M+S                 A AGP GL+IGY + ++ +YCIIQA GE+ + Y  + G 
Sbjct: 74  LMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGELGICYSGMTGN 133

Query: 169 FNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILV 228
           + AY   LVDPAL FS++W+YCIQW  V PL+LVTA++TI+YWT   N DIFV I Y L+
Sbjct: 134 YTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWT-DTNPDIFVAILYFLI 192

Query: 229 LAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR 288
           + IN+FG A+GYAE EF+ N+CK+LMM+GF ILGI+I CGGAGNDG+IG +YW  PGAF 
Sbjct: 193 VFINLFG-AKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIGARYWHTPGAFS 251

Query: 289 GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLAS 348
                  FKGV      AAF++G  E + +TASEQ NPRK+IPSA KKVIYR LLIY+ +
Sbjct: 252 -----TGFKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLT 306

Query: 349 IIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAF 408
            +IV  LVPYD+ EL  S+ +A++ASP+V+A+++HG+ VVPH INAVIL++V SV +S+ 
Sbjct: 307 TLIVCFLVPYDAPELT-STGSASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSL 365

Query: 409 YSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLA 468
           YS+ R+LL+L+ QGYAPKVF +VDR GRP L FLV   + ++AF A S  E +VF+WLLA
Sbjct: 366 YSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLA 425

Query: 469 ISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQC 528
           ISGLSQ+F W  ICLSH+RFR AMK QGRS+ E+GYKSQ G WGS +A ++ + +++ Q 
Sbjct: 426 ISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQF 485

Query: 529 WVGIVPVGEGSA-DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIH 587
           WV I P+G G     + FFQ YLA PV I +Y GYKI+ +DWRL I A ++DL SHR I 
Sbjct: 486 WVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIF 545

Query: 588 DPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           D + L+QE  +++EK+R   +W ++Y FWC
Sbjct: 546 DEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/622 (48%), Positives = 403/622 (64%), Gaps = 33/622 (5%)

Query: 2   IDTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSR--FRNFIDSFK 59
           +++   ++ S E N IT S+ K  +V        E+    P ++    R  F  F+DSFK
Sbjct: 1   MESSKKNETSPEVNSITSSTLKTPNV-------TEKFEPYPDTTAVKHRTHFNRFVDSFK 53

Query: 60  PPETTHH---IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXX 116
             E  H+   +E   N I               Q DD     LKK ++ RHV+MMS    
Sbjct: 54  RAEVNHNGIDLEDGTNSI---------------QSDD----NLKKAMKSRHVIMMSLGTG 94

Query: 117 XXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFL 176
                          AGPA LVIGY +++   Y +IQA GEMAV Y TL GGFN Y    
Sbjct: 95  IGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIF 154

Query: 177 VDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGG 236
           V     F+  W++CIQW  V PLEL+TASMTI+YW  K+NAD+FV+I Y+ +L I+ FG 
Sbjct: 155 VSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFG- 213

Query: 237 ARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRF 296
            R Y E EFI NSCKILM+ GF IL IV+ CGGAG DG+IGGKYWRDPGAF   +  +RF
Sbjct: 214 VRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRF 273

Query: 297 KGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356
           KGV   LVTA FS+G  E  A++ +EQ NPR++ P+AAK+ IYR L+IYL ++I++G  V
Sbjct: 274 KGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNV 333

Query: 357 PYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLL 416
           P++S +L+G+  +AT ASPYVLAVS HGV+VVPH INAVILISV SVA+SA Y+S R+L 
Sbjct: 334 PHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLR 393

Query: 417 TLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVF 476
           +LA QGYAPK F +VDR GRP    ++ ++  V+AFCACS +E  +F WL AI+GLS++F
Sbjct: 394 SLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453

Query: 477 TWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG 536
           TW+ I LSH+RFR AMK QG+S++E+GY S  G+WGS Y     +L+ I Q WV + P G
Sbjct: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513

Query: 537 -EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQE 595
            +G    +AFF+ YLA PV++  YLGY ++ RD+      K IDL +HR ++DPE+LRQE
Sbjct: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573

Query: 596 REEYQEKLRNGPVWRRVYDFWC 617
            EE +E++RNG   +++ +FWC
Sbjct: 574 DEETKERIRNGGWTQKLLNFWC 595

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/605 (48%), Positives = 398/605 (65%), Gaps = 19/605 (3%)

Query: 16  DITKSSAKFNDVDV-IDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPI 74
           D++  + K N + V I ID+   +       + H   RNF+DSFK  E            
Sbjct: 6   DLSAKNTKSNTIAVEIPIDTESVH-------SQHGFVRNFMDSFKRAE-------PQGQT 51

Query: 75  LSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGP 134
           +  + + +  +   +   +   +K+K+T++ RH+ M+S                    GP
Sbjct: 52  IREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGP 111

Query: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194
            GLVIGY   ++ +YC+IQA  E+ V+Y TL G +N+YP FLVD   NF++AW+Y +QW 
Sbjct: 112 GGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWA 171

Query: 195 CVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILM 254
            V PLELVT+SMTI+YW   +N D+FV IFY  ++ I+ FG ++GYAE+EFI NSCK+LM
Sbjct: 172 IVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFG-SQGYAESEFIFNSCKVLM 230

Query: 255 MIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTE 314
           M+GF I+GI + CG A   G+IGGKYW  PGAF G    + FKG+ S  V +AF++G +E
Sbjct: 231 MVGFIIMGISVNCG-ASKSGYIGGKYWHTPGAFVGEKAIDHFKGICSVWVQSAFAYGGSE 289

Query: 315 FLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS-SSAATKA 373
           F+A+TA+EQ+NPRK++P A K+ +YR L+++L  II+VG LVPYDS  LLGS   AA+ A
Sbjct: 290 FIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHA 349

Query: 374 SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDR 433
           SP+V+A ++HGV+VVPH INAVILISV SV +SAFYS+ R+LL+LA QG  PKVFT+VDR
Sbjct: 350 SPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDR 409

Query: 434 TGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMK 493
            GRP +  L  A+  +++F A S  E  VF WL AI  LSQ+FTW+ I LSHIRFR AMK
Sbjct: 410 KGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMK 469

Query: 494 VQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA-DVQAFFQDYLAM 552
            QGRS+ E+GYK+  G WGS YA    I+++  Q WV I P+G G   DV  FFQ+YLA 
Sbjct: 470 TQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAF 529

Query: 553 PVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRV 612
           PV +  Y GYK+W RDW+LFI A  +DL SHR I D ++++QE  E++E++RN   W R 
Sbjct: 530 PVLVFFYFGYKLWYRDWKLFIPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFWVRA 589

Query: 613 YDFWC 617
            DFWC
Sbjct: 590 LDFWC 594

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/609 (46%), Positives = 405/609 (66%), Gaps = 16/609 (2%)

Query: 10  ESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIET 69
           +S+ K   + S A      ++  +S   +     +S T   FRNFIDS+K          
Sbjct: 3   DSFPKETKSPSYASSEHSSIVSANSYNSS---AGNSKTRGYFRNFIDSYK---------- 49

Query: 70  DMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXX 129
             +P   H +  +D +  I+ +  +   + KK++  RHV+MMS                 
Sbjct: 50  RADPSQLHNARSEDVEDGIASIRSD--TQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGL 107

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIY 189
            + GP  L+IGY +++   Y +IQA GEMAV Y TL G FNAY    +  +  F+  W++
Sbjct: 108 YYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLF 167

Query: 190 CIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
           CIQW  V PLEL+T+S+TI+YW  K+NADIFV+IFY+ ++AI++ GG R Y ETEF+ NS
Sbjct: 168 CIQWLTVLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNS 227

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFS 309
           CKILM+IGF IL IVI  GGAGNDG+IGGKYW +PG+F   D  +RFKG+   LV+  FS
Sbjct: 228 CKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATSRFKGICLVLVSGYFS 287

Query: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369
           +G TE   ++ +EQ+ PRKA P+AAKK IYR L+IYL ++I++G  VP+++ +L+G+  +
Sbjct: 288 YGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGS 347

Query: 370 ATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFT 429
           AT ASPYVLA + HGV++VPHFINAVILISV SVA+S+ ++  R+L +LA QGYAPK+ +
Sbjct: 348 ATHASPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILS 407

Query: 430 FVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFR 489
           +VDR GRP +   +  +I ++AF +C+S E EVF WL AI+GLS++FTW+ I  SH+RFR
Sbjct: 408 YVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFR 467

Query: 490 RAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA-DVQAFFQD 548
            AMKVQG+ I+E+GYK+  GVWGSAY     +L++I Q WV + P+G G   D +AFF+ 
Sbjct: 468 AAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFES 527

Query: 549 YLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPV 608
           YLA P+++  Y GY I+ +D+ L      IDL S+R I+DPE+++QE EE +E L++ P+
Sbjct: 528 YLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSRPL 587

Query: 609 WRRVYDFWC 617
           + ++Y FWC
Sbjct: 588 YYKIYRFWC 596

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/614 (47%), Positives = 395/614 (64%), Gaps = 13/614 (2%)

Query: 12  YEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP----PETTHHI 67
           Y ++D  K +   ND    D D+     E P +   H     F+DSFK     P      
Sbjct: 26  YSRDDGEKYAGNSNDYSQRDSDNTSIESE-PRTKLVH----RFVDSFKRAQDVPTGRKSK 80

Query: 68  ETDMNPILSHQSVFDDAKVEISQVDDE---LNEKLKKTIQPRHVVMMSXXXXXXXXXXXX 124
           E   N     +  F++  +++   D +    N  LKK ++ RHV+MMS            
Sbjct: 81  EIGNNGGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVA 140

Query: 125 XXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFS 184
                   GPA LVIGY +++   Y +IQA GEMAV Y TL G FNAY    V  A  F+
Sbjct: 141 NAKGLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFA 200

Query: 185 IAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETE 244
             WI+CIQW  V PLEL+TAS+TI+YW  K+NAD+F++IFY+ +L I++FGG   Y ETE
Sbjct: 201 TVWIFCIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETE 260

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLV 304
           F+ N CKILM+IGF I+ IVI  GGAGN  +IGGK+W DPGAF G    +RFKG+   LV
Sbjct: 261 FLFNLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLV 320

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
           +  FS+G TE  A++ +EQSNPR++ P A+K  +YR L+IYL ++I++G  VPYDS EL+
Sbjct: 321 SGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELM 380

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
           GS  +AT ASPYVLA S +GV++ PHFINAVILISV SVA+S+ Y++ R++ +LA+QGYA
Sbjct: 381 GSGGSATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYA 440

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           PK   +VDR GRP L  +   ++ V+ F A S KE EVF WL AI+GLS++FTW+ I LS
Sbjct: 441 PKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLS 500

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV-GEGSADVQ 543
           H+RFR AMK+Q RS++E+GYK+  G++GS Y     +L+   Q W  + P  G+G A+  
Sbjct: 501 HVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANAN 560

Query: 544 AFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKL 603
           +FF +YLAMP+++V Y GY +W RD++L      IDL  HR I+DPE++RQE EE +E+L
Sbjct: 561 SFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERL 620

Query: 604 RNGPVWRRVYDFWC 617
           RNG    R+Y FWC
Sbjct: 621 RNGSFMMRMYHFWC 634

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/565 (50%), Positives = 382/565 (67%), Gaps = 16/565 (2%)

Query: 54  FIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSX 113
           F+DSF+  E+              Q + DD  +E        N  LKK+++ RHVVMMS 
Sbjct: 55  FVDSFRRAES--------------QRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSL 100

Query: 114 XXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYP 173
                             AGP  LVIGY +++   Y ++QA GEM V Y TL G FNAY 
Sbjct: 101 GTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYN 160

Query: 174 GFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINI 233
              V  +  F+  W++CIQW  V PLEL+T+SMTI+YW   +NAD+F+ IFY+ +L I+ 
Sbjct: 161 SIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHF 220

Query: 234 FGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGP 293
           FG  + Y ETEFI NSCKILM+ GF IL ++I CGGAG DG+IGG+YWR+PG+F      
Sbjct: 221 FG-VKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSA 279

Query: 294 NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVG 353
            RFKG+   LVTA FSFG  E   ++ +EQ+NPRK+ P AAK+ IYR L+IYL ++I++G
Sbjct: 280 TRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIG 339

Query: 354 LLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSR 413
             VP+D+ +L+GS S+AT ASPYVLA S HGV+V+PH INAVILISV SVA+SA Y++ R
Sbjct: 340 FNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPR 399

Query: 414 MLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLS 473
           ++ +LA+QGYAPK   ++DR GRP    +V + + ++ F ACSS+E + F WL AI+GLS
Sbjct: 400 LMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLS 459

Query: 474 QVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIV 533
           ++FTW+ I LSHIRFR+AMKVQGRS+DE+GYKS  G+WGS Y  +  IL+ + Q WV + 
Sbjct: 460 EIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALS 519

Query: 534 PVG-EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEIL 592
           P G +G  DV++FFQ YLA P++I +YLGY I+ +D+ L      IDL  HR ++DPEI+
Sbjct: 520 PPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIM 579

Query: 593 RQEREEYQEKLRNGPVWRRVYDFWC 617
           RQE EE +E+LRN  V+ R+Y+ WC
Sbjct: 580 RQEDEENKERLRNSSVFFRMYNMWC 604

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/602 (47%), Positives = 398/602 (66%), Gaps = 15/602 (2%)

Query: 29  VIDIDSAERNYELP-TSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSV--FDDAK 85
           ++     E++ E   T S  ++ F     +   PE   H E   N ++ H+ V  F  A+
Sbjct: 5   IVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLV-HRFVDSFRRAE 63

Query: 86  VEISQVDDEL---------NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAG 136
            +  + D++L         N  LKK+++ RHVVMMS                 + AGP  
Sbjct: 64  SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGS 123

Query: 137 LVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCV 196
           LVIGY +++   Y ++QA GEM V Y TL G FNAY    +  +  F+  W++CIQW  V
Sbjct: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183

Query: 197 CPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMI 256
            PLEL+T+SMT++YW   +NAD+F++IFY+ +L I+ FG  + Y ETEFI NSCKILM+ 
Sbjct: 184 LPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFG-VKAYGETEFIFNSCKILMVA 242

Query: 257 GFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFL 316
           GF IL +VI CGGAG DG+IGGKYWRDPG+F    G  RFKG+   LV+A FSFG  E  
Sbjct: 243 GFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELF 302

Query: 317 AITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPY 376
            ++ +EQSNPRK+ P AAK+ +YR L+IYL ++I++G  VP+++ +L+GS  +AT ASPY
Sbjct: 303 VLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPY 362

Query: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436
           VLA S H VRV+PH INAVILISV SVA+SA Y++ R++ +LA+QGYAPK   ++DR GR
Sbjct: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422

Query: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496
           P    +V +++ V+ F ACS +E + F WL AI+GLS++FTW+ I LSHIRFR+AMKVQG
Sbjct: 423 PLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482

Query: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVF 555
           RS+DE+GYK+  G+WGS Y     +L+ + Q WV + P+G  G  D QAFF+ YLA P++
Sbjct: 483 RSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLW 542

Query: 556 IVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDF 615
           I +Y+GY ++KRD+        IDL  HR ++DPEI+RQE EE +E+L+N  ++ RVY F
Sbjct: 543 IFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRVYKF 602

Query: 616 WC 617
           WC
Sbjct: 603 WC 604

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/595 (48%), Positives = 394/595 (66%), Gaps = 15/595 (2%)

Query: 36  ERNYELP-TSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSV--FDDAKVEISQVD 92
           E+N E   T S  ++ F     +   PE   H E   N ++ H+ V  F  A+ +  + +
Sbjct: 12  EKNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLV-HRFVDSFRRAESQCLEEN 70

Query: 93  DEL---------NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAI 143
           ++L         N  LKK+++ RHVVMMS                   AGP  LVIGY +
Sbjct: 71  NDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVL 130

Query: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203
           ++   Y ++QA GEM V Y TL G FNAY    +  +  F+  W++CIQW  V PLEL+T
Sbjct: 131 VSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190

Query: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263
           +SMTI+YW   +NAD+F++IFY+ +L I+ FG  + Y ETEFI NSCKILM+ GF IL +
Sbjct: 191 SSMTIKYWNDSINADVFIVIFYVFLLFIHFFG-VKAYGETEFIFNSCKILMVAGFIILSV 249

Query: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323
           VI CGGAG DG+IGGKYWRDPG+F       RFKG+   LVTA FSFG  E   ++ +EQ
Sbjct: 250 VINCGGAGVDGYIGGKYWRDPGSFADGSNATRFKGICFILVTAYFSFGGIELFVLSINEQ 309

Query: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383
           SN RK+ P AAK+ +YR L+IYL ++I++G  VP+++ +L+GS SAAT ASPYVLA S H
Sbjct: 310 SNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIH 369

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
            VRV+PH INAVILISV SVA+SA Y++ R++ +LA+QGYAP+   ++DR GRP     V
Sbjct: 370 KVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAV 429

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
            A++ V+ F ACS +E + F WL AI+GLS++FTW+ I LSHIRFR+AMKVQGRS+ E+G
Sbjct: 430 CALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELG 489

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGY 562
           YK+  G+WGS Y     IL+ + Q WV + P+G  G  DVQAFF+ YLA P++I +YLGY
Sbjct: 490 YKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGY 549

Query: 563 KIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            ++ +D+ L      IDL  HR ++DPEI+RQE EE +EKLRN  ++ R+Y+FWC
Sbjct: 550 MLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKEKLRNSSIFFRMYNFWC 604

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/618 (48%), Positives = 396/618 (64%), Gaps = 17/618 (2%)

Query: 3   DTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPE 62
           D   S K+    + I+  S  F+ V+ +   S+E+NY   T+       R F+DSFK  E
Sbjct: 6   DFGSSGKKEASPDSISIRS--FSAVNNLQSSSSEKNYSGQTTRNNKLIHR-FVDSFKRAE 62

Query: 63  --TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXX 120
             TTH  + + N          D + +++    +   KLKK+++ RHVVMM+        
Sbjct: 63  GSTTHTKQINENT--------SDLEGDVNSFTSD--SKLKKSMKSRHVVMMTLGTGIGTG 112

Query: 121 XXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180
                     + GPA LVIGY +++   Y +IQA GEMAV Y TL   FNAY    +   
Sbjct: 113 LLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKP 172

Query: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240
             F+  W+YC QW  V PLEL+TA+MTI++W   +N DIF+LIF++ +L I+ FG  +GY
Sbjct: 173 FGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFG-VKGY 231

Query: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV 300
            ETEFI N CKILM+ GF IL +VI CGGAGNDG+IGGKYWR+PGAF G     RFK V 
Sbjct: 232 GETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAFAGDTSAGRFKNVC 291

Query: 301 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360
             LVTA FSFG  E  A++  EQ+NPRK  P AAK+ IYR L+IYL ++I++G  VPY+ 
Sbjct: 292 YILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYND 351

Query: 361 SELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420
            +L+G+  +AT ASPYVLA S HGV+VVPH INAVILISV SVA+S+ Y+  R++ +LA+
Sbjct: 352 DQLMGAGGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQ 411

Query: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480
           QGY PK   +VDR GRP +  +V +V  V+ F A SSKE  VF WL AI+GLS++FTW  
Sbjct: 412 QGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTS 471

Query: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GS 539
           I LSH+RFR+AMKVQGRS+DE+GYK+  G+WGSAY     IL+ I Q WV + P+   G 
Sbjct: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGK 531

Query: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599
              ++FFQ YLA P++I  YLGY I+ RD+        IDL  HRHI+DPE++RQE  E 
Sbjct: 532 CSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLEN 591

Query: 600 QEKLRNGPVWRRVYDFWC 617
           +E+ R+  + R+ Y FWC
Sbjct: 592 EERKRDMSLMRKTYHFWC 609

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/613 (48%), Positives = 392/613 (63%), Gaps = 20/613 (3%)

Query: 16  DITKSSAKFNDVDVIDIDS--AERNYELPTSSTTHSRFRN--------FIDSFKPPETTH 65
           D   S  K    D I I S  A  N++  +S  T+S+ ++        F DSFK  E + 
Sbjct: 6   DFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGS- 64

Query: 66  HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXX 125
              T    I  + S  +D    I+      + KLKK+++ RHVVMMS             
Sbjct: 65  --TTRTKQINENTSDLEDGVESITS-----DSKLKKSMKSRHVVMMSLGTGIGTGLLVAN 117

Query: 126 XXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSI 185
                + GPA L+IGY +++   Y +IQA GEMAV Y TL   FNAY    +  +  F+ 
Sbjct: 118 AKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFAT 177

Query: 186 AWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEF 245
            W+YC QW  V PLEL+TASMTIQ+W  K+N DI++LIFY+ ++ I+ FG  + Y ETEF
Sbjct: 178 VWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFG-VKAYGETEF 236

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVT 305
           I N CKILM+ GF IL IVI CGGAGNDG+IG  YW +PGAF G     RFK V   LVT
Sbjct: 237 IFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVT 296

Query: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365
           A FSFG  E  A++  EQSNPRK+ P AAK+ IYR ++IYL ++I++G  VPY+  +L+G
Sbjct: 297 AYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMG 356

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
           +  +AT ASPYVLA S HGV++VPH INAVILISV SVA+S+ Y+  R++ +LA+QGYAP
Sbjct: 357 AGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAP 416

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           K   +VDR GRP    +V  V  V+AF A SSKE  VF WL AI+GLS++FTW  I LSH
Sbjct: 417 KFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSH 476

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQA 544
           +RFR+AMKVQGRS+DE+GYK+  G+WGS Y     IL+ + Q WV + P+G  G  D ++
Sbjct: 477 LRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAES 536

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
           FFQ+YLA P+++  Y GY ++ RD+ L      IDL  HR I+DPE++RQE EE +EKLR
Sbjct: 537 FFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLR 596

Query: 605 NGPVWRRVYDFWC 617
           N  + R+ Y FWC
Sbjct: 597 NMSLMRKAYHFWC 609

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/540 (52%), Positives = 381/540 (70%), Gaps = 12/540 (2%)

Query: 82  DDAKVEISQVDDELN--EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
           +D K E+   ++E     K+KK+I+ RH++M+S                 A AGPAGLVI
Sbjct: 52  EDVK-ELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVI 110

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPL 199
           GYA+ +  +YCIIQA GE+ + Y  + G + AY   LVDPAL FS++W+YC+QW  V PL
Sbjct: 111 GYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPL 170

Query: 200 ELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
           +LVTA+MT++YWT   N DIFV +F+++++ IN+FG A+GYAE EF+ N CK+LM+ GF 
Sbjct: 171 QLVTAAMTVRYWT-NANPDIFVAVFFVVIMVINMFG-AKGYAEAEFLFNICKVLMIAGFV 228

Query: 260 ILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319
           ILGI I CGGAG  G+IG KYW  PG+F        FKGV      AAFS+G  E + +T
Sbjct: 229 ILGIAINCGGAGTSGYIGAKYWHSPGSFAAG-----FKGVCYVFCYAAFSYGGIEVMVLT 283

Query: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS-SAATKASPYVL 378
           ASEQ NPRK+IP+A KKVIYR L+IY+ + IIV  LVPY+SSEL+GSS  +A+ ASP V+
Sbjct: 284 ASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVI 343

Query: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438
           AV++HGV++VPH INAVILISV SV +S+ YS+ R+LL+L+ QGYAPK   +VDR GRP 
Sbjct: 344 AVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPL 403

Query: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498
           + F +  ++A++AF A S  E ++F WLLAISGLSQ+F W  ICLSH+RFR AM  QG S
Sbjct: 404 ICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLS 463

Query: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGSADVQAFFQDYLAMPVFIV 557
           + +IGYKSQ G WGS +A V+ +L++I Q WV I P+G EG  + + FFQ+YLA P+ + 
Sbjct: 464 LGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLG 523

Query: 558 LYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            Y GYK++ +DWRL I A ++DL SHR+I D EILRQE  E+ EK+ N  +W R+  FWC
Sbjct: 524 AYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRLCHFWC 583

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/611 (48%), Positives = 390/611 (63%), Gaps = 17/611 (2%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           SS+E        KS  + N+  V   +S   N E+   +T  + FR F+DSFKP E   H
Sbjct: 14  SSQELRTDASNKKSVDQINEKSV---ESYASNAEV--GATNPTMFRRFVDSFKPAEDNKH 68

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
            E D     S      DA   ++      +  LKK ++ RHV+MM+              
Sbjct: 69  SEVD-----SDVERNGDAAYSVNT-----DTHLKKAMKTRHVIMMTLGTGIGTGLLVANA 118

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
                 GPA LVIGY +++   Y +IQA GEMAV Y TL G FN Y    V     F+  
Sbjct: 119 KGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATV 178

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
           W++CIQW  V PLEL+TAS+ I+YWT KVNAD+FV+IFY+ +L I+ F G + Y ETEF+
Sbjct: 179 WLFCIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIH-FIGVKAYGETEFV 237

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTA 306
            N CKILM+ GF I  IV+ CGGAG+DG+IGGKYW  PGAF G++   RFKGV   LV+ 
Sbjct: 238 FNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFAGTNAAERFKGVCYVLVSG 297

Query: 307 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS 366
            FS+G TE   ++ +EQ NPRK+ P AAK+ IYR L+IYL ++I++G  VP++  +L+G+
Sbjct: 298 YFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGA 357

Query: 367 SSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPK 426
             +AT ASPYVLA S HGVRVVPH INAVILI+V SVA+S+ Y++ R+L +LA QGYAPK
Sbjct: 358 GGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPK 417

Query: 427 VFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHI 486
             T+VDR GRP    L  AV  V+AF ACS +E +VF WL AI+GLS++FTW+ I LSH+
Sbjct: 418 FMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHV 477

Query: 487 RFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFF 546
           RFR+AMK+QGR ++E+GY +  G WGS Y  V  IL+ I Q WV + P  +     Q+FF
Sbjct: 478 RFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAP-PKSPITAQSFF 536

Query: 547 QDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNG 606
           + YLA P++I  Y GY IW +D+        IDL  HR I+DPE+L+QE  E +E++RNG
Sbjct: 537 ESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNG 596

Query: 607 PVWRRVYDFWC 617
            +W ++  FWC
Sbjct: 597 NIWTKLKWFWC 607

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/603 (48%), Positives = 396/603 (65%), Gaps = 19/603 (3%)

Query: 16  DITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPIL 75
           D   + A  ND D I I S++ N  L     T S +RNFIDSFK  E  +         L
Sbjct: 23  DYANNLASTNDDD-ISIASSQ-NRSLSHRKNT-SYYRNFIDSFKRAEHGN---------L 70

Query: 76  SHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPA 135
           + +S    A +E      +    +KK+++ RHV+MMS                 A+ GPA
Sbjct: 71  NEKS----ADLEDGTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPA 126

Query: 136 GLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFC 195
            L+IGY I++  +Y +IQA GEMAV Y TL G FN Y    +  +  F+  W++CIQW  
Sbjct: 127 SLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWIT 186

Query: 196 VCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMM 255
           V PLEL+T+S+TIQYWT  +N DIFV+IFY+ +L I+ F G + Y ETEFI N CKILM+
Sbjct: 187 VLPLELITSSLTIQYWT-DLNGDIFVVIFYVFLLLIH-FIGVKAYGETEFIFNLCKILMI 244

Query: 256 IGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEF 315
            GF I  IV+ CGGAGNDG+IGGKYW  PG+F      +RFKG+   LV   FS+G TE 
Sbjct: 245 SGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGICYVLVAGYFSYGGTEL 304

Query: 316 LAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASP 375
             ++ +EQ+ PRKA P+AAKK IYR L+IYL ++I++G  VP++S +L+G+  ++T ASP
Sbjct: 305 YVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASP 364

Query: 376 YVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTG 435
           YVLA S HGV+VVPH INAVILISV SVA+S+ Y+S R+L +LA QGYAPK  T++DR G
Sbjct: 365 YVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREG 424

Query: 436 RPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQ 495
           RP +  L+ AV   +AF A S KE +VF WL AI+GLS+VFTW  I  SH+RFR AMKVQ
Sbjct: 425 RPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQ 484

Query: 496 GRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA-DVQAFFQDYLAMPV 554
            + IDE+GYK+  G++GS +  +  +L++I Q WV + P G G A   ++FF++YLAMP+
Sbjct: 485 NKDIDEVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPI 544

Query: 555 FIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYD 614
           ++  Y+ Y ++ ++W +      IDL +HR I+DP+++RQE  E +EKL+N P W RVY+
Sbjct: 545 WVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYN 604

Query: 615 FWC 617
           FWC
Sbjct: 605 FWC 607

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/617 (47%), Positives = 393/617 (63%), Gaps = 16/617 (2%)

Query: 7   SSKE--SYEKNDITK---SSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPP 61
           SSK+  S+ K D +    S+  F+D +   + S E+ Y        +     F DSFK  
Sbjct: 3   SSKDCGSFGKKDPSPDFISTRSFSDENNFQLSSNEKIYS-EQKPKRNRLIHRFTDSFKRA 61

Query: 62  ETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXX 121
           E +    T + PI  + S  +D     +      + KLKK+++ RHVVMMS         
Sbjct: 62  EGS---TTKIKPINENTSDLEDGIQSFTS-----DSKLKKSMKSRHVVMMSLGTGIGTGL 113

Query: 122 XXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPAL 181
                    + GPA LVIGY +++   Y +IQA GEMAV Y TL   FNAY    +    
Sbjct: 114 LVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPF 173

Query: 182 NFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYA 241
            F+  W+YC QW  V PLEL+TASMTIQ+W  K+N DI++LIFY+ +L ++ FG  + Y 
Sbjct: 174 GFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFG-VKAYG 232

Query: 242 ETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVS 301
           ETEFI N CKILM+ GF +L +VI CGGAGNDG+IGG YW  PGAF G     RFK V  
Sbjct: 233 ETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAFAGDTSIARFKNVCY 292

Query: 302 TLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSS 361
            LVTA FSFG  E   ++  EQ+NPRK+ P AAK+ IYR ++IYL ++I++G  VPY+  
Sbjct: 293 ILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDD 352

Query: 362 ELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQ 421
           +LLG+  +AT ASPYVLA S HGVR+VPH INAVILISV SVA+S+ Y+  R++ +LA+Q
Sbjct: 353 QLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQ 412

Query: 422 GYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALI 481
           GYAPK   +VDR GRP    +V  VI V+AF A SSKE  VF WL AI+GLS++FTW  I
Sbjct: 413 GYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSI 472

Query: 482 CLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSA 540
            LSH+RFR+AMKVQGRS++E+GYK+  G+WGS Y     IL+ I Q WV + P+G  G  
Sbjct: 473 MLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKC 532

Query: 541 DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQ 600
           + +AFF+ YLA P++++ Y+GY I+ RD+ L      IDL  HR ++DPE++RQE EE +
Sbjct: 533 NAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

Query: 601 EKLRNGPVWRRVYDFWC 617
           EK++N     + + FWC
Sbjct: 593 EKIKNMSFLSKAHHFWC 609

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/612 (47%), Positives = 390/612 (63%), Gaps = 14/612 (2%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           S KE+  ++   +S +  ND     I S E+ Y     S +        +SFK  E +  
Sbjct: 11  SKKEASPESISIRSFSGGND---FQISSREKAYS-GQPSKSEKLIHRLANSFKRAEGS-- 64

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
             T    I  + S  +D    I+      + KLKK+++ RHVVMMS              
Sbjct: 65  -ITKTRQINENTSDLEDGIESITS-----DSKLKKSMKSRHVVMMSLGTGIGTGLLVANA 118

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
               + GPA LVIGY +++   Y +IQA GEMAV Y TL   FNAY    +     F+  
Sbjct: 119 KGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATV 178

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
           W+YC QW  V PLEL+TASMTIQYW  K+N D+++LIFYI +L I++FG  + Y ETEFI
Sbjct: 179 WLYCFQWLTVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFG-VKAYGETEFI 237

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTA 306
            N CKILM+ GF IL +VI CGGAG+DG+IGG YW +PGAF G     RFK V   LVT 
Sbjct: 238 FNCCKILMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTG 297

Query: 307 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS 366
            FSFG  E  A++  EQSNPRK+ P AAK+ IYR ++IYL ++I++G  VPY+  +L+G+
Sbjct: 298 YFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGA 357

Query: 367 SSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPK 426
             +AT ASPYVLA S HGV++VPH INAVILISV SVA+S+ Y+  R++ +L++QGYAPK
Sbjct: 358 GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPK 417

Query: 427 VFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHI 486
              +VDR GRP    +V  +  V+AF A SSKE  VF WL AI+GLS++FTW  I LSH+
Sbjct: 418 FLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHL 477

Query: 487 RFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGSADVQAF 545
           RFR+AMKVQGRS+DE+GYK+  G+WGS Y F   IL+ I Q WV + P+G +G   V++F
Sbjct: 478 RFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESF 537

Query: 546 FQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRN 605
           F+ YLA P+++  + GY I+ RD+ L      IDL  HR I+DPE++RQE +E +EK +N
Sbjct: 538 FESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKN 597

Query: 606 GPVWRRVYDFWC 617
             + R+ Y FWC
Sbjct: 598 MSLMRKAYHFWC 609

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/581 (49%), Positives = 386/581 (66%), Gaps = 25/581 (4%)

Query: 40  ELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKL 99
           E+  S+  H     F+DSF+  E+    E D+          D  +  +++        L
Sbjct: 13  EISKSNLVH----RFVDSFRRAESPELEENDLE---------DGTRSIVTKT------HL 53

Query: 100 KKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMA 159
           KK ++ RHVVMMS                   +GPA L+IGY +++   Y +IQA GEMA
Sbjct: 54  KKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMA 113

Query: 160 VNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADI 219
           V Y TL G FN+Y    +     F+  W++ IQW  V PLEL+TAS+T++YW  K+NAD+
Sbjct: 114 VAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADV 173

Query: 220 FVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGK 279
           F++IFY  +L I+ FG  + Y ETEFI NSCK+LM+ GF IL IVI CGGAG DG+IG K
Sbjct: 174 FIIIFYAFLLFIHFFG-VKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAK 232

Query: 280 YWRDPGAFRGSDGP--NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 337
           YW DPG+F  +DGP   RFKGV   LV+A FS+G  E  +++ +EQ NPRK+ P+AAK+ 
Sbjct: 233 YWHDPGSF--ADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQS 290

Query: 338 IYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVIL 397
           IYR L+IYLA++I++G  VP++S EL+G+ SAAT ASPYVLA S H V+VVPHFINAVIL
Sbjct: 291 IYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVIL 350

Query: 398 ISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSS 457
           ISV SVA+SA Y++ R++ +LA QGYAPK   +VDR GRP  G ++ A+  V+ F + SS
Sbjct: 351 ISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASS 410

Query: 458 KETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAF 517
           KE EVF WL AI+GLS++FTW+ I LSHIRFR+AMK  G+S DEIG+K+  G+WGS Y  
Sbjct: 411 KEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGC 470

Query: 518 VMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAK 576
              IL+ I Q WV + P G  G  D +AFFQ YLA P+++V Y GY I+KRD+ +    +
Sbjct: 471 AFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLE 530

Query: 577 DIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            IDL  HR I+DP+ ++QE EE +E+L+N  +W R+Y +WC
Sbjct: 531 KIDLDFHRRIYDPDFIKQEDEENKERLKNSSIWARIYHWWC 571

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/615 (46%), Positives = 389/615 (63%), Gaps = 22/615 (3%)

Query: 5   PGSSKESYEKNDIT-KSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPET 63
           P SSKE       T  SS K +++     + +   + L ++    + F  F+DSF+  E 
Sbjct: 2   PSSSKEGGSPEIKTFDSSVKLSEIT----EKSTPVFPLDSTLKRRTHFTKFVDSFRRAED 57

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
             H ++D+          +D    I+  DD +    KK ++ RHV+MM+           
Sbjct: 58  -KHADSDL----------EDGSKSITSDDDHM----KKAMKSRHVIMMTLGTGIGTGLLV 102

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                 A AGPA LV+GY +++   Y +IQA GEMAV Y T+   FN Y    V     F
Sbjct: 103 ANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGF 162

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAET 243
           +  W++CIQW  V PLEL+TASMTI+YW   +N D+F++IFY+ +L I+ FG  + Y ET
Sbjct: 163 ATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFG-VKAYGET 221

Query: 244 EFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTL 303
           EFI NSCKILM+ GF IL IVI CGGAG DG+IG KYW +PGAF       RFKGV   L
Sbjct: 222 EFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPAARFKGVAYIL 281

Query: 304 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL 363
           VT  FS+G TE  +++ +EQ NPRK+ P+AAK+ IYR L+IYL ++I++G  VP+DS +L
Sbjct: 282 VTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQL 341

Query: 364 LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGY 423
           +G+  +AT ASPYVLA S HGV+VVPHFINAVILISV SVA+SA Y+S R++ +LA QGY
Sbjct: 342 MGAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGY 401

Query: 424 APKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICL 483
           APK F +VDR GRP     +  +  V+ F ACS +E + F WL AI+GLS++FTW+ I +
Sbjct: 402 APKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFI 461

Query: 484 SHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIV-PVGEGSADV 542
           SHIRFR AMKVQG+S++E+GY++  G+WGS Y+    +L+ I Q WV +  P   G  D 
Sbjct: 462 SHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDA 521

Query: 543 QAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEK 602
           + FF+ YLA P+++V Y GY I+ RD+        IDL  HR I+DPE+LRQE  E +E+
Sbjct: 522 EGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETKER 581

Query: 603 LRNGPVWRRVYDFWC 617
           LRN     R+  FWC
Sbjct: 582 LRNSGWLARLRSFWC 596

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/578 (47%), Positives = 374/578 (64%), Gaps = 19/578 (3%)

Query: 40  ELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKL 99
           E P +   H     F+DSFK  +               ++ FDD  +E           L
Sbjct: 59  EAPRTGLVH----RFMDSFKRAD-------------GQRAGFDDNDLESGTRSFISESHL 101

Query: 100 KKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMA 159
           KK+++ RHVVMM+                   +GPA LV+ Y +++   Y +IQA GEMA
Sbjct: 102 KKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMA 161

Query: 160 VNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADI 219
           V Y TL G FN+Y    V     F+  W++ +QW  V PLEL+T+S+TI+YW  K+N+D+
Sbjct: 162 VTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDKINSDV 221

Query: 220 FVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGK 279
           FV+IFY+ +L I+ FG  + Y ETEFI NSCKILM+ GF I  IV+ CGGAG+DG+IGGK
Sbjct: 222 FVVIFYVFLLFIHFFG-VQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGK 280

Query: 280 YWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 339
           YW DPGAF       RFKG+   LVTA FS+G TE   ++ +EQ NPRK+ P AAK+ IY
Sbjct: 281 YWHDPGAFTSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIY 340

Query: 340 RALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILIS 399
           R ++IYL ++I++G  VP+D+ +L+GS  +AT ASPYVLA S HGVR+VPHFINAVILIS
Sbjct: 341 RIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVPHFINAVILIS 400

Query: 400 VFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKE 459
           V SVA+S+ Y+S R+L +LA+QGYAPK  T++DR GRP       ++  V+ F A S++E
Sbjct: 401 VISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQE 460

Query: 460 TEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVM 519
            +VF WL AI+GLS++FTW+ I LSH+RFR+AMKVQGR ++E+GYK+  GVWGS Y    
Sbjct: 461 EQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFF 520

Query: 520 MILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDID 579
            IL+   Q WV + P G     + +FF+ YLA P+F   Y GY +W +D+   I  + ID
Sbjct: 521 NILVFFAQFWVALAPPGSKPTAL-SFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESID 579

Query: 580 LISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           L  HR ++DPE +RQEREE + KL+N  +W R+Y FWC
Sbjct: 580 LDFHRRVYDPEFIRQEREEKKIKLKNSSIWTRMYYFWC 617

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/605 (46%), Positives = 384/605 (63%), Gaps = 32/605 (5%)

Query: 25  NDVDVIDIDSAE---RNYELPT---SSTTHSR---FRNFIDSFKPPE--TTHHIETDMNP 73
           N    +D  S E      E P+    +T  SR      F+DSFK  +  T + +E    P
Sbjct: 9   NKEKTVDYSSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTENDLEDGTKP 68

Query: 74  ILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAG 133
           +        DA              LKK ++ RHV+MM                  ++ G
Sbjct: 69  L-------GDAS------------HLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGG 109

Query: 134 PAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQW 193
           P  LVIGY +++   Y +IQA GEMAV Y TL G FN+Y    +     F+  W++ IQW
Sbjct: 110 PGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQW 169

Query: 194 FCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKIL 253
             V PLEL+TAS+TI+YW  K+NAD+F++IFY+ +L I+ FG  + Y E EFI NSCK+L
Sbjct: 170 LTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFG-VKAYGEAEFIFNSCKVL 228

Query: 254 MMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQT 313
           M+ GF IL IVI CGGAG DG+IG KYWRDPG+F   D   +FKG+   LVTA FS+G  
Sbjct: 229 MIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGGA 288

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA 373
           E  +++ +EQ NPRK+ P AAK+ IYR L+IYL ++I++G  VP+++ +L+GS  +AT A
Sbjct: 289 ELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHA 348

Query: 374 SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDR 433
           SPYVLA S HGV+VVPHFINAVILISV SVA+SA Y+S R++ +LA QGYAPK   +VDR
Sbjct: 349 SPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDR 408

Query: 434 TGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMK 493
            GRP    ++ AV  V+ F + SSKE EVF WL AI+GLS++FTW+ I LSH+RFR+ MK
Sbjct: 409 EGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMK 468

Query: 494 VQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGSADVQAFFQDYLAM 552
           + GRS +EIG+++  G+WGS Y     +L+ I Q WV + P    G  D ++FFQ YLA 
Sbjct: 469 LHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAA 528

Query: 553 PVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRV 612
           P+++  Y GY ++KRD+   +    IDL  HR I+DPE++RQE EE +EK++N  VW R+
Sbjct: 529 PIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNSSVWVRM 588

Query: 613 YDFWC 617
           + FWC
Sbjct: 589 FHFWC 593

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/583 (47%), Positives = 375/583 (64%), Gaps = 16/583 (2%)

Query: 35  AERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDE 94
           ++ +YE P S    +    F++SFK  E          P L   S  ++    I      
Sbjct: 26  SKSSYE-PASRQDSTMIHRFVNSFKRAE---------QPPLKQDSDLEEDTDTIVT---- 71

Query: 95  LNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQA 154
            + +LKKT++ RHVVMMS                   AGPA LVI Y +++   Y +IQA
Sbjct: 72  -DTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQA 130

Query: 155 VGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK 214
            GEMAV Y TL G FNAY    +     F+  W++ IQW  V PLEL+TA+MT+QYW   
Sbjct: 131 AGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDS 190

Query: 215 VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDG 274
           +NAD++V+IFY+ +L I+ FG  + Y ETEFI N CKIL + GF I  IV+  GGAGN G
Sbjct: 191 INADVYVVIFYVFLLFIHFFG-VKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSG 249

Query: 275 FIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAA 334
           +IG KYW DPGAF       RFKGV   LVTA FS+G  E  A++ +EQ NPR++ P+AA
Sbjct: 250 YIGAKYWHDPGAFTSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAA 309

Query: 335 KKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINA 394
           K+ IYR ++IYL ++I+VG  VP +S+EL+GS  + T ASPYVLA S HGV+VVPH +NA
Sbjct: 310 KQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNA 369

Query: 395 VILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCA 454
           VILIS+ SV +SA Y++ R++  LA+QG+APK   +VDR GRP    +V +V  V+ F A
Sbjct: 370 VILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVA 429

Query: 455 CSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSA 514
           CSSKE +VFNWL AI+GL+++FTW+ I +SHIRFR+AMK+Q +S+DE+GYKS  GV+GS 
Sbjct: 430 CSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSY 489

Query: 515 YAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIR 574
           +     +L+ + Q WV + P          FF+ YLA P+F   Y GY IWKRD+ LF  
Sbjct: 490 FGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSD 549

Query: 575 AKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            + +DL  HR I+DPE+++QE EE +E L+N P+W+R+Y FWC
Sbjct: 550 LESVDLDYHRRIYDPELVKQEDEEKKEMLKNSPMWKRMYYFWC 592

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/591 (48%), Positives = 396/591 (67%), Gaps = 27/591 (4%)

Query: 31  DIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAK-VEIS 89
           D+   +R +        + +  NF +SFK                ++   FD ++ +E +
Sbjct: 34  DLSDGDRGF-------VNRKLHNFCNSFKR---------------ANSDTFDASQDLEGA 71

Query: 90  QVDD-ELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
            ++    N K K++++ RHVVMMS                    GPAGL+IGY++++   
Sbjct: 72  SINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVA 131

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           Y ++QA GEMAV Y TL G FN Y    +  +  F+  W+YC+QW  V PLEL+TAS+TI
Sbjct: 132 YIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTI 191

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           +YW + +N D F+ IFY +++ I+ FG A GY E EFI ++CK+ M+ GF IL IVI CG
Sbjct: 192 KYWNSSINPDAFIAIFYAVIVFIHFFGAA-GYGEAEFIFSTCKVSMIAGFIILSIVINCG 250

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           GAG  G+IGG+YWR+PGAF G      FKG+   LVTA FS+G  E  A+T +EQ+NPRK
Sbjct: 251 GAGTGGYIGGEYWRNPGAFAGGSPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRK 310

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS-SAATKASPYVLAVSTHGVRV 387
           A+PSA KK IYR L+IY+ ++I++G LVPY+S EL+GSS  +AT ASPYV+AV++HGV+V
Sbjct: 311 AVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGVKV 370

Query: 388 VPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVI 447
           VPH INAVILISV SV +SA YS+ R+L +LA QGYAPK+F++VDR GRP +  +  ++ 
Sbjct: 371 VPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIF 430

Query: 448 AVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQ 507
            +++F A S KE +VF WL AI+GLS++FTW+ ICLSH+RFR AMK QG S+ E+GYKS+
Sbjct: 431 GLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSK 490

Query: 508 VGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
            G WGS YA    I++ + Q WV + P+G  G AD +AFFQ YLA P++I  Y+GYKI+ 
Sbjct: 491 TGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYS 550

Query: 567 RDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           ++W+L +   +IDL SHRHI D  IL+QE +E++EKL+N   W ++ +FWC
Sbjct: 551 KEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKEKLKNSGWWVKMANFWC 601

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/529 (51%), Positives = 364/529 (68%), Gaps = 10/529 (1%)

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
           +  +D    K+KKTI+ RH++M++                 A AGPAGL++GY + ++ +
Sbjct: 55  ADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAML 114

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           Y I++A GE+ + Y  + G + AY   LVDPA+ FS++W+YCIQW  V PL+LVTA+M I
Sbjct: 115 YLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMII 174

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           QYWT  +N DIFV I Y +++ IN+FG A+GYAE EF  N CK+LM+IGF ILG+VI CG
Sbjct: 175 QYWT-DINPDIFVAIIYAVIVFINLFG-AKGYAEAEFFFNLCKVLMIIGFVILGVVINCG 232

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           GAG  G+IG KYW +P  F      N FKG+      AAF++G  E + ++ASEQ NPRK
Sbjct: 233 GAGTSGYIGDKYWHEPRPFM-----NGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRK 287

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVV 388
           +I SA KKVIYR +LIYL + +IV  LVP D   L   +S  ++ASP V+AVS HGV++V
Sbjct: 288 SISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSL---ASEGSRASPLVIAVSFHGVKIV 344

Query: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448
           PH INAVILI+V SV +S+ YS+ R+LL+LA QGYAPK+FT++DR GRP   F V  V  
Sbjct: 345 PHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFG 404

Query: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508
           ++AF A S  + +VF WLLAISGLSQ+F W  IC+SHIRFR AMK QGRS+ E+GYK++ 
Sbjct: 405 LLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKART 464

Query: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568
           G WGS  A V   LI+I Q WV I PV     D ++FFQ YLA P+ ++ Y GYKI+ +D
Sbjct: 465 GYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKD 524

Query: 569 WRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           WR+ I A ++DLISHR + D + L+QE  E++ KL++ P+W R+Y FWC
Sbjct: 525 WRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/537 (49%), Positives = 374/537 (69%), Gaps = 7/537 (1%)

Query: 86  VEISQVDDELN---EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYA 142
           +E    D+ LN   + LK  I+ RH+ M+S                    GPAGLVIGY 
Sbjct: 52  LEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYV 111

Query: 143 IMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELV 202
             ++ +YC++QA  E+ V Y TL G +NAYP FLVD    F++A +Y +QW  V PLELV
Sbjct: 112 TTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELV 171

Query: 203 TASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILG 262
           TASMT++YWT+ VN D+FV IFY+ +L I+ FG +RGYAE EFI NS K+L+M GF I+ 
Sbjct: 172 TASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFG-SRGYAEAEFIFNSLKVLLMAGFIIMA 230

Query: 263 IVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASE 322
           I +   GA   G+IGG+YW DPGAF G    +RFKG+ S  V AAF++G +EF+A+TA+E
Sbjct: 231 ISL-TAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAE 289

Query: 323 QSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAA-TKASPYVLAVS 381
           Q+NPR+++P A K+ +YR ++++L  +I++G LVP++S +LL +   + ++ASP+V+A +
Sbjct: 290 QANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAA 349

Query: 382 THGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGF 441
            HGVRVVPH IN +IL SV SV +SA YS+ R+LL+LA  G  PK+FT+VDR GRP +  
Sbjct: 350 LHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTL 409

Query: 442 LVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDE 501
           +  ++  ++AF A S++E  VF WL AI+GLSQ+FTW  I +SH+RFRRAM+VQGRS+ E
Sbjct: 410 IFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGE 469

Query: 502 IGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYL 560
           +GY++  G  GS YA    ++++I Q W+ I P+ + G  DV+ FFQ+YLA PV +V YL
Sbjct: 470 LGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYL 529

Query: 561 GYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           GYK+WKRD+RL I + ++DL+SHR I D E+L QE  E +E+LRN  +++R+ DFWC
Sbjct: 530 GYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNSTLFKRLLDFWC 586

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/606 (44%), Positives = 380/606 (62%), Gaps = 28/606 (4%)

Query: 13  EKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMN 72
           +K+ I      FN+       S     +L         F  FIDSFKPP           
Sbjct: 4   DKDSIRTKDINFNET------SNSTAVDLGGEGRASGVFHRFIDSFKPP----------- 46

Query: 73  PILSHQSVFDDAKVEISQVDDELNEK-LKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAH 131
                    +D K ++ ++  E  ++ LKK ++ RHV+MM+                 ++
Sbjct: 47  --------VEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSY 98

Query: 132 AGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCI 191
            GP  LVIGY +++   Y +IQA GEMAV Y TL G FN Y    +   + F+  W++ I
Sbjct: 99  GGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLI 158

Query: 192 QWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCK 251
           QW  V PLEL+T +MTIQYW   +NAD++++IFY+ +L +++FG  + Y E EFI N+CK
Sbjct: 159 QWLTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFG-VKAYGELEFIFNTCK 217

Query: 252 ILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFG 311
           IL + GF I  IV+  GGAG DG+IG KYW++PG+F  S    RFK V   LVTA FS+G
Sbjct: 218 ILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSFASSTSAGRFKDVCYVLVTAYFSYG 277

Query: 312 QTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAAT 371
            TE   ++ +EQ+NPR++ P AAK+ IYR L+IYL ++I++G  VP+D+ +L+G+  ++T
Sbjct: 278 GTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSST 337

Query: 372 KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431
            ASPYVLA S HGV+VVPH INAVILI V S+ +S+ Y++ R+  +LA QGYAPK   ++
Sbjct: 338 HASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYI 397

Query: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491
           DR GRP +     AV+ V+AF A SS+E +VF WL AI+ LS++FTW+ I LSHIRFR A
Sbjct: 398 DREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMA 457

Query: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551
           MKVQG+ ++E+GYK+  GVWGS + F   +L+ I Q WV + P G G+   + FF+ YLA
Sbjct: 458 MKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPG-GTISAEGFFESYLA 516

Query: 552 MPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRR 611
            P+++  Y  Y +WKRD+    + +DIDL +HR I+DPE LRQE EE +EK+RN   W +
Sbjct: 517 FPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRNSSFWIK 576

Query: 612 VYDFWC 617
           +  FWC
Sbjct: 577 MKYFWC 582

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/572 (47%), Positives = 372/572 (65%), Gaps = 22/572 (3%)

Query: 48  HSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRH 107
           +   + FIDSFK          D +P        D   +E +      +++ KKT++ RH
Sbjct: 61  NRHLQGFIDSFK--------RADDSP--------DHNDLEKTTTA---HQEQKKTMKSRH 101

Query: 108 VVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVG 167
           V+MMS                 + AGPA LVI Y +++   Y +IQA GEMAV Y TL G
Sbjct: 102 VIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPG 161

Query: 168 GFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYIL 227
            FNAY  F +     F+  W++CIQW  V PLEL+TA+MTI+YW T ++ D+FV+IFY+ 
Sbjct: 162 SFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVF 221

Query: 228 VLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF 287
           ++ I+ FG  + Y ETEFI N+CKILM+ GF I  IV+ CGGAG DG+IGGKYW DPGAF
Sbjct: 222 LMFIHFFG-VQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAF 280

Query: 288 RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
             S+G +RFKG+   LV A FS+G  E   ++ ++Q NPRK+ P+AAK  +YR ++IYL 
Sbjct: 281 ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLL 340

Query: 348 SIIIVGLLVPYDSSELLGSSSA-ATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADS 406
           ++I++G +VP++SSELLG+S      ASPYVLA S HG++VVPH INAVILI++ SVA+S
Sbjct: 341 TMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANS 400

Query: 407 AFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWL 466
           + Y+  R+L +LA+QGYAP+  ++VDR GRP    L+ A++ V+ F A S +E EVF WL
Sbjct: 401 SLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWL 460

Query: 467 LAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIG 526
            AISGLS++FTW  I  SHIRFRRAMK+Q +S+D +GYK+  G+WGS +     IL+   
Sbjct: 461 AAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAA 520

Query: 527 QCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
           Q WV + P    G  D  +FF  YLAMP+++V Y GY  W +D+ +      +DL +HR 
Sbjct: 521 QFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRK 580

Query: 586 IHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           ++DPE LRQE  E +E+LRN     ++Y+FWC
Sbjct: 581 VYDPEFLRQEDLENKERLRNSSFLVKIYEFWC 612

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/598 (43%), Positives = 386/598 (64%), Gaps = 22/598 (3%)

Query: 20  SSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQS 79
           S  KFN+  V+   +   +Y  P S+     FR F+DSF+  +T+               
Sbjct: 5   SVNKFNEKTVVQ-TAYSPSYASPEST---GPFRRFVDSFRREDTSR-------------- 46

Query: 80  VFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
                 +E  +++     KL++ ++ RHVVMMS                  + GPAGL+I
Sbjct: 47  ---SGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLI 103

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPL 199
           GY +++   Y ++ A GEMAV Y TL G FNAY    +     F+  W++C+QW  V PL
Sbjct: 104 GYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPL 163

Query: 200 ELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
           EL+TA++ I+YW   VNA++FV+IFY+ ++ I+ FG ARGY ETEFI N CK+LM++GF 
Sbjct: 164 ELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFG-ARGYGETEFIFNMCKVLMIVGFV 222

Query: 260 ILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319
           I+GI+I  G  G+ G+IG +YWR+PG+F      ++ KG    LVTA FSFG  E  A++
Sbjct: 223 IVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALS 282

Query: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLA 379
            +E  NP+ AIPSA KK +YR LL+YL ++I++G LVP+DS  L+GS S     SPYVLA
Sbjct: 283 VNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLA 342

Query: 380 VSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSL 439
           +  HGV+V+PH +NAVILISV SV +SA YS+ R+L  LA+QGYAPK   ++DR GRP +
Sbjct: 343 IEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLI 402

Query: 440 GFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSI 499
             ++ A+  ++AF A S  + ++F WL AI+GLS++FTW  ICLSH RFR+AMK+QGRS+
Sbjct: 403 SLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSL 462

Query: 500 DEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLY 559
           + +GY++  G WGS YA    +L+ I Q WV +VP+ +   DV +FFQ+Y+A P++++++
Sbjct: 463 ETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMF 522

Query: 560 LGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           LGY ++ R+W L      +DL +HR ++D E+L+QE  E++E++RN P + +V +FWC
Sbjct: 523 LGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/568 (46%), Positives = 374/568 (65%), Gaps = 17/568 (2%)

Query: 51  FRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVM 110
           F+  +DSFK  E                 V + + +E  +V    + KLK+ ++ RHVV+
Sbjct: 38  FQRIVDSFKRVE---------------GEVRNSSDLEDGEVTSAHSTKLKQNMKTRHVVL 82

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           MS                    GP GL+IGY  ++   Y ++QA GEMAV Y TL G FN
Sbjct: 83  MSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFN 142

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
           AY    +     F+  W++CIQW  + PLEL+T+S+ ++YWTTK+NADIFVLIFY+ +L 
Sbjct: 143 AYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILC 202

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS 290
           I+ F GARGY ETEFI NSCK+LM+ GF I+GI+I CG  G+DG+IGGKYW +PGAF   
Sbjct: 203 IH-FCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG 261

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
            G +RFKG+   LVTA FS+G  E  A++ +E  NPRKAIPSA  K +YR L+IY+ +++
Sbjct: 262 SGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMV 321

Query: 351 IVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYS 410
           I+G LVP+DS++LLGS S+    SPYVLA+S HG+++VPH INAVILISV SV +SA YS
Sbjct: 322 IIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYS 381

Query: 411 SSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAIS 470
             R+L +LA+QGYAPK+  +VDR GRP +  ++ +V  ++AF A S  E ++F WL AIS
Sbjct: 382 GPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAIS 441

Query: 471 GLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWV 530
           GLS++FTW  ICLSH RFRRAMK+QGRS++ +GY+S  G WGS YA V  + ++I Q WV
Sbjct: 442 GLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWV 501

Query: 531 GIVPVGEGSA-DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDP 589
            ++P+  G    V++ F+  LA+P+++ + +GY I  ++W +      I + SHR  +D 
Sbjct: 502 AMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDV 561

Query: 590 EILRQEREEYQEKLRNGPVWRRVYDFWC 617
           E+++QE  EY++K++    + R+   WC
Sbjct: 562 EVMKQEDLEYKQKMKRSKWYVRMSYTWC 589

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/601 (45%), Positives = 379/601 (63%), Gaps = 21/601 (3%)

Query: 20  SSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQS 79
           SS K   V   ++  +  + +         RFR   DSFK  +               +S
Sbjct: 16  SSTKSESVTASELYDSRPHAQHEEHEGAWCRFR---DSFKRAQK--------------RS 58

Query: 80  VFDDAKVEISQVDDELNE-KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
           V     +E + V  +L + +L+++I+PRHV MMS                  + GP GL+
Sbjct: 59  VPQGGDLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLI 118

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           IGYA ++   Y ++QA GEMAV Y ++ G FNAY    +     F+  W+YC+QW  V P
Sbjct: 119 IGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFP 178

Query: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGF 258
           LEL+TAS+TI+YWT  VNAD+F+ IFY+ +L I+ FG +RGY E+EFI   CK+LM+ GF
Sbjct: 179 LELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFG-SRGYGESEFIFGLCKVLMIAGF 237

Query: 259 FILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318
            IL IVI CGGAGN G+IG +YW DPGAF   D  ++FKG    LVT  FS+G TE  A+
Sbjct: 238 VILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPASKFKGFCYVLVTGYFSYGGTELYAM 297

Query: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSS-AATKASPYV 377
           T +EQS+PR+AI SA K+ IYR L+IY+ +++++G LVP+ S EL+GS   +AT ASPYV
Sbjct: 298 TVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYV 357

Query: 378 LAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRP 437
           LAVS HGV+VVPH +NAVILI+V SV +SA YS  R+L  LA QGYAPK   ++DR GRP
Sbjct: 358 LAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRP 417

Query: 438 SLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGR 497
            +  +  +VI ++AF A S  E +VF WL AI+GLS++FTW+ I LSHIRFR+AMK  G 
Sbjct: 418 LMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGY 477

Query: 498 SIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGSADVQAFFQDYLAMPVFI 556
           S+ ++GYKS  G+WGS Y     IL+ + Q WV + P+G  G  DV +FFQ YLA P++ 
Sbjct: 478 SLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWF 537

Query: 557 VLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFW 616
           V +LGY ++  +W +    KDID+   R ++D E + QE+ E++  L+N     R+  FW
Sbjct: 538 VFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQNSNWLGRLKHFW 597

Query: 617 C 617
           C
Sbjct: 598 C 598

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/566 (49%), Positives = 367/566 (64%), Gaps = 16/566 (2%)

Query: 54  FIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSX 113
           F++SFK  E      T  N  L H +    A           +  LK++I+PRHV MMS 
Sbjct: 51  FVNSFKRAEKH---STPSNGDLEHATTHSVAS----------SSPLKRSIKPRHVAMMSI 97

Query: 114 XXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYP 173
                              GPAGL+IGYA ++   Y ++QA GEMAV Y +L G FNAY 
Sbjct: 98  CTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYS 157

Query: 174 GFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINI 233
             L+     F+  W+YCIQW  V PLEL+TAS+TI+YW   +NAD+F+ IFY+ +L I+ 
Sbjct: 158 SQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHF 217

Query: 234 FGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGP 293
           FG +RGY E+EFI   CK+LM+IGF IL IVI CGGAG+  +IG KYW DPGAF    G 
Sbjct: 218 FG-SRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGA 276

Query: 294 NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVG 353
            +FKGV   LVT  FS+G TE  A+T +EQSNPR+AI S  K+ IYR LLIY+ ++I++G
Sbjct: 277 TKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIG 336

Query: 354 LLVPYDSSELLGSS-SAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSS 412
            LVP+ SSEL+GSS  +AT ASPYVLAVS HGV++VPH INAVILI+V SV +SA YS  
Sbjct: 337 FLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGP 396

Query: 413 RMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGL 472
           R+L TLA QGYAP+   +VDR GRP +  +  +V  ++AF A S  E +VF WL AI+GL
Sbjct: 397 RILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGL 456

Query: 473 SQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGI 532
           S++FTW+ I LSH+RFR+AM+   R + E+GYK+  GV GS       IL+ I Q WV I
Sbjct: 457 SELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSI 516

Query: 533 VPVG-EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEI 591
            P G +G  DV +FFQ YLA P+++VL+ GY I  R+W +    KDIDL  +R I+D + 
Sbjct: 517 APFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDR 576

Query: 592 LRQEREEYQEKLRNGPVWRRVYDFWC 617
           L QE  E++  ++N    R++++FWC
Sbjct: 577 LYQEDLEHKILIQNSSWARKLHNFWC 602

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/574 (47%), Positives = 373/574 (64%), Gaps = 17/574 (2%)

Query: 48  HSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRH 107
           + R +N+IDSFKPPE     E ++N      S+ ++   E  +       +LKKT++ RH
Sbjct: 104 NKRIKNWIDSFKPPEECMESELELN------SIDENGHREKPRA------QLKKTMKSRH 151

Query: 108 VVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVG 167
           VVMMS                 + +GPA LVIGY +++   Y +IQA GEM V Y TL G
Sbjct: 152 VVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEMGVAYPTLPG 211

Query: 168 GFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYIL 227
            FN Y    +   + F+  W+  IQW  V PLEL+ ASMTI+YWTT ++ D+FV+IFY+ 
Sbjct: 212 NFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTSISPDVFVVIFYVF 271

Query: 228 VLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF 287
           +  I+ FG A  Y ETEFI N CKILM+IGF IL IVI CGGAG+DG+IGGKYW  PGAF
Sbjct: 272 LNFIHFFGTA-AYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGKYWHTPGAF 330

Query: 288 RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
            G +  +RFK V   LVTA FS+G TE   +T +EQ NPRK+ P+AAK  IYR L++YL 
Sbjct: 331 VGKNSASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTTIYRILIVYLL 390

Query: 348 SIIIVGLLVPYDSSELLGSSSA---ATKASPYVLAVSTHGVRVVPHFINAVILISVFSVA 404
           ++I++G  VPYD+  L  ++S+   +   SPYVLA S HGV+VVPHFINAV+LI++ SVA
Sbjct: 391 TMILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINAVVLIALISVA 450

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           +SA Y++ RM+ +LA+QG APK   ++DR GRP  G L+ +++ V+ F A S KE EVF 
Sbjct: 451 NSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAAASDKEQEVFV 510

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           WL AI+GL+ +F W    LSHIRFR AMKVQG+ I+E+GYK+  G+WGS       +L++
Sbjct: 511 WLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIGACFNVLVL 570

Query: 525 IGQCWVGIVPVGEGS-ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISH 583
           I   WV + P G+GS    + FF+  LA+P++I   +GY + K+DW ++   + IDL   
Sbjct: 571 IANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPIESIDLDYC 630

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           R I+DPE L++E EE +E++RN   W R   FWC
Sbjct: 631 RKIYDPEQLKREDEENRERIRNAGFWARCRAFWC 664

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/615 (45%), Positives = 385/615 (62%), Gaps = 21/615 (3%)

Query: 8   SKESYEKNDITK--SSAKFNDVDVIDIDSAER--NYELPTSSTTHSRFRNFIDSFKPPET 63
           +K +   N++T+   ++  ND     + S E   +++    +    RFR + DSFK  E 
Sbjct: 17  NKATSSSNNLTERIHTSTTNDYINEKLGSVEEVSSFDYVQEAAKTGRFRRWADSFKRAEK 76

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
           +   E          S+++  +          + +LKK ++ RHVVMMS           
Sbjct: 77  STEAEDG-----ESGSIYNGNE----------STELKKAMKSRHVVMMSLGTGIGTGLLV 121

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                 A +GPA LVIGY +++   Y +IQA GE+ V Y +L G FN Y G LV     F
Sbjct: 122 ANAKGLAISGPAPLVIGYGLVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSRPFGF 181

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAET 243
           +  W+  +QW  V PLEL+T ++TI+YWT KVN DIFVLI Y+ +L I+IFG  + Y E 
Sbjct: 182 ATVWLASVQWLTVIPLELITCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFG-VKAYGEA 240

Query: 244 EFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTL 303
           EF+ N+CKILM+ GF IL IVI  GGAGNDG+IGG YW +PGAF   +  +RFK +   L
Sbjct: 241 EFLFNTCKILMIAGFIILSIVINVGGAGNDGYIGGSYWNNPGAFASDNAASRFKSICYIL 300

Query: 304 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL 363
           VT  FS+G TE   ++ +EQ NPRK+ P AAK  IYR L+IYL ++I++G  VP+DS +L
Sbjct: 301 VTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQL 360

Query: 364 LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGY 423
           +GS+ ++  ASPYVLA S HGV+VVPHFINAVILI++ SVA+S+ Y++ RM+++LA+QG+
Sbjct: 361 MGSAGSSAHASPYVLAASLHGVKVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGF 420

Query: 424 APKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICL 483
           APK  T+VDR GRP LG  V AV  V+ F A S KE +VF WL AI+GLS++FTW+   L
Sbjct: 421 APKFLTYVDREGRPLLGIAVCAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFL 480

Query: 484 SHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGSADV 542
           SHIRFR+AMKVQG++I E GY S  G+WGS       IL+ I Q WV + P+G +G  D 
Sbjct: 481 SHIRFRQAMKVQGKNIKECGYLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGNDGKCDA 540

Query: 543 QAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEK 602
           QAFFQ YLA P+++  Y G   + +D+ L    + IDL  HR I+DPE L++E    + +
Sbjct: 541 QAFFQSYLAFPIWLAFYFGCMFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDLATKAE 600

Query: 603 LRNGPVWRRVYDFWC 617
           L+      ++  F+C
Sbjct: 601 LKRRGFHAQLVAFFC 615

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/603 (45%), Positives = 377/603 (62%), Gaps = 30/603 (4%)

Query: 4   TPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPET 63
           T GS+  S ++ND    S  FND     ID++ER     +      R R +IDS+K  E 
Sbjct: 24  TTGSNFPSNQRNDSGFKS--FND-----IDTSERTSVESSEVYRSGRIRRWIDSYKRAEH 76

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
                        H   F+D + +     D ++  LKK ++ RHVVMMS           
Sbjct: 77  PRE----------HIDGFEDGESK-----DGIH--LKKQMKTRHVVMMSLGTGIGTGLLI 119

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                   AGPA LVIGY +++   Y +IQA GE+AV Y TL G FN+Y G L+     F
Sbjct: 120 ANAKGLHFAGPAPLVIGYGMVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGF 179

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAET 243
           +  W+  +QW  V PLE + AS+TI+YW  +++ D+FV+IFY+ +L I+ F G R Y ET
Sbjct: 180 ATVWLAAVQWLTVLPLEFIAASLTIKYWNDRISGDVFVVIFYVFLLFIH-FVGVRAYGET 238

Query: 244 EFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTL 303
           EFI N CK+LM+IGF IL IVI  GGAGNDG+IGGKYW DPGAF G    +RFKGV   L
Sbjct: 239 EFIFNLCKVLMIIGFIILSIVINAGGAGNDGYIGGKYWNDPGAFAGETAGSRFKGVCYIL 298

Query: 304 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL 363
           VT  FS+G TE   ++ +EQ NPRK+ P AAK  IYR ++IYL ++I++G  VPY+   L
Sbjct: 299 VTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRL 358

Query: 364 LGSSSAA-TKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQG 422
           +G+  A+ + ASPYVLA S HGV++VPHFINAV+LI++ SV +SA Y++ RM+++LA QG
Sbjct: 359 MGADDASGSHASPYVLAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQG 418

Query: 423 YAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALIC 482
           +APK+  +VDR GRP +   + A+  ++ F A SSKE +VF WL AI+GLS++FTW+   
Sbjct: 419 FAPKIMAYVDREGRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFF 478

Query: 483 LSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADV 542
           +SHIRFR AMK+QG+ I E+G+ +  G++GS Y     IL+   Q WV + P+G      
Sbjct: 479 ISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILVFAAQFWVALSPIGSKKVGA 538

Query: 543 QAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDP----EILRQEREE 598
           ++FF+ YLA P+++  Y GY +W +D+      + IDL  HR I+DP    EI RQE+EE
Sbjct: 539 ESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDLDFHRRIYDPEEMAEINRQEKEE 598

Query: 599 YQE 601
           Y+ 
Sbjct: 599 YKN 601

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/588 (47%), Positives = 376/588 (63%), Gaps = 46/588 (7%)

Query: 48  HSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRH 107
            + FR F DSFK       + +D N                S+++ +    L+K+I+ RH
Sbjct: 60  RNEFRKFFDSFK-----RQLPSDQN----------------SELESQEKNNLRKSIKSRH 98

Query: 108 VVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVG 167
           +VM+S                   AGPAGLV+GY I +  +YCIIQA GE+ + Y  L G
Sbjct: 99  LVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTG 158

Query: 168 GFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYIL 227
            +  Y   LVDP+L F+++ +Y IQW  V PL+LVTA+MT++YWT  VNADIFV + +I 
Sbjct: 159 NYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN-VNADIFVAVVFIF 217

Query: 228 VLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF 287
           V+ IN+FG +RGYAE EFI N CKILM+ GF IL IVI CGGAG+  +IG +YW +PG F
Sbjct: 218 VIIINLFG-SRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIGTEYWHNPGPF 276

Query: 288 RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
                 + FKGV +    AAFS+G  E L ++A+EQ NP ++IP+A KKV+YR LLIY+ 
Sbjct: 277 -----AHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNACKKVVYRILLIYML 331

Query: 348 SIIIVGLLVPYDSSELLGSSSAAT-KASPYVLAVSTHGVRVVPHFINAVILISVFSVADS 406
           + I++G LVPY+S ELLGS S++   ASP+V+AVS+HGV+VVPHFINAVILISV SVA+S
Sbjct: 332 TTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFINAVILISVISVANS 391

Query: 407 AFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWL 466
           + YS  R+LL+LA QG  PK   +VDR GRP L FLV      + F A S+ E +VF WL
Sbjct: 392 SLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFVATSNAEEQVFTWL 451

Query: 467 LAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIG 526
           LAIS LSQ+F W  +CLSHIRFR AM  QGRS+DE+GYK+Q G WGS  A ++ +  ++ 
Sbjct: 452 LAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWIAVLIAVFFLVC 511

Query: 527 QCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
           Q WV I PV E G  DV+ FFQ+YLAMP+ ++ Y G+K++ + WR +I A+ IDL SHR+
Sbjct: 512 QFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFWIPAEKIDLDSHRN 571

Query: 586 IHDPE-------------ILRQEREEYQEKL---RNGPVWRRVYDFWC 617
           ++ P              +   E  E  E L   R    ++++ +FWC
Sbjct: 572 VYLPPTSTGADKIDDDDDVTEYETSESSENLHSSRLNKSFKKMVNFWC 619

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/665 (42%), Positives = 393/665 (59%), Gaps = 60/665 (9%)

Query: 6   GSSKESYEKNDITKSSAKFNDVDVIDIDSAER--------NYELPTSSTTHSRFRNFIDS 57
           G S+ S EK +  +      D +V DI+ AER            P     HS ++N+IDS
Sbjct: 6   GGSRGSVEK-EPDQFEILDQDTNVSDINLAERYARDTQSDERSKPRHRNVHSYYQNWIDS 64

Query: 58  FKPPE--------------TTHHI-------ETDM------NPILSHQSVFDDAKVEISQ 90
           FK  E              +T +I       E+D        P  +  + +D    E+  
Sbjct: 65  FKRAEPVGERRRRRAQQDISTTNINNMNKGDESDFYMGNGGEPSTNIDTAYDMNSNEVDP 124

Query: 91  VDDE------LNEKL---------------KKTIQPRHVVMMSXXXXXXXXXXXXXXXXX 129
            + +      LN+ L               K  ++ RHV+MM+                 
Sbjct: 125 NNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSL 184

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIY 189
             +GPAGLV+GY +++   Y ++QA GEMA+ Y TL GGFN Y    +     F+  WI+
Sbjct: 185 HFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIF 244

Query: 190 CIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
            + W  + PLEL+T+S+T++YWTT +N DIFVLIFY+ +L ++ F G R YAE EF  NS
Sbjct: 245 ALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVH-FIGLRLYAEAEFFFNS 303

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFS 309
           CKILM+ GF I  IV+ CGGAG+DG+IGGKYW DPG F   +G  RFK V   L+ A FS
Sbjct: 304 CKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPFASDNGAARFKEVCYVLINAYFS 363

Query: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369
           +G TE   ++ +EQ NPRKA+P AAK  +YR  +IYL ++I++G  VPY+S +L+G++++
Sbjct: 364 YGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANS 423

Query: 370 ATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFT 429
              ASPYVLA   HGV++VPHFINAVIL+SV SVA+SA ++  R+L TLA QG+APK  T
Sbjct: 424 -KDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLT 482

Query: 430 FVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFR 489
           +VDR GRP L   V ++  V+AF A S KE EVF WL AI+GLS++F W+ I LSHIRFR
Sbjct: 483 YVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFR 542

Query: 490 RAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGI-VPVGEGSADVQAFFQD 548
            AMK  G+S+DE+GYK+  G+WGS Y     +L++I Q WV +  P   G     +FF+ 
Sbjct: 543 WAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFES 602

Query: 549 YLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPV 608
           YLA  +++  YL Y I+ +DW + I  KDID+   R I+D + LRQE+EE  EK +   +
Sbjct: 603 YLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIYDADFLRQEKEESYEKYKQSNI 662

Query: 609 WRRVY 613
            +++Y
Sbjct: 663 GKKIY 667

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  524 bits (1350), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 267/544 (49%), Positives = 362/544 (66%), Gaps = 23/544 (4%)

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
           S+++ +    L K+I+ RH+VM+S                   AGPAGLV+GY + +  +
Sbjct: 80  SELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIML 139

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           YCIIQA GE+ + Y  L G +  YP  LVDP+L F+++ +Y IQW  V PL+LVTA+MT+
Sbjct: 140 YCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTV 199

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           +YWT+ VN+DIFV + +I V+ IN+FG +RGYAE EFI N CKILM+IGF IL I+I CG
Sbjct: 200 KYWTS-VNSDIFVAVVFIFVIIINLFG-SRGYAEAEFIFNICKILMVIGFVILAIIINCG 257

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           GAG+  +IG +YW +PG F      + FKGV +    AAFS+G  E L ++A+EQ NP K
Sbjct: 258 GAGDRKYIGTEYWHNPGPF-----AHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTK 312

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS-SAATKASPYVLAVSTHGVRV 387
           +IP+A KKV+YR LLIY+ + I+V  LVPY+S ELLGS  S+ + ASP+V+AV++HGV+V
Sbjct: 313 SIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKV 372

Query: 388 VPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVI 447
           VPHFINAVILISV SVA+S+ YS  R+LL+LA QG  PK   +VDR GRP L FLV    
Sbjct: 373 VPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAF 432

Query: 448 AVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQ 507
             + F A S  E EVF WLLAIS LSQ+F W  + LSHIRFR AM  QGRS++E+GYK+Q
Sbjct: 433 GCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQ 492

Query: 508 VGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
            G WGS  A ++ +  ++ Q WV I PV + G  +V+ FFQ+YLAMP+ +V Y G+KI+ 
Sbjct: 493 TGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYF 552

Query: 567 RDWRLFIRAKDIDLISHRHIH-----------DPEILRQEREEYQE---KLRNGPVWRRV 612
           + W  +I A  IDL SHR+I            D ++   E +E  E    LR+  +++++
Sbjct: 553 KSWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLENLNNLRSRNLFKKM 612

Query: 613 YDFW 616
            + W
Sbjct: 613 VNLW 616

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  517 bits (1332), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/510 (51%), Positives = 346/510 (67%), Gaps = 15/510 (2%)

Query: 80  VFDDAKVEISQVDDELNE---KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAG 136
           + D  K +  + D E  E   +L KT++PRH+VM+S                 + +GPAG
Sbjct: 84  IVDSFKRQKVRNDGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAG 143

Query: 137 LVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCV 196
           LVIGY + +  IYC++QA GE+ + Y  L G +  YP +L+DPA+ F+++ +Y +QW  V
Sbjct: 144 LVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTV 203

Query: 197 CPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMI 256
            PL+LVTA+MTI+YWTT VN DIFV    +LV+AIN+FG A+GYAE EF CN CK+LMM 
Sbjct: 204 LPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFG-AKGYAEAEFFCNCCKLLMMA 262

Query: 257 GFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFL 316
           GF ILGIVI CGGAG+  +IG KYW+ PGAF      N FKGV +    AAFS+G  E L
Sbjct: 263 GFVILGIVINCGGAGDKEYIGVKYWQTPGAF-----ANGFKGVAAVFCYAAFSYGGIEVL 317

Query: 317 AITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSS--AATKAS 374
            +TA+EQ+NPRKAIP A +KV+YR L +Y+ + IIV  LVPY+S  LLGS++  + + AS
Sbjct: 318 VLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDAS 377

Query: 375 PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRT 434
           P+V+AV++HGV+VVPH INA ILISV SVA+S+ YS  R+LL+L++QGYAPK F ++DR 
Sbjct: 378 PFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRR 437

Query: 435 GRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKV 494
           GRP +  LV   + ++AF A      EVF WLLA+SGLSQ+F W  I +SH+RFR A++ 
Sbjct: 438 GRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRS 497

Query: 495 Q---GRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYL 550
           Q    R+ D + Y +Q G  GS  A  + I I++ Q WV I P+G  G  DVQ FF++YL
Sbjct: 498 QLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYL 557

Query: 551 AMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
           A PV +  YL YKIW RDWRL I A +IDL
Sbjct: 558 AAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  516 bits (1330), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 281/625 (44%), Positives = 381/625 (60%), Gaps = 47/625 (7%)

Query: 12  YEKNDITKSSAKFNDVDVIDIDSAERNYELPTSST--THSRFRNFIDSFKPPETTHHIET 69
           +E+    K    F   +  D    ++     TS      +  + F DSFK       +  
Sbjct: 22  HERGHAEKEKKDFTVTENQDEGLQQQAKRQGTSGKFKLQNECKKFFDSFK-----RQLPA 76

Query: 70  DMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXX 129
           D N                S+++ +    L ++I+ RH++M+S                 
Sbjct: 77  DQN----------------SELESQERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVL 120

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIY 189
             AGPAGLV+GY I +  +YCIIQA GE+ + Y  L G +  Y   LVDP+L F+++ +Y
Sbjct: 121 GTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVY 180

Query: 190 CIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
            IQW  V PL+LVTA+MTI+YWT  VNADIFV   +I V+ IN+FG ++GYAE EF+ N 
Sbjct: 181 TIQWLTVLPLQLVTAAMTIKYWTN-VNADIFVAAVFIFVIIINLFG-SKGYAEAEFMFNI 238

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFS 309
           CKILM+IGF IL IVI CGGAG+  FIG KYW +PG F      + FKGV +    AAFS
Sbjct: 239 CKILMVIGFVILAIVINCGGAGDRKFIGTKYWHNPGPF-----AHGFKGVCTVFCYAAFS 293

Query: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369
           +G  E L ++A+EQ NP K+IP+A KKV+YR L IY+ + I++  LVPY+S ELLGS S+
Sbjct: 294 YGGIEVLLLSAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSS 353

Query: 370 AT-KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428
           +   ASP+V+AV++HGV+VVPHFINAVILISV SVA+S+ YS+ R+LL+LA QG+ PK  
Sbjct: 354 SGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCL 413

Query: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488
            +VDR GRP L FLV  +   + F A S  E +VF WLLAIS LSQ+F W  + LSHIRF
Sbjct: 414 AYVDRNGRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRF 473

Query: 489 RRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQ 547
           R AM  QGRS+DE+GYK+Q G WGS  A ++ +  ++ Q WV I PV + G  D   FFQ
Sbjct: 474 RDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQ 533

Query: 548 DYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR--- 604
           +YLAMP+ +  Y G+KI+ + W+ +I A+ IDL SHR I+ P IL    +   + L+   
Sbjct: 534 NYLAMPIVLFAYFGHKIYTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYE 593

Query: 605 --------NG----PVWRRVYDFWC 617
                   NG      ++R+ +FWC
Sbjct: 594 TSESSENPNGSGSRKFFKRMANFWC 618

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  509 bits (1310), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 285/624 (45%), Positives = 390/624 (62%), Gaps = 38/624 (6%)

Query: 25  NDVDVIDIDSAERNYELPTSSTTHS--RFRNFIDSFKPPE----TTHHIETDMNPILSHQ 78
           + V  I  +++   Y       THS  + R+F  + K  E    T     TD   IL  +
Sbjct: 3   DSVSFIAKEASPAQYSHSLHERTHSEKQKRDFTITEKQDEVSGQTAEPRRTDSKSILQRK 62

Query: 79  --SVFDDAKVEI-----SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAH 131
               FD  K ++     S+++ +    L K+I+ RH+VM+S                   
Sbjct: 63  CKEFFDSFKRQLPPDRNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGT 122

Query: 132 AGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCI 191
           AGPAGLV+GY I +  +YCIIQA GE+ + Y  L G +  YP  LVDP+L F+++ +Y I
Sbjct: 123 AGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTI 182

Query: 192 QWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCK 251
           QW  V PL+LVTA+MT++YWT+ VNADIFV + ++ V+ IN+FG +RGYAE EFI NSCK
Sbjct: 183 QWLTVLPLQLVTAAMTVKYWTS-VNADIFVAVVFVFVIIINLFG-SRGYAEAEFIFNSCK 240

Query: 252 ILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFG 311
           ILM+IGF IL I+I CGGAG+  +IG +YW +PG F      + FKGV +    AAFS+G
Sbjct: 241 ILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPF-----AHGFKGVCTVFCYAAFSYG 295

Query: 312 QTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAAT 371
             E L ++A+EQ NP K+IP+A KKV+YR LLIY+ + I+V  LVPY+S ELLGSS ++ 
Sbjct: 296 GIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSG 355

Query: 372 KAS-PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTF 430
             + P+V+AV++HGV+VVPHFINAVILISV SVA+S+ YS  R+LL+LA QG  PK   +
Sbjct: 356 SHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAY 415

Query: 431 VDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRR 490
           VDR GRP L F V  V   + F A S  E +VF WLLAIS LSQ+F W  + LSHIRFR 
Sbjct: 416 VDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRD 475

Query: 491 AMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDY 549
           AM  QGRS++E+GYK+Q G WGS  A ++ I  ++ Q WV I PV E G  +V+ FFQ+Y
Sbjct: 476 AMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNY 535

Query: 550 LAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIH-DPEILRQEREEYQEKL----- 603
           LAMP+ +  Y G+KI+ + W  +I A+ IDL SHR+I   P +   ++ +  + L     
Sbjct: 536 LAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDLKEYEN 595

Query: 604 ----------RNGPVWRRVYDFWC 617
                     R+   ++R+ +FWC
Sbjct: 596 SESSENPNSSRSRKFFKRMTNFWC 619

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  506 bits (1303), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 270/597 (45%), Positives = 370/597 (61%), Gaps = 36/597 (6%)

Query: 3   DTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPE 62
           ++  S  + +E  DI+ + +   + +VI   S+  N    T         +F+DSFK  E
Sbjct: 15  NSKDSKNDGFEVKDISATVSP--ETNVITASSSASNEGPATPQPQLGVVASFLDSFKRKE 72

Query: 63  TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXX 122
                              DD     S   DE    L K I+ RH++M+S          
Sbjct: 73  ------------------HDD-----STAGDE--NDLNKAIRSRHLIMISLGTGIGTGLL 107

Query: 123 XXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALN 182
                  + +GP GL+IGY + +  ++ IIQA GE+ + Y  +VG F  YP  LVDPA  
Sbjct: 108 VGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFG 167

Query: 183 FSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAE 242
           F+I+++Y IQW  V PL+LVTA+MTIQ+W   VN D+FVL  +++V+ IN+ GGARGY E
Sbjct: 168 FAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNLDVFVLASFVVVVLINL-GGARGYVE 226

Query: 243 TEFICNSCKILMMIGFFILGIVIICGG--AGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV 300
            EF CN CKI+M+ GF ILGI+I  GG   G DG+IGGKYWR+PG F      N FKGV 
Sbjct: 227 AEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGYIGGKYWRNPGLFA-----NGFKGVC 281

Query: 301 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360
           S    AAFS+G  E L ++A+EQ NP K+IPSA KKV+YR L IYL S+IIV  LVPY S
Sbjct: 282 SVFCYAAFSYGGVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTS 341

Query: 361 SELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420
            +L+GSS + + +SP+V+A+++HGV VVPH INAVILISV SVA+SA Y + R+LL+LA+
Sbjct: 342 PDLMGSSGSGSHSSPFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQ 401

Query: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480
            G APK   ++D+ GRP+   LV  +  ++ F A S K   VF WLL+ISGL Q+F W  
Sbjct: 402 GGSAPKFLNYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWIS 461

Query: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGS 539
           IC+SHIRFR AM+VQG  + EI YK+Q G WGS  A  + + +++ Q WV I PVG  G 
Sbjct: 462 ICVSHIRFRDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGK 521

Query: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQER 596
            D   FFQ+YLA PV +  YLG+K++ + W+L I A  I+L ++R+++ PE   +++
Sbjct: 522 LDATNFFQNYLAFPVVLCAYLGFKVYYKQWQLLIPADKIELDNNRNVYVPEEALEDK 578

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  501 bits (1290), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 257/569 (45%), Positives = 365/569 (64%), Gaps = 16/569 (2%)

Query: 51  FRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVM 110
           F+ F DSFK  +    +         H+    + + E +   ++  +KLK  I+ RH+ M
Sbjct: 35  FQRFKDSFKRADVVEDV---------HE---KEGQEEYATGLNKTQQKLKHNIKTRHLTM 82

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           +S                  + GP GL+IGY   ++ +YC++QA  E+ V Y TL G +N
Sbjct: 83  ISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYN 142

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
           AYP FLVD    F++A +Y +QW  V PLELVTASMTI+YWT  VN D+FV IFY+ ++ 
Sbjct: 143 AYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVF 202

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS 290
           I+ FG +RGYAE+EFI N+ K+L+M GF I+GI + CG A   G+IG KYW +PG F G 
Sbjct: 203 IHFFG-SRGYAESEFIFNTLKVLLMAGFIIMGISLNCG-ASKLGYIGAKYWSNPGTFAGE 260

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
              N  KG+ S  V +AF++G +EF+A+TA+EQ+NPR+++PSA K+ +YR ++++L  I 
Sbjct: 261 RSINHLKGICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIA 320

Query: 351 IVGLLVPYDSSELLGSSSAATKAS-PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFY 409
           ++  LVPY S +LL SS A+   + P+V+A + HGV++VPH INA+IL SV SV +S  Y
Sbjct: 321 LICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMY 380

Query: 410 SSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAI 469
           S+ R+LL+LA  G  PK+FT+VDR GRP    L   V  +++F A S  +  VF WL AI
Sbjct: 381 SAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAI 440

Query: 470 SGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCW 529
           +GLSQ+FTW  I LSHIRFR AMKVQGRS+ E+GY S  G  GS YA    I++++ Q W
Sbjct: 441 AGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFW 500

Query: 530 VGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHD 588
           + I P+ + G  D ++FF++YLA  V ++ Y+GYKIW R+ +L I    IDL +HR I D
Sbjct: 501 IAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFD 560

Query: 589 PEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            E+L+QE  E +E+++     +R   FWC
Sbjct: 561 EEVLQQEELERKERMKTASFKQRFIAFWC 589

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  491 bits (1263), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 257/590 (43%), Positives = 369/590 (62%), Gaps = 22/590 (3%)

Query: 33  DSAERNYELPTS----STTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEI 88
           D+   +YE  +S      + SR+++F D FK  E       +++P L+     +  K+ I
Sbjct: 21  DAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELE-----ELDPNLT-----EAEKIAI 70

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
                 L   LK     RH+ M++                    GPAG++IG+ ++   I
Sbjct: 71  ITAQSPLQRHLKN----RHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMI 126

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           YC++ ++GE+AV +  + GGF  Y    VD +  F+I + Y +QW  V PLE+V AS+T+
Sbjct: 127 YCVVMSMGELAVTF-PVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITV 185

Query: 209 QYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIIC 267
            +W T     D FV +FYI+++ IN FG  RGY E EF+ +  K++ +IGF ILGIV++C
Sbjct: 186 NFWGTPPKYRDGFVALFYIVIVIINFFG-VRGYGEAEFVFSFIKVITVIGFIILGIVLVC 244

Query: 268 GGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPR 327
           GG    G+IGGKYW +PGAF G D  +RFKGV S  VTAAFSF  TE + + ++E +NPR
Sbjct: 245 GGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPR 304

Query: 328 KAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRV 387
           KA+P AAK+V +R LL Y+ S+ ++GLLVP+ S  L+G+SS    ASP+VLA+ THG++ 
Sbjct: 305 KALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKG 364

Query: 388 VPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVI 447
           +P  IN VILISV SV +SA Y+ SR ++ LA QG  P +F ++DR GRP +  +   V 
Sbjct: 365 LPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVF 424

Query: 448 AVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQ 507
            +++F A S KE +VFNWLLA+SGLS +F+W  IC+ HIRFRRA+  QGRS DE+ + S 
Sbjct: 425 GLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSY 484

Query: 508 VGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKR 567
            G+ GS +  ++++L++I Q WV + P+G GS + + FF  YL+ PV +  Y+ +KIWKR
Sbjct: 485 AGIAGSYFGVILVLLVLIAQFWVAVWPIG-GSPNAEDFFSAYLSFPVLLAFYIFHKIWKR 543

Query: 568 DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +W+LF RAKDID+ + R   D E LRQE  E +  L   P W R+Y FWC
Sbjct: 544 NWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPWWYRLYFFWC 593

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  484 bits (1245), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 259/515 (50%), Positives = 349/515 (67%), Gaps = 11/515 (2%)

Query: 78  QSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGL 137
           +S+ DD+K    + +++   +L ++I+ RH++M+S                 A +GPAGL
Sbjct: 73  ESLRDDSKP--LENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGL 130

Query: 138 VIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVC 197
           VIGY + +  +Y I+QA GE+ + Y  L G +  YP  LVDPAL F+I+ IY +QW  V 
Sbjct: 131 VIGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVM 190

Query: 198 PLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIG 257
           PL+LVTA+MTI YWT  +N +IFV I  ++V+  N FG A+GY E EF+CN  K+LMM+G
Sbjct: 191 PLQLVTAAMTIGYWT-NINPNIFVAIVLVIVVLTNCFG-AKGYVEAEFLCNIFKVLMMVG 248

Query: 258 FFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLA 317
           F +L I+I  G  G DG+IG  YW++PGAF      N FKGV S    AAFS+G  E LA
Sbjct: 249 FVLLAILINTGAIGTDGYIGTIYWKNPGAFA-----NGFKGVCSVFCYAAFSYGGIEVLA 303

Query: 318 ITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS-PY 376
           +TA+EQ NP KAIPSA KK +YR L +Y+ + I++G LVPYDS +L+GS+S     S P+
Sbjct: 304 LTAAEQENPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSSPF 363

Query: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436
           V+A+++HGV+VVPH INAVILIS+ SVA+SAFYSS+R+LL+L+ QG  PK+F +VD+ GR
Sbjct: 364 VIAIASHGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGR 423

Query: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496
           P    L  ++   + F A S  + EVF WLLAISGLSQ+F W  ICLSHIRFRRAM  QG
Sbjct: 424 PWYCILFASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQG 483

Query: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG-EGSADVQAFFQDYLAMPVF 555
           +S+DEIGYK+  G WGS  A  + +  +I Q WV I P+G +G  DV  FFQ+YLA P+ 
Sbjct: 484 KSLDEIGYKAPTGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIV 543

Query: 556 IVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPE 590
           ++ YLGYK + +DWRL+I +  IDL   R I+ PE
Sbjct: 544 LIAYLGYKTYYKDWRLYIPSDKIDLSYGREIYVPE 578

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  482 bits (1240), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 258/612 (42%), Positives = 369/612 (60%), Gaps = 28/612 (4%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           + +E  E  D+  SS +    ++ D          PTSS   SR+++F+D FK  E    
Sbjct: 12  AQEEPLEGRDVGHSSYETGSGEITD--------SKPTSS--GSRWQDFVDGFKRVELG-- 59

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
              D++P L+        KV I+     L   LK     RH+ M++              
Sbjct: 60  ---DLDPNLTQAE-----KVAIATARSPLQRHLKN----RHLQMIAIGGAIGTGLFVGSG 107

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
                 GPA ++IG+ ++   IY ++ A+GE+AV +  + GGF  Y    VD +  F+I 
Sbjct: 108 SALRTGGPAAVLIGWGLIGLMIYSVVMAMGELAVTF-PVAGGFTTYIPRFVDDSFGFAIN 166

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEF 245
           +IY +QW  V PLE+V AS+T+ YW T     D FV +FY++++ IN+FG  +GY E EF
Sbjct: 167 YIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDGFVALFYVVIVIINMFG-VKGYGEAEF 225

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVT 305
           + +  K+  ++GF ILGIV+ICGG    G++GGKYW +PGAF G +   RFK V S  VT
Sbjct: 226 VFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGKYWHNPGAFNGDNAGQRFKAVCSVFVT 285

Query: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365
           AAFSF  TE + + A+E  NPRKA+P AAK+V +R  L Y+ S+ ++GLLVPY S  L+G
Sbjct: 286 AAFSFAGTELVGLAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIG 345

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
           SSS    ASP+VLA+ THG+  +P  IN VILISV SV +S+ Y+ SR L  LA QG+ P
Sbjct: 346 SSSVDAAASPFVLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLP 405

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           ++F+++DR GRP +G L      ++ F A S KE +VFNWL+A+SGLS +FTW  IC+ H
Sbjct: 406 QIFSYIDRKGRPLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICH 465

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAF 545
           +RFRRA+  QGRS DE+ + S VGVWGS +  +++ L+ I Q W+ + P+G G+ +   F
Sbjct: 466 LRFRRALAAQGRSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMG-GTPNASDF 524

Query: 546 FQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRN 605
           FQ YL++ V +  YL +K++ R+W    RAKDID+ + R   D + L+QE  E + +L  
Sbjct: 525 FQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEKLRLST 584

Query: 606 GPVWRRVYDFWC 617
            P W RVY  WC
Sbjct: 585 KPWWYRVYHLWC 596

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  481 bits (1239), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 231/526 (43%), Positives = 342/526 (65%), Gaps = 5/526 (0%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           N  LK+ ++ RHV MMS                 ++AGPA L+IGY +++   Y ++QA 
Sbjct: 96  NAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAA 155

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GE+AV + T+ G FNAY   LV     F+  W++ +QW  + P+EL+  +  +++WTT+V
Sbjct: 156 GELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTRV 215

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           +AD+FVLIF++ +  ++ F G   Y ETEF  N  K+LM+IGF I  I +  GGAG+ G+
Sbjct: 216 DADVFVLIFFVFLFIVH-FIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSGY 274

Query: 276 IGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 335
           IG KYW DPGAF       RFKGV   LV+A FS+G TE   ++ +EQ NPRK IP+A K
Sbjct: 275 IGAKYWHDPGAFVSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATK 334

Query: 336 KVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA---ATKASPYVLAVSTHGVRVVPHFI 392
             IYR + IYL ++++VG  VP +   L+GS  A       SPYVLA S H VRV+PHFI
Sbjct: 335 TTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFI 394

Query: 393 NAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAF 452
           NAV+++++ S+++SA Y++ R++ +LA+QGY PK F ++DR GRP+   ++  +I V+AF
Sbjct: 395 NAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAF 454

Query: 453 CACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWG 512
            + S K   +F+WL AI+GLS++FTW+ I LSH+RFR A+KVQG+ I+E+GYKS  GVWG
Sbjct: 455 ASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWG 514

Query: 513 SAYAFVMMILIMIGQCWVGI-VPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRL 571
           SAY     +L+   Q WV +  P   G      FFQ YLA+P+++  Y+G+ +W RD+  
Sbjct: 515 SAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTF 574

Query: 572 FIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            I    +DL S+R  +DPE+LRQE EE+++ +++  +W +++ F+C
Sbjct: 575 LIPLNKVDLDSYRRYYDPELLRQEDEEHKQAMKSASIWIKLHSFFC 620

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  481 bits (1237), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 260/622 (41%), Positives = 378/622 (60%), Gaps = 29/622 (4%)

Query: 7   SSKESYE------KNDITKSSAKFNDVDV----IDIDSAERNYELPTSSTTHSRFRNFID 56
           SS E ++      K+  T  + +F D D+    IDI     NY   T     S++R FID
Sbjct: 2   SSSEGFQMSNQDYKDAKTNINTEFIDPDLESESIDIKKETFNYN-QTGEEKGSKWRQFID 60

Query: 57  SFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXX 116
           SFK  E       +++P L+ Q      ++ I      L   LK     RH+ M++    
Sbjct: 61  SFKRVEVP-----ELDPNLTEQE-----RIAIITAHTPLKHHLKS----RHLQMIAIGGA 106

Query: 117 XXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFL 176
                          AGPA L+IG++I  S IY ++ AV EMAV Y  + GGF  Y    
Sbjct: 107 IGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAVLY-PISGGFTTYATRF 165

Query: 177 VDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFG 235
           +D +  F+  + Y +QW  V PLE+V+AS+T+ YW T     D FV +F+++++ IN+FG
Sbjct: 166 IDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRDGFVALFWLVIVIINLFG 225

Query: 236 GARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNR 295
             +GY E EFI ++ K++ ++GF ILG+V++CGG    G++G KYW DPGAF G+    +
Sbjct: 226 -VKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAKYWHDPGAFVGATAGAQ 284

Query: 296 FKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLL 355
           F+G  S  VTAAFSF  +E + I  SE  NPRKA+P AAK+V +R LL Y+ S++ +GLL
Sbjct: 285 FQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQVFWRILLFYILSLLFIGLL 344

Query: 356 VPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRML 415
           VP + S L+GSS+    ASP+V+A++ HG+R +P  IN VILI+V SV +SA Y+ SR L
Sbjct: 345 VPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVILIAVLSVGNSAIYTCSRTL 404

Query: 416 LTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQV 475
           + LA QG+ PKV +++DR+GRP +G  + +   ++AF A S KE +VFNWLLAISGLS  
Sbjct: 405 VALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSF 464

Query: 476 FTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV 535
           FTW  ICL HIRFR A+K Q RS DE+ + S +GV+GS +   +++L++  Q +V I PV
Sbjct: 465 FTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPV 524

Query: 536 GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQE 595
           G+ +     FF  YL++PV +V+Y+ +K+W ++W++FI    +DL + R   D ++LRQE
Sbjct: 525 GD-TPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQE 583

Query: 596 REEYQEKLRNGPVWRRVYDFWC 617
             E +  L   P W R+Y FWC
Sbjct: 584 VAEERATLAARPRWFRIYTFWC 605

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  473 bits (1217), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 249/610 (40%), Positives = 374/610 (61%), Gaps = 18/610 (2%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIE 68
           KE+Y  N  T      + +      S + N      S + SR+    DSFK  E     E
Sbjct: 19  KETYFINSETLHEPVQSSLTPTTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKE---E 75

Query: 69  TDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXX 128
            D N   + +   + AK             LK T++ RH+ M++                
Sbjct: 76  VDPNLTEAERIAINTAKA-----------PLKHTLKGRHMQMVAIGGAIGSGLFVGSSTA 124

Query: 129 XAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWI 188
              AGPAG+VIG+ + ++ IYC++ A+GE+AV +  + GGF  Y    +D +  F+  + 
Sbjct: 125 LRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVF-PVSGGFTTYATRFIDESFGFASNFN 183

Query: 189 YCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEFIC 247
           Y +QW    PLE+V+AS+T+ YW T     D FV +F+++++ IN+FG  RG+ E EF+ 
Sbjct: 184 YALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFG-VRGFGEAEFVF 242

Query: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAA 307
           ++ K+L +IGF ILGIV++ GG    GF+GG+YW +PGAF G +   +FKGV S  VTAA
Sbjct: 243 STIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAFVGDNAGTQFKGVCSVFVTAA 302

Query: 308 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS 367
           FSF  +E + ITA+E +NPRK++P AAK+V++R +L Y+ S+I++GLLVPY    L+G+S
Sbjct: 303 FSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGAS 362

Query: 368 SAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKV 427
           S    ASP+V+A+ THG+R +P  IN VILI+V SV +SA ++ SR +  L+ QG+ P++
Sbjct: 363 SVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEI 422

Query: 428 FTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIR 487
           F ++DR GRP +G +V +   ++AF A S K+ EVF WL+A+SGLS +FTW  ICL HIR
Sbjct: 423 FGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIR 482

Query: 488 FRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQ 547
           FR A+K QGRS +E+ + S  G+ GS++   M++L+ I Q +V + P G      + FF+
Sbjct: 483 FRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGS-KPSAEVFFE 541

Query: 548 DYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGP 607
            YL+ P+ +  Y G+KI+K++W+LFI+A+D+D+ + R   D E+L+QE EE +  L    
Sbjct: 542 SYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEKAILATKG 601

Query: 608 VWRRVYDFWC 617
            W R Y FWC
Sbjct: 602 WWYRQYQFWC 611

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  472 bits (1215), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 244/521 (46%), Positives = 341/521 (65%), Gaps = 11/521 (2%)

Query: 76  SHQSVFDDA---KVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHA 132
           S + + +D+   K E      E NEKLK++I+P HV M++                 + A
Sbjct: 45  SSEDITNDSTTGKTEKGHTGSE-NEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDA 103

Query: 133 GPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQ 192
           G  G ++GY I+ S + C +Q+VGE+ V + +L GGFN+Y    VDP+  F++AW++C+Q
Sbjct: 104 GVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQ 163

Query: 193 WFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKI 252
           W  V PLELVTASMTI+YW   +N  IFV IFY L+L I+ FG ARGYA+ EF+ N  K+
Sbjct: 164 WQIVLPLELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFG-ARGYADAEFLFNLSKV 222

Query: 253 LMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQ 312
           LM+ GF ILGI+I  G AG  G+IG KY + PGAF   +  N FK + STLV A FS G 
Sbjct: 223 LMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAF---NTRNTFKSICSTLVNACFSCGG 279

Query: 313 TEFLAITASEQS--NPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAA 370
            EFLA++A+EQ+  N  K+I  A  +V+ R  + Y+ SI ++GLLVPY+S EL+GSSS  
Sbjct: 280 VEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEI 339

Query: 371 TKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTF 430
             +SPYV+AV++HGV+VVPH INAVILI+V SVA+SA YSSSR L  LA QG+AP  F  
Sbjct: 340 IHSSPYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAK 399

Query: 431 VDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRR 490
           +D  GRP    +V  V  +++F A    +  VF WLL+ISGLS +FTW +IC++H+RFR 
Sbjct: 400 LDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRA 459

Query: 491 AMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV-GEGSADVQAFFQDY 549
           AMK Q  S++E+G+++  G++GS Y   +  L ++ Q WV + P+ G+G  D   FFQ+Y
Sbjct: 460 AMKDQNHSLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNY 519

Query: 550 LAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPE 590
           +A+P  + LY+G+KI+ R W+  I A  ID+ + R I+  E
Sbjct: 520 MAVPFALCLYVGHKIYTRSWQFIIPADKIDVDTSRDIYGVE 560

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  472 bits (1215), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/616 (40%), Positives = 371/616 (60%), Gaps = 23/616 (3%)

Query: 8   SKESYEKNDITKSSAKFNDV--DVIDIDSAER--NY-ELPTSSTTHSRFRNFIDSFKPPE 62
           S + Y   D+   + +  +   DV    S E   NY +        SR++   DSFK  E
Sbjct: 2   SDKEYTTKDVEAGNVQVKETLPDVETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAE 61

Query: 63  TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXX 122
                  +++P L+        K+ I+     L  +LK     RH+ M+S          
Sbjct: 62  VP-----ELDPNLTEAE-----KIAIATARSPLQHQLKN----RHLQMISIGGAIGTGLF 107

Query: 123 XXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALN 182
                    AGPAG++IG+ I  S IYC++ +V E+A+ +  + GGF  Y    +D +  
Sbjct: 108 VGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAF-PVAGGFTTYATRFIDESYG 166

Query: 183 FSIAWIYCIQWFCVCPLELVTASMTIQYW-TTKVNADIFVLIFYILVLAINIFGGARGYA 241
           F+  + Y +QW    PLE+V AS+T+ YW T K   D FV +F+++++ IN+FG  RGY 
Sbjct: 167 FANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINMFG-VRGYG 225

Query: 242 ETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVS 301
           E EFI + CKILM++GF IL I++ICGG    G+IG +YW  PGAF G     +FKG  S
Sbjct: 226 EAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGAFAGDTSGRKFKGFCS 285

Query: 302 TLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSS 361
             VTAAFSF  +E + + A+E SNPRK +P AAK+V +R  + Y+  ++++G+LVPY   
Sbjct: 286 VFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDP 345

Query: 362 ELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQ 421
            L+G SS    ASP+V+A+   G+  +P  +N VILI+V SV +SA Y+ SR L  LA Q
Sbjct: 346 RLIGGSSVDAAASPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQ 405

Query: 422 GYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALI 481
           G+ PK F+++DR GRP +G  V +   ++AF A S KE EVF+WL+A+SGLS +FTWA I
Sbjct: 406 GFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATI 465

Query: 482 CLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSAD 541
           CL HIRFRRA+  QGRS +E+ + S  GVWG+A+   + I+++  Q +V + P+G     
Sbjct: 466 CLCHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLG-APPS 524

Query: 542 VQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQE 601
              FFQ YL++P+ + ++LG+KIWK++W+LFI+A+D+D+ + R   D ++LRQ+ EE + 
Sbjct: 525 ANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERA 584

Query: 602 KLRNGPVWRRVYDFWC 617
            L   P+W R+Y F+C
Sbjct: 585 ALAAKPMWYRIYKFFC 600

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  473 bits (1217), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/573 (48%), Positives = 368/573 (64%), Gaps = 32/573 (5%)

Query: 17  ITKSSAKFNDVDVIDIDSAERNYELPTSS-TTHSRFRNFIDSFKPPETTHHIETDMNPIL 75
           I   S K  +++V +   A  +  + TS     + F++F  SFK  ++      D+    
Sbjct: 41  IEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDS------DL---- 90

Query: 76  SHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPA 135
                  D+ VE        + +L KTI+ RH++M+S                 A AGPA
Sbjct: 91  -------DSDVEAQ------DTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPA 137

Query: 136 GLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFC 195
           GL+IGY + +  IYCII A GE+ + Y  LVG F  YP  L+DP+L F+I+ +Y +QW  
Sbjct: 138 GLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLT 197

Query: 196 VCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMM 255
           V PL+LVTA++TI +WT  VN DIFVL  +I+V+ +N+FG ARGYAETEF CN CKILM+
Sbjct: 198 VLPLQLVTAAITISFWT-DVNPDIFVLCVFIVVIIVNLFG-ARGYAETEFFCNCCKILMI 255

Query: 256 IGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEF 315
            GF IL IVII GGAG DG+IG KYW  PG F      + FKGV +    AAFS+G  E 
Sbjct: 256 TGFIILSIVIITGGAGKDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEV 310

Query: 316 LAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASP 375
           + ++  EQ +P  A+P+A KKV+YR LLIYL + I+V  LVPYDS  LLGSS + + ASP
Sbjct: 311 VVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASP 370

Query: 376 YVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTG 435
           +V+A+ +HGV+VVPHFINAVILISV SVA+S+ YSSSR+LL+L+ QG  P+   F+D  G
Sbjct: 371 FVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNG 430

Query: 436 RPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQ 495
           RP   F++  +  ++ F A S K  +VF WLLAISGLSQ+F W  + LSHIR R AMK Q
Sbjct: 431 RPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQ 490

Query: 496 GRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPV 554
           G+S+DEIGYK+Q G WGS  A  +    ++ Q WV I PV + G  DV  FFQ+YLA P+
Sbjct: 491 GKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPI 550

Query: 555 FIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIH 587
            +V YLG+KI+ ++WRL+I A  IDL SHR I+
Sbjct: 551 VLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  466 bits (1200), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 252/577 (43%), Positives = 366/577 (63%), Gaps = 26/577 (4%)

Query: 42  PTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKK 101
           P   T   RFR   DSFK  +T      D++P L+     D  K+ I       N  LK+
Sbjct: 36  PVEGTRWERFR---DSFKRADTQ-----DLDPNLT-----DAEKMAILTA----NAPLKR 78

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
           T++ RH+ M++                 A AGPAG++IG+A+  + IYC++ A+GE+AV 
Sbjct: 79  TLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVT 138

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIF 220
           +  + GGF  Y    VD +  F+   IY +QW  V PLE+V AS+T+ YW T     D F
Sbjct: 139 F-PIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGF 197

Query: 221 VLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKY 280
           V +FY++++AIN FG  +GY E EFI +  K++ +IG+ ILG++++CGG    G+IGG+ 
Sbjct: 198 VALFYVVIVAINFFG-VKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRL 256

Query: 281 WRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 340
           W +PGAF      N FKGV S  VTAAFSF  +E + + A+E +NPRK++PSAAK+V +R
Sbjct: 257 WHNPGAF-----ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWR 311

Query: 341 ALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISV 400
             L Y+ ++++VGLLVPY S  L+G SS    ASP+V+++   G++ +P  IN VILI+V
Sbjct: 312 ITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAV 371

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
            SV +SA ++ SR +  LA QG  PK+F ++DRTGRP +G +V  V  +++F A S KE 
Sbjct: 372 LSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEG 431

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
           EVF+WLLA+SGLS +FTW  I L HIR RRA+  Q R+  E+ + +  GVWGS Y FV++
Sbjct: 432 EVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLI 491

Query: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
           ILI++ Q W+ + P+G+      AFF+ YL+ P+ I  Y+G+KIWK++W+LFIRAK+ID+
Sbjct: 492 ILILMAQFWIALFPIGD-KPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDI 550

Query: 581 ISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            + R   D E L+QE  E +  + + P + R+Y FWC
Sbjct: 551 DTGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  461 bits (1187), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 232/496 (46%), Positives = 328/496 (66%), Gaps = 6/496 (1%)

Query: 98  KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGE 157
            L+++I+PRHV M+S                 A AG  G +IGY I+   + C +Q+VGE
Sbjct: 24  SLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGE 83

Query: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217
           + V + +L GGFN+Y    +DP+L F ++W++C+QW  V PLELVTASMTI+YW + ++ 
Sbjct: 84  LVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLSP 143

Query: 218 DIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIG 277
            +FV  FYIL+  +N FG   GYAE EFI N  K++++  F +LGIVII GG GN G IG
Sbjct: 144 SLFVSAFYILICIVNFFGSG-GYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIG 202

Query: 278 GKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQS--NPRKAIPSAAK 335
            +Y + PGAF  +   N FK    TLV AAFS G  EFLA++A+EQ+  N  K+I  A +
Sbjct: 203 FQYLKTPGAFNTNY--NVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIRRACR 260

Query: 336 KVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAV 395
           +V  R  + YL SI +VGLLVPYDS  L+GS S  T  SPYV A++ HGVR+VPH INAV
Sbjct: 261 QVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHIINAV 320

Query: 396 ILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCAC 455
           ILI+V SVA+SA YSSSR L +LA Q +AP+ F  +++ G+P    +V A++ +++F A 
Sbjct: 321 ILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISFIAE 380

Query: 456 SSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAY 515
              +  VF WLL+ISGLS +FTW  IC++HIRFR A+K+QG+S+D +GY+S  GV GS  
Sbjct: 381 YRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGSYI 440

Query: 516 AFVMMILIMIGQCWVGIVPV-GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIR 574
           A  + ++++I Q WV + P+   G  D   FFQ+Y+A+PV ++LYLG+K++  DW  +IR
Sbjct: 441 ATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPWIR 500

Query: 575 AKDIDLISHRHIHDPE 590
              +D+ + R ++ P 
Sbjct: 501 THCVDINTDRDVYAPS 516

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  462 bits (1188), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 248/608 (40%), Positives = 364/608 (59%), Gaps = 20/608 (3%)

Query: 13  EKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTT--HSRFRNFIDSFKPPETTHHIETD 70
           E+     +S   ++V V +I     +Y+    S+T  HSR+  F +SFK  E     E +
Sbjct: 5   EEKTRLPASKGGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAE-----EME 59

Query: 71  MNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXA 130
           ++P L+        ++ I      L   LK     RH+ M++                  
Sbjct: 60  LDPNLTEAE-----RIAIKTAQSPLKHHLKN----RHLQMIAIGGAIGTGLFVGSGTALR 110

Query: 131 HAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYC 190
            AGPAG++IG+ +  + IY ++ AVGE+AV +  + GGF  Y    VD +  F+  +IY 
Sbjct: 111 TAGPAGILIGWGLTGTMIYSMVMAVGELAVVF-PVAGGFTTYATRFVDESFGFAANFIYM 169

Query: 191 IQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
           +QW  V PLE+V AS+T+ YW T     D FV +FY++++ IN+FG  +GY E EFI + 
Sbjct: 170 LQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFG-VKGYGEAEFIFSF 228

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFS 309
            K++ +IGF I+ IV+ICGG  +  +IG +YW +PGAF G     +F+G  +  VTAAFS
Sbjct: 229 IKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAFVGDTAGQQFQGFCTVFVTAAFS 288

Query: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369
           F  +E + +  SE   PRK++P AAK+V +R  L Y+  ++++G+LVP DS  L+G+SS 
Sbjct: 289 FAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSV 348

Query: 370 ATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFT 429
              ASP+V+A+  HG++ +P  +N VILI+V SV +SA YS SR L  LA QG+ P +  
Sbjct: 349 DAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICG 408

Query: 430 FVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFR 489
           ++DR GRP +G  + A   ++AF A S KE +VFNWL+A+SGLS +FTWA ICL HIR+R
Sbjct: 409 YIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYR 468

Query: 490 RAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDY 549
            A+  QGRS DE+ +++  GVWGS + F M IL+ I Q +VG+ P G    +   FF  Y
Sbjct: 469 GALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGT-KPNAYDFFLAY 527

Query: 550 LAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVW 609
           L+  +FI LY  +KIWKR+W+LFI  KD+D+ + R   D ++LR+E  E +  L   P W
Sbjct: 528 LSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVDLDVLREELAEERAALAARPFW 587

Query: 610 RRVYDFWC 617
            R + FWC
Sbjct: 588 YRSWKFWC 595

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  460 bits (1183), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 250/619 (40%), Positives = 383/619 (61%), Gaps = 27/619 (4%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSST-------THSRFRNFIDSFK 59
           S+  SYEKN+    + K N + +      +    +P++ +       + S++++F DSFK
Sbjct: 2   SNTSSYEKNN--PENLKHNGITIDSEYLTQEPITIPSNGSAVSTEKGSGSKWKDFRDSFK 59

Query: 60  PPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXX 119
             E    +E D N   + +  F  A+             LK  ++ RH+ M++       
Sbjct: 60  RVEP---VEVDPNLTEAEKVAFITAQT-----------PLKHQLKNRHLQMIAIGGAIGT 105

Query: 120 XXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDP 179
                        GPA L+IG+  M + IY ++ A+GE+AV +  + GGF  Y    +D 
Sbjct: 106 GLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGELAVVF-PISGGFTTYATRFIDE 164

Query: 180 ALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGAR 238
           +  F+  + Y +QW    PLE+V+AS+T+ YW T     D FV +F+++++ IN+FG  +
Sbjct: 165 SFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRDGFVALFWLVIVCINMFG-VK 223

Query: 239 GYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKG 298
           GY E EF+ +  K++ +IGF ILGI++ CGG    G+IGGKY+ DPGAF G     +FKG
Sbjct: 224 GYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAFAGDTPGAKFKG 283

Query: 299 VVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPY 358
           V S  VTAAFSF  +E + + ASE  +PRK++P AAK+V +R  L Y+ S++++GLLVPY
Sbjct: 284 VCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPY 343

Query: 359 DSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTL 418
           + S L+G+SS    ASP+V+A+ THG++ +P  +N VILI+V SV +SA ++ SR  + L
Sbjct: 344 NDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVAL 403

Query: 419 ARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTW 478
           A QG+ P++F +VDR GRP +G ++ + + ++AF A S+KE +VFNWLLA+SGLS +FTW
Sbjct: 404 AEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTW 463

Query: 479 ALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEG 538
             IC+ HIRFR+A+  QGRS+DE+ +KS  GVWGS +   M++++ I Q +V + PV  G
Sbjct: 464 GGICICHIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPV-NG 522

Query: 539 SADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           S   + FF+ YL+ P+ + +Y+G+KI+KR+W+L I A ++D+ S R   D E+L+QE  E
Sbjct: 523 SPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAE 582

Query: 599 YQEKLRNGPVWRRVYDFWC 617
            +  L   P W RVY FWC
Sbjct: 583 EKAILATKPAWFRVYSFWC 601

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  459 bits (1181), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 270/567 (47%), Positives = 360/567 (63%), Gaps = 18/567 (3%)

Query: 33  DSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSV---FDDAKVEIS 89
           DS + N E      +     N   + KP   T   E   NPI   ++    F   K    
Sbjct: 22  DSFKENAEETVKHISIEEASNETLNEKPEAHTQKCE--YNPITHFKNFLNGFKRQKQNEE 79

Query: 90  QVDDELNE-KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
             D E+ + +L KTI+ RH++M+S                 + AGP GLVIGY I +  I
Sbjct: 80  GADLEMQDTQLSKTIKARHLLMISLGTGIATGLLVGNGQVLSKAGPGGLVIGYFISSVMI 139

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           YC+IQ+ GE+ + Y  LVG F  Y   L+DP+L F+++ +Y  QW  V PL+LVTA++TI
Sbjct: 140 YCMIQSAGELGICYRGLVGNFTRYSSLLIDPSLGFALSILYTFQWLTVLPLQLVTAAITI 199

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           ++WT  +N DIFV I +I+V+ +N+FG ARGYAE EF CN CKILM+IGF IL I+II G
Sbjct: 200 EFWT-DLNPDIFVAIIFIVVIVVNLFG-ARGYAEAEFFCNLCKILMIIGFIILSIIIISG 257

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           GAGNDG+IG KYW++PGAF      N FKGV +    AAFS+G  E L ++  EQ NP K
Sbjct: 258 GAGNDGYIGAKYWKNPGAF-----ANGFKGVCTVFTYAAFSYGGIEVLVLSIDEQENPIK 312

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS----SSAATKASPYVLAVSTHG 384
            +P+  KKV YR L IYL + I+V  LVPY S +LLGS     ++ + ASP+V+AV +HG
Sbjct: 313 VVPNCCKKVAYRILFIYLLTTILVCFLVPYTSPQLLGSLNKGENSGSHASPFVIAVESHG 372

Query: 385 VRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVG 444
           V+VVPHFINAVILISV SVA+S+ YSS R+LL+L+ QG  P+   ++D+ GRP   F++ 
Sbjct: 373 VKVVPHFINAVILISVISVANSSVYSSGRLLLSLSEQGTFPQFLNYIDQRGRPIRCFVIS 432

Query: 445 AVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGY 504
               ++ F A S K  +VF WLLAISGLSQ+F W  ICLSHIRFR AMK Q +S+DE+GY
Sbjct: 433 LTFGLIGFVASSEKRQDVFTWLLAISGLSQLFIWLAICLSHIRFRDAMKTQKKSMDEVGY 492

Query: 505 KSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE-GSADVQAFFQDYLAMPVFIVLYLGYK 563
           K+Q G WGS  A ++ +  ++ Q WV I PV + G  DV +FFQ+YLA P+ +V Y G+K
Sbjct: 493 KAQTGYWGSWVAVLIGLFSLVTQFWVAIAPVDKNGKLDVMSFFQNYLAFPIVLVAYFGHK 552

Query: 564 IWKRDWRLFIRAKDIDLISHRHIHDPE 590
           ++  +W   I    IDL SHR I+ PE
Sbjct: 553 LYYGNWCPLIPLSKIDLDSHRKIYSPE 579

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  455 bits (1170), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/613 (41%), Positives = 367/613 (59%), Gaps = 24/613 (3%)

Query: 11  SYEKNDITKSSAKFNDVDVIDIDSAERNYELP-TSSTTHSR---FRNFIDSFKPPETTHH 66
           SYEK DI+        V+   I     +++L  T S  H +   +  F+DSF+  E    
Sbjct: 4   SYEK-DISDGKDAHLRVESEFISQEPLSHDLSSTGSEEHKKGKVWTRFVDSFRERE---R 59

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
           +E D N     Q  F  A           N  L+  ++ RH+ M++              
Sbjct: 60  LEVDPNMSELDQIAFRTA-----------NSPLQHHLKNRHLQMIAIGGAIGTGLFVGSG 108

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
                AGPAG++IG+ +  + IY ++ A+GE+AV +  + GGF  Y    +D +  F+  
Sbjct: 109 TALRTAGPAGILIGWGLTGTMIYSMVMALGELAVLF-PVSGGFTTYATRFIDESYGFANN 167

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEF 245
             Y +QW  V PLE+V AS+T+ YW T     D FV +F++ +  IN+FG  +GY E EF
Sbjct: 168 INYMLQWLVVLPLEIVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFG-VKGYGEAEF 226

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDP-GAFRGSDGPNRFKGVVSTLV 304
           I +  K++ ++GF ILGI++ CGG    G+IGG+YW  P GAF G     RFKGV S  V
Sbjct: 227 IFSIIKVITVVGFIILGIILNCGGGPVKGYIGGRYWHHPYGAFVGDSAGARFKGVCSVFV 286

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
           TAAFSF  +E + + ++E +NPRK++P AAK+V +R  L YL ++ +VGLLVPY    L+
Sbjct: 287 TAAFSFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLI 346

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
           G+SS    ASP+V+A++THG+R +P  +N VILI+V SV +SA Y+ SR L  LA Q + 
Sbjct: 347 GASSVDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFL 406

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           PK F ++DR+GRP    LV +   ++AF A S KE EVFNWLLA+SGLS +FTW  ICL 
Sbjct: 407 PKFFGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLC 466

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQA 544
           HIRFR+A+  QGR  DE+ + S  GV+GS +   M+IL+ I Q +V + P G    + +A
Sbjct: 467 HIRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPG-AKPNAKA 525

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
           FF+ YL+ P+ I  YLG+KI+K++W++FI+A+D+D+ + R   D ++LRQE  E +  L 
Sbjct: 526 FFEAYLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLA 585

Query: 605 NGPVWRRVYDFWC 617
             P W R + FWC
Sbjct: 586 TKPWWYRWWVFWC 598

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  454 bits (1169), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 241/576 (41%), Positives = 361/576 (62%), Gaps = 18/576 (3%)

Query: 43  TSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKT 102
           T+  + +R++ F DSFK  E     + +++P L+       A  +           L+ T
Sbjct: 61  TTQPSTTRWQKFKDSFKKAE-----DVELDPNLTEAERIAQATAK---------APLQHT 106

Query: 103 IQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNY 162
           ++ R   M++                    GPAGL+IG+ + ++ IY ++ A+GE+AV +
Sbjct: 107 LKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVF 166

Query: 163 LTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFV 221
             + GGF  Y    VD +  ++  + Y +QW  V PLE+V+AS+T+ YW T     D FV
Sbjct: 167 -PVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDGFV 225

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281
            +F+++++ IN+FG  +G+ E EF+ +  K+  +IGF ILGIV++CGG    GF+G KYW
Sbjct: 226 ALFWLVIVIINMFG-VKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYW 284

Query: 282 RDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 341
            DPGAF G     +FKGV S  VTAAFSF  +E + ITA+E +NPRK+IP AAK+V++R 
Sbjct: 285 HDPGAFVGHGSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRI 344

Query: 342 LLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVF 401
           +L Y+ ++ ++GLLVPY+   L+G+SS    ASP+V+A+ THG++ +P  IN VILI+V 
Sbjct: 345 VLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVL 404

Query: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461
           SV +SA ++ SR +  L+ QG+ PKVF ++DR+GRP +G  + +   ++AF A S KE E
Sbjct: 405 SVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGE 464

Query: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521
           VFNWLLA+SGLS +FTW  ICL HIRFR A+K QGR  +E+ + S  GV GS +   M++
Sbjct: 465 VFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIV 524

Query: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581
           L+ I Q +V + P G G  D + FFQ YL+ P+ +  Y G+KI+KR+W+LFI  +D+D+ 
Sbjct: 525 LMFIAQFYVALFPPG-GKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDID 583

Query: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           + R   D E+L+QE  E +  L + P + R Y FWC
Sbjct: 584 TGRRETDMELLKQEIMEEKAILASKPWYIRAYAFWC 619

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  453 bits (1166), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 225/571 (39%), Positives = 345/571 (60%), Gaps = 10/571 (1%)

Query: 55  IDSFKPP---ETTHHIETDMNPILSHQSVFDD----AKVEISQVDDELNEKLKKTIQPRH 107
           +D FKP    E   H     +   S +++  D    +  E +  D   + KL K +  RH
Sbjct: 37  VDGFKPGNAVEYGEHTSLKSSSFDSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRH 96

Query: 108 VVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVG 167
           ++ ++                    GPA L++ + I+++C++ I+ A+GE+A  +  +VG
Sbjct: 97  LLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVF-PVVG 155

Query: 168 GFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYIL 227
           GFN Y    V+P+  F++   Y  QW  + PLELV AS+TI+YW   +N+D +V IFY  
Sbjct: 156 GFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTA 215

Query: 228 VLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF 287
           +   N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG  +  +IGG+YW DPGAF
Sbjct: 216 IFLANMLD-VKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF 274

Query: 288 RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
            G     RFKGV +  VTAAFS+  TE +A++A+E  NPR  +P A+K+  +   L Y+ 
Sbjct: 275 VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYIT 334

Query: 348 SIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADS 406
            + I+G LVPY+   LL G+SS    ASP V+A+   G++ +P  +NA+ILI++ SVA+S
Sbjct: 335 VLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANS 394

Query: 407 AFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWL 466
           A Y+ SR ++ +A  G  PK   ++D+ GRP        +  +++F A S K+ EVF WL
Sbjct: 395 AVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWL 454

Query: 467 LAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIG 526
            A+SGLS +F W  I LSHIRFR+AMK Q RS++E+ + S  GV+GS Y  +++ L++I 
Sbjct: 455 SALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIA 514

Query: 527 QCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHI 586
             W  + PVG   AD ++FF+ YL++P+FIV YLG+K++K+DWRL+++ KD+DL + R  
Sbjct: 515 SFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRRE 574

Query: 587 HDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            D +IL+QE    +E++   P + R  + WC
Sbjct: 575 IDLDILKQEIRLEREQMAQKPFYIRFLNVWC 605

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  452 bits (1164), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 247/620 (39%), Positives = 383/620 (61%), Gaps = 28/620 (4%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPT--SSTTH------SRFRNFIDSF 58
           S+  SYEKN+    + K N + +      +    +P+  S+TT+      S++++F DSF
Sbjct: 2   SNTSSYEKNN--PENLKHNGITIDSEFLTQEPITIPSNGSATTNDEAGSGSKWQDFKDSF 59

Query: 59  KPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXX 118
           +  E    +E D N   + +  F  A+             LK  ++ RH+ M++      
Sbjct: 60  RRVEP---VEVDPNLTEAEKVAFVTAQT-----------PLKHHLKNRHLQMIAIGGAIG 105

Query: 119 XXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVD 178
                         GPA L+IG+    + IY ++ A+GE+AV +  + GGF  Y    +D
Sbjct: 106 TGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELAVIF-PISGGFTTYATRFID 164

Query: 179 PALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGA 237
            +  ++  + Y +QW  V PLE+V+AS+T+ +W T     D FV +F+++++ IN+FG  
Sbjct: 165 ESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVIINMFG-V 223

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFK 297
           +GY E EF+ +  K++ ++GF ILGI++ CGG    G+IGGKYW DPGAF G     +FK
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPGAKFK 283

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G+ S  VT+AFSF  +E + + ASE  +PRK++P AAK+V +R  L Y+ S+++VGLLVP
Sbjct: 284 GLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVP 343

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           Y+   L+G+SS    ASP+V+A+ THG++ +P  +N VILI+V SV +SA Y+ SR ++ 
Sbjct: 344 YNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVA 403

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA Q + P++F +VDR GRP +G  V +   ++AF A S KE +VFNWLLA+SGLS +FT
Sbjct: 404 LAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFT 463

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W  IC+ HIRFR+A+  QGR +DE+ +KS  GVWGS +   M++++ I Q +V + PVG 
Sbjct: 464 WGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVG- 522

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE 597
            S   + FF+ YL+ P+ + +YLG+KI+KR+W+LFI A+D+D+ + R   D E+L+QE  
Sbjct: 523 ASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRREVDLELLKQEIA 582

Query: 598 EYQEKLRNGPVWRRVYDFWC 617
           E +  +   P W R+++FWC
Sbjct: 583 EEKAIMATKPKWYRIWNFWC 602

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  452 bits (1162), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 252/620 (40%), Positives = 370/620 (59%), Gaps = 26/620 (4%)

Query: 7   SSKESYEKNDITKSSA------KFNDVDVID--IDSAERNYELPTSSTTHSRFRNFIDSF 58
           SS E Y   D +K          F+  D++   ++S +   +    ++  S + NF+DSF
Sbjct: 2   SSPEEYNLEDRSKEKNITIIRDDFSGQDIVSESLESFDNQIDSSNYASHRSAWGNFLDSF 61

Query: 59  KPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXX 118
           K  E       +++P L+     D  K+ I      L  KLK     RH+ M++      
Sbjct: 62  KRVEVE-----EVDPNLT-----DLEKIAIKTARSPLQHKLKS----RHLQMIAIGGAIG 107

Query: 119 XXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVD 178
                        AGPAG++IG++I  + I+ ++ A+GE+AV +  + GGF  Y    +D
Sbjct: 108 TGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGELAVMF-PVSGGFTTYATRFID 166

Query: 179 PALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGA 237
            +  F+  + Y +QW  V PLE+V AS+T+ YW T V   D FV +F+++V+ IN+FG  
Sbjct: 167 ESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVALFWLVVVIINMFG-V 225

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFK 297
           RGY E EF+ +  K+  +IGF ILGIV++CGG    G++G +YW +PGAF GS    +F 
Sbjct: 226 RGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAFVGSTSGQKFH 285

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G  S  VTAAFSF  +E + +  SE  NPRKA+PSAAK+V +R LL Y+  ++++G LVP
Sbjct: 286 GFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVP 345

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           Y+   L+ SSS    ASP+V+A+ THG+  +P  IN VILISV SV +SA YS SR L+ 
Sbjct: 346 YNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVA 405

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           L+ QG+ PK+ +++DR GRP +G  + +   ++AF A S+K+ E+FNWLLAISGLS  FT
Sbjct: 406 LSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFT 465

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W+ IC+ HIRFR A+K QGR  DE+ + S  GV GS +   + IL++I Q ++ + P+G 
Sbjct: 466 WSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIG- 524

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE 597
           GS     FF  YLA PV +  Y+ +K+WK++W+  I  +D+D+ + R   D  +L+QE  
Sbjct: 525 GSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTDVNLLKQEIA 584

Query: 598 EYQEKLRNGPVWRRVYDFWC 617
           E +  L   P W RVY FWC
Sbjct: 585 EEKAALAMRPWWYRVYVFWC 604

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  451 bits (1160), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 248/620 (40%), Positives = 379/620 (61%), Gaps = 28/620 (4%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSST--------THSRFRNFIDSF 58
           S+  SYEKN+    + K N + +      +    +P++ +        + S++++F DSF
Sbjct: 2   SNTSSYEKNN--PDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSF 59

Query: 59  KPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXX 118
           K       IE D N       + +  KV I      L   LK     RH+ M++      
Sbjct: 60  K---RVKPIEVDPN-------LSEAEKVAIITAQTPLKHHLKN----RHLQMIAIGGAIG 105

Query: 119 XXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVD 178
                         GPA L+IG+    + IY ++ A+GE+AV +  + GGF  Y    +D
Sbjct: 106 TGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIF-PISGGFTTYATRFID 164

Query: 179 PALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGA 237
            +  ++  + Y +QW  V PLE+V+AS+T+ +W T     D FV +F++ ++ IN+FG  
Sbjct: 165 ESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFG-V 223

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFK 297
           +GY E EF+ +  K++ ++GF ILGI++ CGG    G+IGGKYW DPGAF G     +FK
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFK 283

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           GV S  VTAAFSF  +E + + ASE   PRK++P AAK+V +R  L Y+ S++++GLLVP
Sbjct: 284 GVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVP 343

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           Y+   L+G+SS    ASP+V+A+ THG++ +P  +N VILI+V SV +SA Y+ SR ++ 
Sbjct: 344 YNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVA 403

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA Q + P++F++VDR GRP +G  V +   ++AF A S KE EVFNWLLA+SGLS +FT
Sbjct: 404 LAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFT 463

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W  IC+ HIRFR+A+  QGR +DE+ +KS  GVWGS +   M+I++ I Q +V + PVG+
Sbjct: 464 WGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGD 523

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE 597
            S   + FF+ YL+ P+ +V+Y+G+KI+KR+W+LFI A+ +D+ + R   D ++L+QE  
Sbjct: 524 -SPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIA 582

Query: 598 EYQEKLRNGPVWRRVYDFWC 617
           E +  +   P W R+++FWC
Sbjct: 583 EEKAIMATKPRWYRIWNFWC 602

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  446 bits (1147), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 246/576 (42%), Positives = 361/576 (62%), Gaps = 23/576 (3%)

Query: 43  TSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKT 102
           TS    +R+  F DSF+  ET      D++P L+        K+ I       N  LK+T
Sbjct: 34  TSRVGGTRWERFKDSFREAETV-----DLDPSLTPAE-----KMAILTA----NAPLKRT 79

Query: 103 IQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNY 162
           ++ RH+ M+                  A AGPAG++IG+A+  + IYC++ A+GE+AV +
Sbjct: 80  LKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTF 139

Query: 163 LTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFV 221
             + GG+  Y    VD +  F+   +Y + W    PLE+V AS+T+ YW T     D FV
Sbjct: 140 -PVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFV 198

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281
            +FY++++ IN+FG  +GY E EFI +  K++ +IGF ILG++++CGG    G+IGG+ W
Sbjct: 199 ALFYVVIVGINLFG-VKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLW 257

Query: 282 RDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRA 341
            +PGAF      N FKGV S  VTAAFSF  +E + + A+E +NPRK+IPSAAK+V +R 
Sbjct: 258 HNPGAF-----ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRI 312

Query: 342 LLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVF 401
            L Y+ ++++VGLLVPY S  L+G SS    ASP+V+++   G++ +P  IN VILI+V 
Sbjct: 313 TLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVL 372

Query: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461
           SV + A +  SR +  LA QG  PK+F ++DRTGRP +G +V  V  +++F A S KE E
Sbjct: 373 SVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGE 432

Query: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521
           VF+WLLA+SGLS +FTW  I L HIR RRA+  Q R+  E+ + +   VWGS Y+ +++I
Sbjct: 433 VFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILII 492

Query: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581
           LI+I Q W+ + P+G G     AFF+ YL+ P++IV Y+G+KIWK++W+LFI+A DID+ 
Sbjct: 493 LILIAQFWIALFPIG-GKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDID 551

Query: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           S R   D E L+QE  E +  + + P + R+Y FWC
Sbjct: 552 SGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  446 bits (1148), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 245/613 (39%), Positives = 369/613 (60%), Gaps = 24/613 (3%)

Query: 11  SYEKNDITKSS----AKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           S EK D+ K+     ++F   + ++I + E +        + SR+R F DSFKP +    
Sbjct: 3   SLEKTDLPKNELQIDSEFLREEPLEISNFEESSSSQGPQPSGSRWRKFKDSFKPLD---- 58

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDEL-NEKLKKTIQPRHVVMMSXXXXXXXXXXXXX 125
                      ++V  D   +I ++     +  LK  ++ RH+ M++             
Sbjct: 59  -----------EAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGS 107

Query: 126 XXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSI 185
                 AGPAG++IG+ +  + IYC++ A+GE++V +  + GGF  Y    +D +  F+ 
Sbjct: 108 GTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVF-PISGGFTTYATRFIDESFGFAN 166

Query: 186 AWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETE 244
            + Y +QW CV PLE+V AS+T+ YW T     D FV +F+++++ IN+FG  +GY E E
Sbjct: 167 NFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFG-VKGYGEAE 225

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLV 304
           F+ +  K+L +IGF I+GIV+ CGG    G+IGGKY+ DPGAF G     RF+GV S  V
Sbjct: 226 FVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFV 285

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
           TAAFSF  +E + I A+E + PRK++P AAK+V +R  L Y+ S+++VGLLVPY    L+
Sbjct: 286 TAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLI 345

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
           G+SS    ASP+V+A+++HG+R +P  +N VILI+V SV +SA Y  SR L  LA+Q + 
Sbjct: 346 GASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFL 405

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           PK+F ++DR+GRP  G    +   ++AF A S KE EVF WLLA+SGLS +FTW  IC  
Sbjct: 406 PKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFC 465

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQA 544
           HIRFR A+  QGRS DE+ +K+  G++GS +   M++L+ + Q +V + P G G    + 
Sbjct: 466 HIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPG-GKPSAEV 524

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
           FFQ YL+ PV +  Y G+K++ R+W+L I    +D+ + R   D ++LRQE  E ++ + 
Sbjct: 525 FFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMS 584

Query: 605 NGPVWRRVYDFWC 617
             P W R Y FWC
Sbjct: 585 TRPWWYRWYSFWC 597

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 235/535 (43%), Positives = 342/535 (63%), Gaps = 11/535 (2%)

Query: 76  SHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPA 135
           S +SV +D  VE         E L+++I+PRHV M+S                 A AG  
Sbjct: 20  SVESVAED--VEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIG 77

Query: 136 GLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFC 195
           G +IGY I+   + C +Q+VGE+ V + +L GGFN+Y    +DP+L FS++W++C+QW  
Sbjct: 78  GTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMI 137

Query: 196 VCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMM 255
           V PLELVT SMTI+YW   ++  +FV +FY L+  +N FG   GYAE EFI NS K++++
Sbjct: 138 VLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSG-GYAEAEFIFNSLKVVVI 196

Query: 256 IGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEF 315
           IGF ILG++I  G  G  G IG +Y  DPG F  +   N  K    TLV AAFS G  EF
Sbjct: 197 IGFIILGVLIDTGCVGTSGTIGFRYLIDPGMF--NKNYNIIKATAGTLVNAAFSCGGVEF 254

Query: 316 LAITASEQS--NPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA 373
           LA++A+EQ+  N  K+I  A  +V  R  + YL SI +VGLLVP++S  L+GS S    +
Sbjct: 255 LALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHS 314

Query: 374 SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDR 433
           SPYV AV+ +G+ VVPH INAVILI+V SVA+SA YSSSR L +LA Q +APK FT +++
Sbjct: 315 SPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNK 374

Query: 434 TGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMK 493
            G+P     + A+  +++F A    +  +F WLL+ISGLS +FTW  IC++HIRFR A+K
Sbjct: 375 HGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIK 434

Query: 494 VQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV-GEGSADVQAFFQDYLAM 552
            +G+S++ +GYKS  GV GS  A V+ ++I++ Q WV + P+   G  ++  FFQ+Y+A+
Sbjct: 435 SRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAV 494

Query: 553 PVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGP 607
           PV ++ Y+G+K++ ++W L IRA ++D+ + R I+ P I   E  + +  ++N P
Sbjct: 495 PVALLFYIGHKVYTKNWSLLIRASNVDITTDRDIYCPTI---EDPKIKVLMQNSP 546

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  443 bits (1140), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 244/588 (41%), Positives = 376/588 (63%), Gaps = 19/588 (3%)

Query: 32  IDSAE-RNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQ 90
           ++S E  N+E     ++ S++++F +SFK  E       +++P L+     +  K+ I+ 
Sbjct: 23  VESGEFTNHEASNEESSGSKWQDFKNSFKRMEVV-----ELDPNLT-----EAEKIAIAT 72

Query: 91  VDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYC 150
                N  LK+ ++ RH+ M++                   AGPAG++IG+A+  + IYC
Sbjct: 73  A----NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYC 128

Query: 151 IIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQY 210
           ++ A+GE+AV +  + GGF  Y    +D +  ++  + Y +QW  V PLE+V AS+T+ Y
Sbjct: 129 MVMAMGELAVTF-PVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNY 187

Query: 211 WTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGG 269
           W T     D FV +FY+++++IN+FG  +GY E EF+ +  K++ +IGF ILGI+++CGG
Sbjct: 188 WGTDPKYRDGFVALFYVVIVSINMFG-VKGYGEAEFVFSFIKVITVIGFIILGIILVCGG 246

Query: 270 AGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKA 329
               G+IGG  W +PGAF G+    RFKGV S  VTAAFSF  +E + + ++E +NPRK+
Sbjct: 247 GPVGGYIGGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKS 306

Query: 330 IPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVP 389
           +P AAK+V +R  L Y+ S+ ++GLLVPY+ + L+G+SS    ASP+VLA+  HG++ +P
Sbjct: 307 LPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLP 366

Query: 390 HFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAV 449
             +N VILI+V SV +SA +  SR L  LA QG+ PK+F ++DR GRP +G    +   +
Sbjct: 367 SVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGL 426

Query: 450 MAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVG 509
           ++F A S KE EVF+WLLA+SGLS +FTW  IC+ H+RFRRA+  QGRS DE+ + S  G
Sbjct: 427 LSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAG 486

Query: 510 VWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDW 569
           VWGS Y  V+++LI+  Q W+ + P+G    D + FF+ YL++PV +V+Y+G+K +KR+W
Sbjct: 487 VWGSIYGTVLIMLILAAQFWIALFPIGS-PPDAKDFFESYLSLPVVLVMYIGHKCYKRNW 545

Query: 570 RLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +LFIRA++ID+ + R   D E L+ E  E +  L +  +W R Y FWC
Sbjct: 546 KLFIRAENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYYFWC 593

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  441 bits (1135), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 225/573 (39%), Positives = 346/573 (60%), Gaps = 24/573 (4%)

Query: 47  THSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPR 106
             SRF+NF+D F+          D++P L+                   +  LK+ ++ R
Sbjct: 51  NKSRFQNFVDGFRELRME-----DVDPNLTAAE---------RAAIATASSPLKRHLKNR 96

Query: 107 HVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLV 166
           H+ M++                    GPA +VI + +  S +Y ++QA+GE+AV  L + 
Sbjct: 97  HLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGELAVA-LPVS 155

Query: 167 GGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFY 225
           G + +Y    ++P+  F+IA+ Y I      PLEL+ AS+T+ YW      AD FV +FY
Sbjct: 156 GSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYADAFVALFY 215

Query: 226 ILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND-GFIGGKYWRDP 284
           I+++ IN+FG  +GY E EF+ +  K+  ++GF ILGIV++CGG  +D G+IG +YW +P
Sbjct: 216 IVIVGINLFG-VKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGARYWYNP 274

Query: 285 GAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLI 344
           G F      + FKG  +  VT+AFSF  +E  A+ A+E  NPRK +P AAK+V +R  L 
Sbjct: 275 GGF-----AHGFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQVFWRITLF 329

Query: 345 YLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVA 404
           Y+ S+ ++G LVPY    L  +SS    ASP+V+A++  G++ +P  +N VILI+V SV 
Sbjct: 330 YVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVNVVILIAVLSVG 389

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           +   Y++SR +L+LA  G+ P+ F +VDR GRP +G L+ A+  +++F + SS   EVF+
Sbjct: 390 NCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSASSNYGEVFD 449

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           W+LAISGL+  F W  IC+ H+RFRRA+ VQGRS DE+ YK+Q G+WGS Y   ++ +++
Sbjct: 450 WMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGSLYGIGLIFIVL 509

Query: 525 IGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHR 584
             Q WV + P+G GS +   FF  YL++PV I  Y  +K++ R W   I++ DID+ + R
Sbjct: 510 CFQFWVALFPIG-GSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIKSSDIDIDTGR 568

Query: 585 HIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
              D E+L+QE +E Q+ +R+ P+W R+Y FWC
Sbjct: 569 REMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  441 bits (1134), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 227/594 (38%), Positives = 357/594 (60%), Gaps = 18/594 (3%)

Query: 25  NDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDA 84
           N  +V++  +++ +Y   +   + S++++F DSFK  ++      D++P L+     D  
Sbjct: 24  NQENVVESGASQEDYSNSSYPKSGSKWKDFKDSFKRMDSV-----DLDPNLT-----DAQ 73

Query: 85  KVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIM 144
           K+ I      L  KLK     RH+ M++                   AGPAG++IG+ +M
Sbjct: 74  KIAILTSQSPLQRKLKN----RHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLM 129

Query: 145 ASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTA 204
           A+ I C+  ++GEMAV +  + GG+  Y    +D +  F+    Y +Q   V PLE+V A
Sbjct: 130 ATMILCMCLSLGEMAVTF-PVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAA 188

Query: 205 SMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263
           S+T+ YW  K      FV +F++ +++IN+FG  +GY E EF+ +  K++ +IGF ILG+
Sbjct: 189 SITVDYWGPKSQYRAAFVALFWLCIVSINMFG-VKGYGEAEFVFSLIKVVTVIGFIILGV 247

Query: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323
           +++CGG     +IG K+W +PGAF G     +FKG+ S  VTAAFSF  TE + + A+E 
Sbjct: 248 ILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAET 307

Query: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383
            +PRK++P AAK+V +R  L Y+ S+++VGLLVPY    LLGSS     ASP+VLA+  H
Sbjct: 308 EDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNH 367

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           G++ +P  IN VIL +V SV +S+ +S SR L  L+ QG+ P VF ++DR GRP +  + 
Sbjct: 368 GIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIF 427

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
            +   ++ F A S +  E+F+W+L++SGLS +F W  I L HIRFR+A+  Q RSIDE+ 
Sbjct: 428 SSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELA 487

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           + S +G+WGS Y+  ++I+++I Q W+ + P G        FF+ YL+MP+ + +YLG+K
Sbjct: 488 FASPIGIWGSYYSVFLIIVVLILQFWIALFP-GHQKPSASNFFKAYLSMPIAVAMYLGHK 546

Query: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           I+ ++W+L I  K +D+ + R   D E+ +QE  E    +   P   RVY+FWC
Sbjct: 547 IYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQNAIMAKKPFIYRVYNFWC 600

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  436 bits (1121), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 230/594 (38%), Positives = 356/594 (59%), Gaps = 29/594 (4%)

Query: 31  DIDSAERN-----YELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAK 85
           DI+++  N     YE  + S++ S   NF+D F+  +       D++P LS     + A 
Sbjct: 25  DIETSSENEGYDKYERESKSSSKSWIHNFVDGFREYKLD-----DVDPNLSST---ERAA 76

Query: 86  VEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMA 145
           +  ++        LK+ ++ RH+ M++                    GPA +++ + +  
Sbjct: 77  IATAR------SPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTG 130

Query: 146 SCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTAS 205
           S +Y ++QA+GE+ V  L + G + +Y    +DP+  F+IA+ Y +      PLE+V AS
Sbjct: 131 SMVYSVVQAIGELCVA-LPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAAS 189

Query: 206 MTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIV 264
           +T+ YW      AD FV +FY+ VL IN F G +GY E EF+ +  K+L ++GF ILGIV
Sbjct: 190 ITVDYWNVDHKYADGFVALFYVTVLLIN-FLGVKGYGEAEFVFSIIKVLAIVGFIILGIV 248

Query: 265 IICGGAGND-GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323
           ++CGG  N+ G+IG KYW +PG F      + FKG  +  VT+AFSF  +E  A+ A+E 
Sbjct: 249 LVCGGGSNNTGYIGTKYWHNPGGF-----AHGFKGFAAIFVTSAFSFSGSEMFALGAAES 303

Query: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383
            NPR+ +P AAK+V +R  L YL S+ ++G LVPY +  L  SSS    ASP+V+A+   
Sbjct: 304 KNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEA 363

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           G+  +P  IN VIL++V SV ++  ++SSR  L+LA  GY PK F +VDR GRP  G ++
Sbjct: 364 GISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLIL 423

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
             V  +++F + S  +  VF W+LA+SGL   FTW  IC+ H+RFR+ ++ QGRS DE+ 
Sbjct: 424 SMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELA 483

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           +K+Q G+WGS Y   ++ +++  Q WV + P+ + S     FF+ YL++PV IV Y+G+K
Sbjct: 484 FKAQTGIWGSIYGITLISVVLCFQFWVALFPLSK-SPSAYHFFEQYLSLPVVIVFYMGHK 542

Query: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           ++ R+WRL I AK++DL + R   D E+L+QE +E  E +R+ P+W R+Y FWC
Sbjct: 543 VYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSRPIWYRIYRFWC 596

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  432 bits (1112), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 218/524 (41%), Positives = 333/524 (63%), Gaps = 5/524 (0%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           N  L K +  RH+V ++                 +  GPA LV+G+ I+++C++ +I ++
Sbjct: 40  NTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSL 99

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GE+A  +  +VGGFN Y    VDP++ F++   Y  QW  + PLELV AS+TI+YW  K+
Sbjct: 100 GELAAAF-PIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKI 158

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           N+D +V IFY+ ++  N+    + + ETEF+ +  KIL +IGF ILGIV+  GG  + G+
Sbjct: 159 NSDAWVAIFYVTIVLANMLE-VKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 276 IGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 335
           +G KYW +PGAF G    ++FKG+ S  VTAAFSF   E +A++A+E  NPRK IP AAK
Sbjct: 218 LGFKYWNNPGAFVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAK 277

Query: 336 KVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINA 394
           +  +     Y+  + +VG LVPY+ S LL  ++S    ASP V+A+   G++ +P  +NA
Sbjct: 278 RTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNA 337

Query: 395 VILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCA 454
           +ILI++ SVA+SA Y+ SR ++++A  G  PKV + VD+ GRP    +V  +  +++F A
Sbjct: 338 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIA 397

Query: 455 CSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSA 514
            S K+ EVF WL A+SGLS +F W  I  S IRFRRAM+VQ RS+DE+ Y SQ G+WG+ 
Sbjct: 398 ASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAW 457

Query: 515 YAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW-KRDWRLFI 573
           Y  +++ L+++   W  + P+G   AD ++FF+ +L++P+ +V Y G+K++  R+WRL I
Sbjct: 458 YGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQI 517

Query: 574 RAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            A+++D+ S R I D E L+QEREE +EK  N     + +  WC
Sbjct: 518 GAEEMDIDSGRKIIDEEGLKQEREE-EEKAMNSSFLIKFWHVWC 560

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  433 bits (1113), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 235/592 (39%), Positives = 348/592 (58%), Gaps = 16/592 (2%)

Query: 33  DSAERNYELPTSSTTHSRFRNFIDS-----FKPPETTHHIETDMNPILSHQ-SVFDDAKV 86
           DS  R  E P   TT +   +F+       FK  ETT   +   N   S+     DD K 
Sbjct: 21  DSGNRMTETPVGGTTSNPESSFLSEKNRYDFKE-ETTSFSDDRFNSQHSYNPGSPDDIKE 79

Query: 87  EISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMAS 146
           +I          + + +  RH++ ++                    GPA LVIG+ I+++
Sbjct: 80  DIH------TSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVST 133

Query: 147 CIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASM 206
            ++ +I ++GE+A  Y  +VGGFN Y    VDP+  FS+   Y +QW  + PLELV AS+
Sbjct: 134 ALFTVINSLGELAAAY-PVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASL 192

Query: 207 TIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVII 266
           TI+YW   +N+D +V IFY L+L  N+    + + ETEFI +  KIL +IGFFILGIV+ 
Sbjct: 193 TIRYWDDTINSDAWVAIFYTLILIANLLD-VKSFGETEFILSLVKILAIIGFFILGIVLT 251

Query: 267 CGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNP 326
           CGG    G+IGGKYW DPGAF G     +FKG+ S  VTAAFS+   E +A++A+E  NP
Sbjct: 252 CGGGPKGGYIGGKYWHDPGAFVGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNP 311

Query: 327 RKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGV 385
           RK IP+AAK+  +     Y+  + +VG LV Y+ + LL GSSS    ASP V+A+   G+
Sbjct: 312 RKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGI 371

Query: 386 RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGA 445
           + +P  +NA+ILI++ SVA+SA Y+ SR ++++A  G  PK  + VD+ GRP        
Sbjct: 372 KGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTL 431

Query: 446 VIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYK 505
              +++F A S K+ EVF WL A+SGLS +F W  I ++HIRFR+AM VQ RS+DE+ Y 
Sbjct: 432 FFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYL 491

Query: 506 SQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW 565
           SQ G++GS Y   ++ L++I   W  + P+G   AD +AFF+ YL+ P+ I  Y+G+K++
Sbjct: 492 SQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLY 551

Query: 566 KRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            ++WR+    ++IDL++ R   D +IL++E +  +E LR     +R    WC
Sbjct: 552 FKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQSSFMKRFLLIWC 603

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  430 bits (1105), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 224/585 (38%), Positives = 338/585 (57%), Gaps = 17/585 (2%)

Query: 48  HSRFRNFIDSFKPPET-THHIETDMNPILSHQSVFDDAKV-------------EISQVDD 93
            S ++  +DSFKP ET       DM+P+ S    F  A                 S   D
Sbjct: 5   QSSWQRMLDSFKPAETYKQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSD 64

Query: 94  ELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQ 153
             + +  K +  RH++ ++                    GP  LVI + I+++C++ I+ 
Sbjct: 65  AEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVN 124

Query: 154 AVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT 213
           A+GE++  +  +VGGFN Y    V+P+  F++   Y  QW  + PLELV AS+TI+YW +
Sbjct: 125 ALGELSSTF-PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNS 183

Query: 214 KVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND 273
            +N+D +V IFY ++   N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG    
Sbjct: 184 TINSDAWVAIFYTIIFLANLLD-VKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEG 242

Query: 274 GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSA 333
           G+IGGKYW +PGAF G+    RF G+ S  VTAAFS+  TE +A++A+E  NPR  +P A
Sbjct: 243 GYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKA 302

Query: 334 AKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFI 392
            K+  +   + Y+  + +VG LVP D   LL GSSS    ASP V+A+   G++ +P  +
Sbjct: 303 CKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLM 362

Query: 393 NAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAF 452
           NA+ILI+V SVA+SA Y+ SR + ++AR G  PK F++VDR GRP    L   +  +++F
Sbjct: 363 NAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSF 422

Query: 453 CACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWG 512
            A S+K+  VF WL A+SGLS +F W  I +SHIRFR  MK +GRS+DE+ + S  GVWG
Sbjct: 423 IAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWG 482

Query: 513 SAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLF 572
           S Y  V++ ++++   W  + P  EG A  ++FF+ YL+ P+ +V Y+G+K++ + WRL 
Sbjct: 483 SYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLL 542

Query: 573 IRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
               +ID+ S R   D E+L+ E+   ++ +R      R    WC
Sbjct: 543 TPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  429 bits (1104), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 218/557 (39%), Positives = 338/557 (60%), Gaps = 4/557 (0%)

Query: 62  ETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXX 121
           E T  +E  + P+   +   D   VE   + +  + KL K +  RH++ ++         
Sbjct: 28  EETWSVEKQLKPLAEEKDYADMNDVE-KAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGL 86

Query: 122 XXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPAL 181
                   +  GPA LVI + I+++C++ I+ ++GE++  +  +VGGFN Y    V+P+ 
Sbjct: 87  FVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATF-PVVGGFNVYVTRFVEPSF 145

Query: 182 NFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYA 241
            F++ + Y  QW  + PLEL  AS+TI+YW   +N D +V IFY+ +   N+    + + 
Sbjct: 146 GFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLD-VKSFG 204

Query: 242 ETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVS 301
           ETEF+ +  KIL +IGF ILGIV+ICGG  + GFIGGKYW DPGAF G     RFKG+ +
Sbjct: 205 ETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSA 264

Query: 302 TLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSS 361
             +TAAFS+   E + ++A+E  NPR  +P AAK+  +   + YL  + ++G LVP +  
Sbjct: 265 VFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDP 324

Query: 362 ELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420
            LL G+SS    ASP V+A+   G++ +P  +NA+ILI++ SVA+SA Y+ SR ++++A 
Sbjct: 325 LLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAE 384

Query: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480
            G  P+    VD+ GRP     +  ++ +++F A S+K  EVF WL A+SGLS +F W  
Sbjct: 385 IGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFA 444

Query: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA 540
           I L+H+RFR AMK Q RS++E+ Y S  G WGS Y  +++ L++I   W  + P G   A
Sbjct: 445 INLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGA 504

Query: 541 DVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQ 600
           D  +FF+ YL++P+FI  YLG+KIWKR+ RL+I+  ++D+ S R   D   L+QE+E   
Sbjct: 505 DATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEA 564

Query: 601 EKLRNGPVWRRVYDFWC 617
           E ++  P + R+++FWC
Sbjct: 565 ELMKTKPFYIRLWNFWC 581

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  429 bits (1102), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 231/605 (38%), Positives = 345/605 (57%), Gaps = 30/605 (4%)

Query: 41  LPTSSTTHSRFRNFIDSFKPPETTH-HIETDMNPILSHQSVFDDAKVEIS---------- 89
           +P +      + + +D FKP   T    E D +  ++ Q+   D+   +S          
Sbjct: 1   MPKNPLKKEYWADVVDGFKPSAPTGPENEKDSSAFVTEQTPKTDSGFPLSAKGSSGVNQT 60

Query: 90  ----------------QVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAG 133
                           Q +D  N  L K +  RH++ ++                 +  G
Sbjct: 61  TNDITSSGRFHSDDDVQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGG 120

Query: 134 PAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQW 193
           PA LVI + I+++C++ +I ++GE++  +  +VGGFN Y    V+P+  F++   Y  QW
Sbjct: 121 PASLVIDWVIISTCLFTVINSLGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQW 179

Query: 194 FCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKIL 253
             + PLELV AS+TI+YW  K+N+D +V IFY  +   N+    + + ETEF+ +  KIL
Sbjct: 180 LVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLD-VKSFGETEFVLSMIKIL 238

Query: 254 MMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQT 313
            +IGF ILGIV+ CGG  + G+IGGKYW DPGAF G D   +FKG+ S  VTAAFS+   
Sbjct: 239 AIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHDSGTKFKGLCSVFVTAAFSYSGI 298

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATK 372
           E  A++A+E  NPR+ IP AAK+  +   + Y+  + ++G LVP +   LL GSSS    
Sbjct: 299 EMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAA 358

Query: 373 ASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVD 432
           +SP V+A+    ++ +P  +NA+ILI+V SVA+SA Y+ SR ++ +A  G  PK    VD
Sbjct: 359 SSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVD 418

Query: 433 RTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAM 492
           + GRP    ++     +++F A S K+ EVF WL A+SGLS +F W  I LSHIRFR+AM
Sbjct: 419 KRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAM 478

Query: 493 KVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAM 552
           K Q RS+DE+ + SQ GVWGS Y FV++ L++I   W  + P+G   A+ ++FF+ YL+ 
Sbjct: 479 KFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSF 538

Query: 553 PVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRV 612
           P+ IV Y G+KI+ RDWRL ++ +D+DL + R   D  + RQE +  QE L       R 
Sbjct: 539 PILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRF 598

Query: 613 YDFWC 617
              WC
Sbjct: 599 LRVWC 603

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  426 bits (1096), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/522 (41%), Positives = 337/522 (64%), Gaps = 8/522 (1%)

Query: 97  EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVG 156
            +LK++I+P HV MMS                 A AG  G ++GY I+   + C +Q VG
Sbjct: 35  NELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGIMLTCCMQTVG 94

Query: 157 EMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN 216
           E+ V + ++ GGF +Y    +DP++ F+I+W++ + W  V PLE+  ASMTI +W   +N
Sbjct: 95  ELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASMTINFWNENIN 154

Query: 217 ADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFI 276
             I V + Y LV  +N FG AR YA+ + I N  K+LM++GF ILGI +  G  G  G++
Sbjct: 155 PSIVVALCYSLVCGVNFFG-ARCYADADCIFNCLKVLMILGFIILGIFVNTGVVGTSGYL 213

Query: 277 GGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN---PRKAIPSA 333
           G KY+  PG FR  +G   FK + +TL+TA FS G TEF+A++ +EQ+    PR +I  A
Sbjct: 214 GFKYFHSPGFFRNDEG--LFKSIAATLITACFSTGGTEFVALSCAEQNTEDMPR-SIKRA 270

Query: 334 AKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFIN 393
           + +V+ R  +I+  S++I+GLLVP++S  L+GS S  T ASPYV+A++T+GVR++PH +N
Sbjct: 271 SIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGVRIIPHIVN 330

Query: 394 AVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFC 453
           A+IL+S+ SVA++A YSSSR L +LA QG+A K F  +D +G+P     V A   + +F 
Sbjct: 331 AIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSAFTGLFSFI 390

Query: 454 ACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGS 513
           A    +  VF WLL+ISGLS +FTW++ C+SH+RFR+AMK Q +++D++GY+S  GV+GS
Sbjct: 391 AEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQSPCGVYGS 450

Query: 514 AYAFVMMILIMIGQCWVGIVPV-GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLF 572
             +  +  +I+I Q WV + P+   G  +V +F Q+Y+A+P+ IVLYLG+K +  +W+ F
Sbjct: 451 YISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKAYTGNWKPF 510

Query: 573 IRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYD 614
           IRA +ID+ + R I+  + +  ++  + E L +G +  ++ D
Sbjct: 511 IRAPEIDIQTDRDIYCVDEVTGKKSVFVELLDSGDMCSKLSD 552

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  424 bits (1089), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 234/615 (38%), Positives = 365/615 (59%), Gaps = 19/615 (3%)

Query: 5   PGSSKESYEKNDITKSSAKFNDVDVIDIDS-AERNYELPTSSTTHSRFRNFIDSFKPPET 63
           P  S  +    DI  ++   +D+      + +  N +  +  +   ++  F+DSFK  E 
Sbjct: 6   PEKSNGNVNVKDIESTTFGMDDIVHEPCSTLSSNNNDNESRGSIRCKWTRFVDSFKRIEL 65

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
                 +++P L+     D  K+ I+         LK T++ RH+ M++           
Sbjct: 66  E-----ELDPNLT-----DAEKIAIATA----RSPLKHTLKSRHLHMIAVGGAIGTGLFV 111

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                   AGPAG++IG+ +  + IY ++ AVGE+AV +  + GGF  Y    +D +  F
Sbjct: 112 GSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGELAVVF-PVSGGFTTYATRFIDESFGF 170

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGARGYAE 242
           +I + Y +QW    PLE+V+AS+T+ YW       D FV +F++  + IN+FG  +GY E
Sbjct: 171 AINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFG-VKGYGE 229

Query: 243 TEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVST 302
            EF+    K++ +IGF I+ +++ICGG    G+IG KYW  PGAF G     +FKG  + 
Sbjct: 230 AEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAFVGDTAGQKFKGFCTV 289

Query: 303 LVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSE 362
            +TA+FSFG +E + +  SE  NPRK++P AAK+V +R  L Y+  ++++G+LVPY+   
Sbjct: 290 FITASFSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKR 349

Query: 363 LLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQG 422
           L+G+SS    ASP+V+AV   G+R +P  IN VILISV SV +S+ Y  SR L  LA QG
Sbjct: 350 LIGASSVDAAASPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQG 409

Query: 423 YAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALIC 482
           + PK+  ++DR GRP +   + +   ++AF A SS E EVFNWLLA+SGLS +F+W+ IC
Sbjct: 410 FLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAIC 469

Query: 483 LSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADV 542
           + HIRFRRA+  QGRS DE+ + S VG+ GS +   + +L++I Q +VG+ P G  S + 
Sbjct: 470 ICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAG-ASPNA 528

Query: 543 QAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEK 602
           + FF  YL+ P+ +  Y+ +KIWK++W+L+I+A+D+D+ + R   D ++L+QE    +  
Sbjct: 529 KDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAERAD 588

Query: 603 LRNGPVWRRVYDFWC 617
           L   P+W R + FWC
Sbjct: 589 LAARPIWYRCWKFWC 603

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  423 bits (1088), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 226/552 (40%), Positives = 332/552 (60%), Gaps = 6/552 (1%)

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
           ++   N I S +   D+  VE  QVD   N  L K +  RH++ ++              
Sbjct: 57  MKQTTNDITSSERSRDNDDVE--QVDIN-NTNLNKDLSVRHLLTLAVGGAIGTGLYVNTG 113

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
              +  GPA LVI + I+ +C++ +I ++GE++  +  +VGGFN Y    V+P+  F++ 
Sbjct: 114 TALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAF-PVVGGFNVYGMRFVEPSFAFAVN 172

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
             Y  QW  + PLELV AS+TI+YW  K+N+D +V IFY  +   N+    + + ETEF+
Sbjct: 173 LNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLD-VKSFGETEFV 231

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTA 306
            +  KIL +IGF ILGIV+ CGG  + G+IGGKYWR+PGAF G +   +FKG+ S  VTA
Sbjct: 232 LSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGTKFKGLCSVFVTA 291

Query: 307 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-G 365
           AFS+   E  A++A+E  NPR+ IP AAK+  +     Y+  + ++G LVP +   LL G
Sbjct: 292 AFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNG 351

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
           SSS    +SP V+A+    ++ +P  +NA+ILI+V SVA+SA Y+ SR ++ +A  G  P
Sbjct: 352 SSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLP 411

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           K    VD+ GRP    L+     +++F A S+KE EVF WL A+SGLS +F W  I LSH
Sbjct: 412 KFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSH 471

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAF 545
           IRFR+AMKVQ RS+DE+ + SQ GV GS Y FV++ L++I   W  + P+G   A  ++F
Sbjct: 472 IRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESF 531

Query: 546 FQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRN 605
           F+ YL+ P+ IV Y G+KI+ R+W L ++ +DIDL + R   D  + R+E +  +E L  
Sbjct: 532 FEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAK 591

Query: 606 GPVWRRVYDFWC 617
                R   FWC
Sbjct: 592 KSFITRFLHFWC 603

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/590 (37%), Positives = 352/590 (59%), Gaps = 12/590 (2%)

Query: 36  ERNYELPTSSTTHSRFRNFIDSFKPPETTHHIET------DMNPILSHQSVFDDAKVEI- 88
           +   E    ++    +     SFK  E    +E+      D+  +       DD +  I 
Sbjct: 3   DTKLESEVETSISKSWTKLFSSFKRMEEVEVVESLTKSNYDVQVMGKKYEDMDDVEKAIF 62

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
           +     LN  L + +  RH++ ++                    GPA LVI + I+++C+
Sbjct: 63  NTTKRSLN--LNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCL 120

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           + I+ A+GE+A  +  +VGGFN Y   LVDP+L F++   Y  QW  + PLELV AS+TI
Sbjct: 121 FTIVNALGELAAVF-PVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITI 179

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           +YW   VN+D +V +FY+ +   ++    + + ETEFI +  KIL + GF ILGIV+ICG
Sbjct: 180 RYWNNSVNSDAWVAVFYVCIFLASLLD-VKSFGETEFILSMVKILAIGGFTILGIVLICG 238

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           G   +G+IG KYW DPG+F G+   ++FKG+ S  VTAAFS+  TE + ++A+E +NPR 
Sbjct: 239 GGPKNGYIGAKYWNDPGSFVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRY 298

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRV 387
            +P A+K+  +   L YL  + I+G LV +D  +LL  SSS    ASP V+A+   G++ 
Sbjct: 299 TLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQG 358

Query: 388 VPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVI 447
           +P  +NA+ILI++ SVA+S+ Y+ SR ++++A  G  P++FT++D  GRP +  +   V 
Sbjct: 359 LPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVF 418

Query: 448 AVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQ 507
            +++F A S+K+ E+F WL A+SGLS +F W  I +SHIRFRRA+  QG S+DE+ Y S 
Sbjct: 419 GLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSM 478

Query: 508 VGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKR 567
            GV GS Y  V++IL++I   W  + P G   AD ++FF+ YL++P+F+  ++G+K++KR
Sbjct: 479 TGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKR 538

Query: 568 DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +W   IR+  ID+ + R + D E L +E++E+ E +       ++++ WC
Sbjct: 539 NWSWMIRSNKIDVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKLWNLWC 588

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  420 bits (1080), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/529 (41%), Positives = 323/529 (61%), Gaps = 3/529 (0%)

Query: 90  QVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIY 149
           + +D  N  L K +  RH++ ++                 +  GPA LVI + I+++C++
Sbjct: 77  EQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLF 136

Query: 150 CIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQ 209
            +I ++GE++  +  +VGGFN Y    V+P+  F++   Y  QW  + PLELV AS+TI+
Sbjct: 137 TVINSLGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 210 YWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGG 269
           YW  K+N+D +V IFY  +   N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG
Sbjct: 196 YWNDKINSDAWVAIFYATIALANMLD-VKSFGETEFVLSMIKILSIIGFTILGIVLSCGG 254

Query: 270 AGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKA 329
             + G+IGGKYW DPGAF G     +FKG+ S  VTAAFS+   E  A++A+E  NPR+ 
Sbjct: 255 GPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 330 IPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVV 388
           IP AAK+  +     Y+A + ++G LVP +   LL GSSS    +SP V+A+   G++ +
Sbjct: 315 IPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGL 374

Query: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448
           P  +NA+ILI+V SVA+SA Y+ SR ++ +A  G  PK    VD+ GRP    L+     
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508
           +++F A S K+ EVF WL A+SGLS +F W  I LSHIRFR+AMKVQ RS+DE+ + SQ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568
           GV GS Y F+++ L++I   W  + P+G   A+ ++FF+ YL+ P+ IV Y G+KI+ R+
Sbjct: 495 GVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRN 554

Query: 569 WRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           W L ++ +DIDL + R   D  + R+E +  +E L       R   FWC
Sbjct: 555 WTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFWC 603

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  419 bits (1078), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 220/589 (37%), Positives = 343/589 (58%), Gaps = 21/589 (3%)

Query: 47  THSRFRNFIDSFKPPETT---------------HHIETDMNPILS--HQSVFDDAKVEIS 89
           + S ++  IDSFKP ET                   ++    ++S       ++      
Sbjct: 4   SRSTWQRMIDSFKPAETQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQ 63

Query: 90  QVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIY 149
           +V+D+ + +  K +  RH++ ++                    GP  LVI + I+++C++
Sbjct: 64  EVEDQ-DARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLF 122

Query: 150 CIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQ 209
            I+ A+GE++  +  +VGGFN Y    V+P+  F++   Y  QW  + PLELV AS+TI+
Sbjct: 123 TIVNALGELSSTF-PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIR 181

Query: 210 YWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGG 269
           YW   +N+D +V IFY ++L  N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG
Sbjct: 182 YWNHTINSDAWVAIFYTIILLANLLD-VKSFGETEFVLSMVKILAIIGFTILGIVLTCGG 240

Query: 270 AGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKA 329
               G+IGGKYW +PGAF G    +RF G+ S  VTAAFS+  TE +A++A+E  NPR  
Sbjct: 241 GPKGGYIGGKYWSNPGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRIT 300

Query: 330 IPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVV 388
           +P A K+  +   + Y+  + +VG LV  D   LL GSSS    ASP V+A+   G++ +
Sbjct: 301 LPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGL 360

Query: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448
           P  +NA+ILI+V SVA+SA Y+ SR + ++A+ G  PKVFT+VDR GRP    +   +  
Sbjct: 361 PSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFG 420

Query: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508
           +++F A S K+ EVF WL A+SGLS +F W  I +SHIRFRR MK +GR++DE+ + S  
Sbjct: 421 LLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMT 480

Query: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568
           GVWGS Y  +++ ++++   W  + P G   A+ ++FF+ YL+ P+ +  Y G+K++ R 
Sbjct: 481 GVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRS 540

Query: 569 WRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           WRL    K+IDL S R   D E+++ E+   ++ +R   ++ R    WC
Sbjct: 541 WRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  420 bits (1079), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 219/530 (41%), Positives = 326/530 (61%), Gaps = 3/530 (0%)

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
           S V+D  N  L K +  RH++ ++                    GPA LVIG+ I+++C+
Sbjct: 78  SYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCL 137

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           + +I ++GE+A  +  +VGGFN Y    ++P+  F+I   Y  QW  + PLELV AS+TI
Sbjct: 138 FTVINSLGELAAAF-PVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITI 196

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           +YW  K+N+D +V IFY  +   N+    + + ETEFI +  KIL +IGF ILGIV+ CG
Sbjct: 197 RYWNDKINSDAWVAIFYTAIALANMLD-VKSFGETEFILSMVKILAIIGFGILGIVLTCG 255

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           G  + G+IGGKYW +PGAF G    ++FKG+ S  VTAAFS+   E  A++A+E  NP++
Sbjct: 256 GGPHGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKE 315

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRV 387
            IP AAK+  +   + Y+  + ++G LVPY+   LL GSSS    ASP V+A+   G++ 
Sbjct: 316 TIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKG 375

Query: 388 VPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVI 447
           +P  +NA+ILI++ SVA+SA Y+ SR ++++A  G  PK  + VD+ GRP    L+    
Sbjct: 376 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFF 435

Query: 448 AVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQ 507
            +++F A S K+ EVF WL A+SGLS +F W  I LS IRFR AMK QGRS+DE+ + SQ
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQ 495

Query: 508 VGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKR 567
            G WG+ Y  +++ L+++   W  + PVG  +A  ++FF+ YL++P+ I  Y+G+K+WKR
Sbjct: 496 SGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKR 555

Query: 568 DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           DWRL +   ++DL S R + D E   +E    +E L N   + R    WC
Sbjct: 556 DWRLLVPLMEMDLDSGRRVLDAETREEELRVEREYLANASFFTRFLHIWC 605

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  418 bits (1075), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/605 (38%), Positives = 351/605 (58%), Gaps = 35/605 (5%)

Query: 23  KFNDVDVIDIDSAERNYELPTSSTTHSRFR-NFIDS--FKPPETTHHIETDMNPILSHQS 79
           +F D +   +D  + +  + T+   H  +  NF  +  ++PP                Q 
Sbjct: 20  EFIDFEKKPVDIKKTSSVVATTKHAHDEYEDNFPGNGFYQPPRNIF------------QR 67

Query: 80  VFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
             D  K  +    D  N  LK++++ RH++M++                 A  GP  +VI
Sbjct: 68  CIDSFKPPLDGSFDTNN--LKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVI 125

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPL 199
           G+AI  S I   I  +GE+ V +  +VG F  Y    +DP+L+F I+ IY IQWF V PL
Sbjct: 126 GWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPL 184

Query: 200 ELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
           E+++++MT+QYW   ++  ++V IFY  +++IN+FG ARG+ E EF+ +S K+L + GF 
Sbjct: 185 EIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFG-ARGFGEAEFVFSSVKVLTICGFI 243

Query: 260 ILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319
           IL IV+ICGG  +  F+G KYW DPG        + F GV+S LV A++S G TE + + 
Sbjct: 244 ILCIVLICGGGPDHDFVGAKYWHDPGCL-----AHGFPGVLSVLVVASYSLGGTEMVCL- 297

Query: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLA 379
           AS +++P K +PSA K+  +R L  +L S+ ++G LVPY +  LLG SS     SP+V+A
Sbjct: 298 ASGETDP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS--VNNSPFVIA 354

Query: 380 VSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSL 439
           +  H ++V+P  +NAVILIS+ SV +S  ++SSR L ++A QG  P+ F ++DR GRP  
Sbjct: 355 IKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLT 414

Query: 440 GFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSI 499
           G +  ++  ++AF   SS  +EVF+WL+AI+GL+    W  I +SHIRFR AMK QGRS+
Sbjct: 415 GIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSL 474

Query: 500 DEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSADVQAFFQDYLAMPVFI 556
           DE+ + S VG+WGSAY+ V+  LI++ Q +  + P+G     S   + FFQ YL   + I
Sbjct: 475 DELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMI 534

Query: 557 VLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRV 612
           VL++G+KI+ R     W   +    IDL + R   D EIL+QE  E    LR  P + R 
Sbjct: 535 VLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVRW 594

Query: 613 YDFWC 617
           Y FWC
Sbjct: 595 YHFWC 599

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  418 bits (1075), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 223/591 (37%), Positives = 344/591 (58%), Gaps = 23/591 (3%)

Query: 34  SAERNYELPTSSTTHSR--FRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQV 91
           S +   + P S     R  +  F+D+F+  E        ++P LS        K+ I   
Sbjct: 30  STDLAVDEPISVQPEPRKGWNGFVDTFRRAEMPV-----IDPNLSEAE-----KLAIRTA 79

Query: 92  DDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCI 151
              L+ +LK     RH+ M++                 A AGPAG++IG+ + A+ I  +
Sbjct: 80  AAPLSRRLKN----RHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIM 135

Query: 152 IQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYW 211
             ++GE+AV +  + GG+  Y    +D +  F+  + Y +Q   V PLE+V AS+T+ YW
Sbjct: 136 CLSLGELAVTF-PVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYW 194

Query: 212 TTKVNADI-FVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270
            T     + FV +F++++++IN+FG  RG+ E E I +  K++ +IGF I+G+V+I GG 
Sbjct: 195 DTDPKYKLAFVALFWVVIVSINLFG-VRGFGEAESIFSLIKVITIIGFIIMGVVLISGGG 253

Query: 271 GNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
            +   IGGKYW DPG F G+   ++FKGV S  VTAAFSF  +E + + A+E   PRK+I
Sbjct: 254 PDHEVIGGKYWNDPGPFVGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSI 313

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P AAK+V +R  L Y+ S++IVGLLVP ++  LL         SP+V+A+  H +RV+P 
Sbjct: 314 PKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPS 373

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
            IN VIL +V SV +S+ YSSSR +  LA  G+ PK+F ++DR GRP       ++  ++
Sbjct: 374 IINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLL 433

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
            F A + +E E+F+WLLAISGLS  FTW  I L+H+RFR A+K QGR+ +E+ + S  G 
Sbjct: 434 CFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGF 493

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQA----FFQDYLAMPVFIVLYLGYKIWK 566
            GS YA  ++ ++++ Q WV + P        +     FF+ YL+  V IV+YL +KIW 
Sbjct: 494 IGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWS 553

Query: 567 RDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           R+W+ FI+AK++D+ + R   D E+ ++E  + +  L   P   RV++FWC
Sbjct: 554 RNWKFFIKAKEMDIDTGRRELDLELFKEELAQERALLAQKPFIIRVFNFWC 604

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/539 (40%), Positives = 323/539 (59%), Gaps = 4/539 (0%)

Query: 80  VFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
           V +DA   +S      N  L K +  RH++ ++                 A  GPA LVI
Sbjct: 52  VVNDATSTVSNASVT-NVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVI 110

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPL 199
            + I+++C++ +I A+GEMA  +  +VGGFN Y    VDP++ F++   Y  QW  + PL
Sbjct: 111 DWVIISTCLFTVINALGEMAAAF-PVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPL 169

Query: 200 ELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
           ELV ASMTI+YW   +N+D +V IFY ++   N+    + + ETEF+ +  KIL +IGF 
Sbjct: 170 ELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLE-VKSFGETEFVLSMVKILAIIGFT 228

Query: 260 ILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319
           ILGIV+ CGG    G++GGKYW +PG+F G     +FKG+ S  VTAAFS+   E  A++
Sbjct: 229 ILGIVLSCGGGPQGGYLGGKYWHNPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVS 288

Query: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVL 378
           A+E  +PR+ IP AAK+  +     Y+  + ++G LVPYD   LL GSSS    +SP V+
Sbjct: 289 AAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVI 348

Query: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438
           A+   G++ +P  +NA+ILIS+ SVA+SA Y+ SR ++ +A  G  P+V   +D+ GRP 
Sbjct: 349 AIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPV 408

Query: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498
              L      +++F A S K+ EVF WL A+SGLS +F W  I +SHIRFR+AMK Q +S
Sbjct: 409 NAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKS 468

Query: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVL 558
           +DE+ Y SQ GVWGS Y  +++ L++I   W  + P+G   AD ++FFQ YL+ P+ I  
Sbjct: 469 LDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIAC 528

Query: 559 YLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           Y+G+K+  R  ++ +  +D+D+ + R   D  I RQE +E QE L     + R    WC
Sbjct: 529 YVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 245/577 (42%), Positives = 353/577 (61%), Gaps = 18/577 (3%)

Query: 42  PTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKK 101
           P S+   SR+RNF+DSFK  E       +++P L+     D  K+ I      L  KLK 
Sbjct: 45  PESTIDKSRWRNFLDSFKRIEVE-----EVDPNLT-----DIEKIAIKTARSPLQHKLKS 94

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
               RH+ M++                   AGPAG++IG+ I  + I+ ++ A+GE+AV 
Sbjct: 95  ----RHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGELAVV 150

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIF 220
           +  + GGF  Y    +D +  F+  + Y  QW    PLE+V AS+T+ YW T V   D F
Sbjct: 151 F-PVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTDGF 209

Query: 221 VLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKY 280
           V +F+++V+ IN+FG  RGY E EF+ +  K++ +IGF ILGI+++CGG    G++GG+Y
Sbjct: 210 VALFWLVVVIINMFG-VRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGGRY 268

Query: 281 WRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 340
           W DPGAF G     RFKG  S  VTAAFSF  +E + I ++E  NPRK++P AAK+V +R
Sbjct: 269 WHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQAAKQVFWR 328

Query: 341 ALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISV 400
            LL Y+  +++VGLLVPY    LLGSS     ASP+V+A+ THG+  +P  +N VILISV
Sbjct: 329 ILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSVVNVVILISV 388

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
            SV +S+ Y+ SR L+ L+ QG+ PK   ++DR GRP +G  + +   ++AF A S+K+ 
Sbjct: 389 LSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFVAASNKKE 448

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
           ++FNWLLAISG+S   TW  IC  HIRFR A+KV GRS DE+ +KS VG+ GS +   + 
Sbjct: 449 QMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGSYWGMCLA 508

Query: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
           +L+++ Q +  + P+G  S +   FF  YLA P+ +  Y+ +K+WKR+W+L I  KDID+
Sbjct: 509 VLMLVAQFYNALFPIGS-SPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLLIPLKDIDI 567

Query: 581 ISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            + R   D  +L+QE  E +  L   P W RVY FWC
Sbjct: 568 DTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  417 bits (1071), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/583 (38%), Positives = 344/583 (59%), Gaps = 18/583 (3%)

Query: 46  TTHSRFRNFIDSFKPPE-----TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLK 100
           T+ S  R+F  S  P +     TT+  ++      S +++      + S   +++NE L 
Sbjct: 34  TSFSNIRSFTSSPIPEKSSDNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDINENLN 93

Query: 101 KTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAV 160
           K +  RH++ ++                 A  GPA LVI + I+++C++ +I A+GE+A 
Sbjct: 94  KDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAA 153

Query: 161 NYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIF 220
            Y  +VGGFN Y    VDP++ F+I   Y  QW  + PLELV AS+TI+YW   +N+D +
Sbjct: 154 AY-PVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAW 212

Query: 221 VLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKY 280
           V IFY ++   N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG    GF+GG Y
Sbjct: 213 VAIFYSVIALANMLD-VKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHY 271

Query: 281 WRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 340
           W DPG+F G     +FKG+ S  VTAAFS+   E  A++A+E  +PRK IP A K+  + 
Sbjct: 272 WHDPGSFVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWL 331

Query: 341 ALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILIS 399
               Y+  + I+G LVP+D   LL GSSS    ASP V+++   G++ +   +NA+ILIS
Sbjct: 332 VTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILIS 391

Query: 400 VFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKE 459
           + SVA+SA Y+ SR ++++A  G  PKV + VD+ GRP    L      +++F A S K+
Sbjct: 392 IVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQ 451

Query: 460 TEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVM 519
            EVF WL A+SGLS +F W  I  SHIRFR AMKVQ +++DE+ Y SQ GV GS Y  ++
Sbjct: 452 AEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIV 511

Query: 520 MILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDID 579
           + L+++   W  + P+G G+ADV +FF+ YL++P+ I  Y+G+K++ R+ ++ ++ +D+D
Sbjct: 512 LFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMD 571

Query: 580 LISHR-----HIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           L + R     H H  EIL ++    Q+        +R +  WC
Sbjct: 572 LETGRKHIDAHEHRAEILAEKAALSQKSFI-----KRFWHVWC 609

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  414 bits (1063), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 226/580 (38%), Positives = 347/580 (59%), Gaps = 14/580 (2%)

Query: 33  DSAERNYELPTSSTTHS-RFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQV 91
           +S E N    T   ++S +  N +        T +I    NP  +  ++     ++ S +
Sbjct: 32  NSIEMNSSFITEKRSNSLKEDNVMIQTTSSGATKNINGTSNP--NDSNMLSKEDIDGSNL 89

Query: 92  DDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCI 151
           + +LN         RH++ ++                    GPA LVIG+ I+++ ++ +
Sbjct: 90  NKDLN--------IRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTV 141

Query: 152 IQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYW 211
           I ++GE+A  Y  +VGGF+ Y    +DP++ FSI   Y +QW  + PLELV AS+TI+YW
Sbjct: 142 INSLGELAAAY-PVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW 200

Query: 212 TTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAG 271
             K+N+D +V IFY ++  +N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG  
Sbjct: 201 NDKINSDAWVSIFYTVIGLLNMLD-VKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGP 259

Query: 272 NDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIP 331
             G+IGGKYW DPGAF G    ++FKG+ S  VTAAFS+   E +A++A+E  +PRK IP
Sbjct: 260 VGGYIGGKYWHDPGAFVGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIP 319

Query: 332 SAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPH 390
            AAK+  +     Y+  + ++G LVPYD   LL GSSS    +SP V+A+   G++ +P 
Sbjct: 320 VAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPS 379

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
            +NA+ILI+V SVA+SA Y+ SR ++++A  G  PK    +D+ GRP    LV     ++
Sbjct: 380 LMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLI 439

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           +F A S K+ EVF WL A+SGLS +F W  I +SHIRFRRAM +QGRS++E+ Y SQVGV
Sbjct: 440 SFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGV 499

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
           +GS Y  +++ L++I   W  + PVG   A+   FF+ YL++P+ +  Y+G+K + ++WR
Sbjct: 500 YGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWR 559

Query: 571 LFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWR 610
           LF    +IDL S +   D E+LR+E++  +  L+   + R
Sbjct: 560 LFTPYNEIDLDSGKRDIDLELLREEKKMEELALKKQLILR 599

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  412 bits (1058), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/616 (37%), Positives = 351/616 (56%), Gaps = 55/616 (8%)

Query: 10  ESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPP-ETTHHIE 68
           +SY+ +     + +  D D  DI     +Y+ P      + F+  IDSFKPP + + H  
Sbjct: 31  DSYKSSSFRTFTKQSKDDD--DIAEGHSSYQPP-----RNIFQRCIDSFKPPLDGSFH-- 81

Query: 69  TDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXX 128
                                         LK+T++ RH++M++                
Sbjct: 82  ---------------------------THNLKRTLKARHLIMIAIGGSIGTGLFIGSGQA 114

Query: 129 XAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWI 188
            A  GP  L+IG++I  + I   I  +GE+ V +  +VG F  Y    +DP+++F I+ I
Sbjct: 115 LASGGPLALIIGWSIAGTQIVGTIHGLGEITVRF-PVVGAFANYSTRFLDPSISFVISTI 173

Query: 189 YCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICN 248
           Y IQWF V PLE++ ++MTIQYW   ++  ++V IFY ++++IN+FG ARG+ E EF+ +
Sbjct: 174 YVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFG-ARGFGEAEFLFS 232

Query: 249 SCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAF 308
           S K++ +IGF IL IV+ICGG  +  F+G +YW DPG        + F GV+S LV A++
Sbjct: 233 SIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLS-----HGFPGVLSVLVVASY 287

Query: 309 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSS 368
           S G TE + + AS ++NPR+ +PSA K+  +R L  +L S+ ++G LVPY +  LLG SS
Sbjct: 288 SLGGTEMVCL-ASGETNPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS 345

Query: 369 AATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428
                SP+V+A+  H ++ +P  +NAVILIS+ SV +S  ++SSR L ++A QG  PK F
Sbjct: 346 --VNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFF 403

Query: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488
            ++DR GRP  G L  ++  ++AF   SS   EVF+WL+AI+GL+    W  I +SHIRF
Sbjct: 404 GYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRF 463

Query: 489 RRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSADVQAF 545
           R AMK QG+S+DE+ + S VG+WGSAY+ ++  LI+I Q +  + P+G   + S   + F
Sbjct: 464 RLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTF 523

Query: 546 FQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQE 601
           FQ YL   +   L++ +K++ R     W   +    IDL + R   D ++L+QE  E   
Sbjct: 524 FQSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEIAERNR 583

Query: 602 KLRNGPVWRRVYDFWC 617
            L+  P + R Y FWC
Sbjct: 584 HLQASPWYVRWYHFWC 599

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 225/576 (39%), Positives = 339/576 (58%), Gaps = 14/576 (2%)

Query: 43  TSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKT 102
           +SS  HS   N    F        IE +++ I S  SV            +++N+ L K 
Sbjct: 33  SSSQVHSFTSNTPSPFNEKSKDSPIEDNID-ITSQSSV----------TKEDINKSLNKD 81

Query: 103 IQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNY 162
           +  RH++ ++                 A  GPA LVI + I+++C++ +I ++GE+A  +
Sbjct: 82  LSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAF 141

Query: 163 LTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVL 222
             +VGGFN Y    VDP+  F++   Y  QW  + PLELV AS+TI+YW + +N+D +V 
Sbjct: 142 -PVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVA 200

Query: 223 IFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWR 282
           IFY ++   N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG    G++GGKYW 
Sbjct: 201 IFYTVITLANMLD-VKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWH 259

Query: 283 DPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 342
           +PGAF G     +FKG+ S  VTAAFS+   E  A++A+E  +PRK IP AAK+  +   
Sbjct: 260 NPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLIT 319

Query: 343 LIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVF 401
             Y+  + +VG LVPYD   L+ G+SS    ASP V+A+   G++ +   +NA+ILIS+ 
Sbjct: 320 ASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILISII 379

Query: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461
           SVA+SA Y+ SR ++++A  G  PK    VD+ GRP    LV     +++F A S K+ E
Sbjct: 380 SVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNE 439

Query: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521
           VF WL A+SGLS +F W  I +SHIRFR+AM  Q RS+DE+ Y SQ GVWGS Y  V++ 
Sbjct: 440 VFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLF 499

Query: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLI 581
           L+++   W  + P+G  SADVQ+FF+ YL++P+ IV Y+G+K++ ++W   +  +++DL 
Sbjct: 500 LVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLD 559

Query: 582 SHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           + R   DP + R E    +  +      +R +  WC
Sbjct: 560 TGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHVWC 595

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  408 bits (1049), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 226/571 (39%), Positives = 348/571 (60%), Gaps = 28/571 (4%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSST--------THSRFRNFIDSF 58
           S+  SYEKN+    + K+N + +      +    +P++ +        + S++++F DSF
Sbjct: 2   SNTSSYEKNN--PENLKYNGITIDSEFLTQEPITIPSNGSAASAEEAGSGSKWQDFKDSF 59

Query: 59  KPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXX 118
           K  E          PI    ++ +  KV I      L   LK     RH+ M++      
Sbjct: 60  KRVE----------PIAVDPNLTEAEKVAIVTAQTPLKHHLKN----RHLQMIAIGGAIG 105

Query: 119 XXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVD 178
                         GPA L+IG+    + IY ++ A+GE+AV +  + GGF  Y    +D
Sbjct: 106 TGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIF-PISGGFTTYATRFID 164

Query: 179 PALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN-ADIFVLIFYILVLAINIFGGA 237
            +  ++  + Y +QW  V PLE+V+AS+T+ +W T     D FV +F+++++ IN+FG  
Sbjct: 165 ESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIINMFG-V 223

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFK 297
           +GY E EF+ +  K++ ++GF ILGI++ CGG    G+IGGKYW DPGAF G     +FK
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAGDTPGAKFK 283

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           GV S  VT+AFSF  +E + + ASE   PRK++P AAK+V +R  L Y+ S++++GLLVP
Sbjct: 284 GVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVP 343

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           Y+   L+G+SS    ASP+V+A+ THG++ +P  +N VILI+V SV +SA Y+ SR ++ 
Sbjct: 344 YNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVA 403

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA Q + P++F +VDR GRP +G  V +   ++AF A S KE +VFNWLLA+SGLS +FT
Sbjct: 404 LAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFT 463

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W  IC+ HIRFR+A+  QGR +DE+ +KS  GVWGS +   M++++ I Q +V + PVG 
Sbjct: 464 WGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVG- 522

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568
           GS   + FF+ YL+ P+ + +Y+G+KI+KR+
Sbjct: 523 GSPSAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  409 bits (1052), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/619 (36%), Positives = 359/619 (57%), Gaps = 55/619 (8%)

Query: 15  NDITKSSAKFNDVDVIDIDSA--ERNYELPTSSTTHSR-------FRNFIDSFKPPETTH 65
           +DI   S+K   + +I+ D+   + N+    + +T SR       +R  IDSFKPPE   
Sbjct: 13  SDIKYKSSKNEFITIIESDNKNIDDNFIPHDTLSTISRKEKKPPIYRRIIDSFKPPE--- 69

Query: 66  HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXX 125
                            D               LKK+++ RH++M++             
Sbjct: 70  -----------------DGSFHTGN--------LKKSLKSRHLIMIAIGGSIGTGLFIGS 104

Query: 126 XXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSI 185
               A  GP  ++IG+A+  S I   I  +GE+ V +  +VG F +Y    +DP+++F +
Sbjct: 105 GQALATGGPLAVIIGWAVAGSQIVGTIHGLGEITVRF-PVVGAFASYTTRFLDPSISFVV 163

Query: 186 AWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEF 245
           + IY +QWF V PLE++ +++T+QYW   ++  +FV IFY ++++IN+FG ARG+ E EF
Sbjct: 164 STIYVLQWFFVLPLEIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFG-ARGFGEAEF 222

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVT 305
           I ++ KI+ + GF IL IV+I GG  +  +IG KYW +PG+       + FKGV+S LV 
Sbjct: 223 IFSTVKIITICGFIILCIVLIAGGGPDHEYIGAKYWHNPGSL-----AHGFKGVLSVLVV 277

Query: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365
           A++S G TE   + AS +++P K +PSA K+V +R L  +L S+ +VG LVPY +  LLG
Sbjct: 278 ASYSLGGTEMTCL-ASGETDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLG 335

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
            SS     SP+V+A+  H ++V+P  +NAVIL+S+ SV +S  ++SSR L ++A Q   P
Sbjct: 336 GSSVDN--SPFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIP 393

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
             F ++DR GRP  G ++ ++  ++AF   SS  TEVF+WL+AI+GL+    W  I + H
Sbjct: 394 WWFGYIDRAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICH 453

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSADV 542
           +RFR AMK Q R++DE+ + S VG+WGS Y+ ++  LI++ Q ++ + P+G   +     
Sbjct: 454 VRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRA 513

Query: 543 QAFFQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           + FFQ+YL   + IVL++G+KI+ R     W  +I  KDIDL + R   D EI++QE  E
Sbjct: 514 KKFFQNYLCALILIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHE 573

Query: 599 YQEKLRNGPVWRRVYDFWC 617
            +  L + P + R +  WC
Sbjct: 574 KKMYLASKPWYVRQFHVWC 592

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  408 bits (1048), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 211/524 (40%), Positives = 320/524 (61%), Gaps = 6/524 (1%)

Query: 61  PETTHHI---ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXX 117
           P ++H +     D    +S  S  D   +  + V  E  E L K +  RH++ ++     
Sbjct: 37  PGSSHDLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSI 96

Query: 118 XXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLV 177
                          GPA L+IG+ I++S ++ +I A+GE+A  +  +VGGFN Y    V
Sbjct: 97  GTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATF-PIVGGFNVYMTRFV 155

Query: 178 DPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGA 237
           DP+  F++   Y I W    PLELV AS+TI+YW  ++N+D +V IF++ +  +N+    
Sbjct: 156 DPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMD-V 214

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFK 297
           + ++E EF+ +  KIL ++GFFILGIV+  GG    G+IGGKYW DPGAF G    +RFK
Sbjct: 215 KFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAFHGDSAGSRFK 274

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G+ S  V AAFS+   E  A++A+E  NPRK IP A K+  +     Y++ + ++G+LVP
Sbjct: 275 GLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVP 334

Query: 358 YDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLL 416
           Y+   LL GSSS    ASP V+A+   G++ +P  +NA+ILI++ SVA+S  Y  SR+++
Sbjct: 335 YNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMV 394

Query: 417 TLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVF 476
           ++A     PKVF+ VD+ GRP         + +++F A S K+ EVF WL AI GLS +F
Sbjct: 395 SMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIF 454

Query: 477 TWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG 536
            W  I L+HIRFR A+K Q RS+DE+ Y SQ G+WGS Y  ++++L++I   WV + PVG
Sbjct: 455 CWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVG 514

Query: 537 EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL 580
           E SAD +AFF+ YL+ P+ I  Y+G+K++ ++W+  I  ++ID+
Sbjct: 515 ESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDI 558

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  409 bits (1051), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 225/618 (36%), Positives = 351/618 (56%), Gaps = 9/618 (1%)

Query: 3   DTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPE 62
           DT    + S  ++ +T ++ +    + + + S +     P     ++R  N        E
Sbjct: 15  DTSTKQEMSNSRSYLTTTAHQSLSSEALSMGSLDARS--PQKDVWYTRLLNDFKRADEGE 72

Query: 63  TTHHI-ETDMNPILSHQSVFDDAKVEISQVDDELNE-KLKKTIQPRHVVMMSXXXXXXXX 120
           TT  + ++DM   +  +   +   VE +  D   N  +L K +  RH++ ++        
Sbjct: 73  TTRSVADSDME--VDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTG 130

Query: 121 XXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180
                       GP  ++I + ++++C++ I+ ++GE+A  +  +VGGFN Y    V+P+
Sbjct: 131 LFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAF-PVVGGFNVYITRFVEPS 189

Query: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240
             F++   Y  QW  + PLEL  AS+TI+YW  K+N+D +V IFY+ +   N+    + +
Sbjct: 190 FGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLD-VKSF 248

Query: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV 300
            ETEF+ +  KIL + GF ILG V+ICGG    GFIG KYW DPGAF G     +FKG+ 
Sbjct: 249 GETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPGAQFKGLC 308

Query: 301 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360
           S  VTAAFS+  TE + ++A+E  NPR  IP A+K+  +     YL  + I G LVP + 
Sbjct: 309 SVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSND 368

Query: 361 SELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLA 419
             LL G SS    ASP V+A+   G+R VP  +NA+ILI++ SVA+S+ Y+ SR ++++A
Sbjct: 369 PRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMA 428

Query: 420 RQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWA 479
           + G  PKVF ++DR GRP +  L   V  +++F A S K+  +F WL A+SGLS +F W 
Sbjct: 429 QVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWF 488

Query: 480 LICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGS 539
            I +SHIRFRRAM  Q RS+DE+ Y S  GV GS Y   +++ +++   W  + P G   
Sbjct: 489 AINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSG 548

Query: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599
              ++FF+ YL+ P+F++ Y+ +K++KRDWRLFI A  ID+ S R   D E L++++   
Sbjct: 549 PSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLRE 608

Query: 600 QEKLRNGPVWRRVYDFWC 617
           Q +    P + R + FWC
Sbjct: 609 QAETAKKPFYVRWWIFWC 626

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  406 bits (1044), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 215/532 (40%), Positives = 323/532 (60%), Gaps = 3/532 (0%)

Query: 87  EISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMAS 146
           E ++ +D  N  L K +  RH++ ++                 +  GPA LVI + I+++
Sbjct: 74  EDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIIST 133

Query: 147 CIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASM 206
           C++ +I ++GE++  +  +VGGFN Y    ++P+  F++   Y  QW  + PLELV AS+
Sbjct: 134 CLFTVINSLGELSAAF-PVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASI 192

Query: 207 TIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVII 266
           TI+YW  K+N+D +V IFY  +   N+    + + ETEF+ +  KIL +IGF ILGIV+ 
Sbjct: 193 TIKYWNDKINSDAWVAIFYATIALANMLD-VKSFGETEFVLSMIKILSIIGFTILGIVLS 251

Query: 267 CGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNP 326
           CGG  + G+IGGKYW DPGAF G     +FKG+ S  VTAAFS+   E  A++A+E  NP
Sbjct: 252 CGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNP 311

Query: 327 RKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGV 385
           R+ IP AAK+  +     Y+  + ++G LVP +   LL GSSS    +SP V+A+   G+
Sbjct: 312 RETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGI 371

Query: 386 RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGA 445
           + +P  +NA+ILI+V SVA+SA Y+ SR ++ +A  G  PK    VD+ GRP    L+  
Sbjct: 372 KGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTL 431

Query: 446 VIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYK 505
              +++F A S K+ EVF WL A+SGLS +F W  I LSHIRFR+AMKVQ RS+DE+ + 
Sbjct: 432 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFI 491

Query: 506 SQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW 565
           SQ GV GS Y F+++ L++I   W  + P+G   A  ++FF+ YL+ P+ IV Y+G+K++
Sbjct: 492 SQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLY 551

Query: 566 KRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            R+W L ++ +D+DL + R   D  + R+E    +E L       R   FWC
Sbjct: 552 TRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFVTRFLHFWC 603

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  405 bits (1042), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/543 (40%), Positives = 329/543 (60%), Gaps = 3/543 (0%)

Query: 76  SHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPA 135
           SH    D+A   + + D + + ++ K +  RH++ ++                 +  GPA
Sbjct: 73  SHSLTRDEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPA 132

Query: 136 GLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFC 195
            LVI + I+++C++ ++ ++GE+A  +  +VGGFN Y    +DP+  F++   Y  QW  
Sbjct: 133 SLVIDWVIISTCLFTVVNSLGELAAAF-PVVGGFNVYITRFIDPSFGFAVNINYLAQWLV 191

Query: 196 VCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMM 255
           + PLELV AS+TI+YW  K+N+D +V IFY  +   N+    + + ETEFI +  KIL +
Sbjct: 192 LLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLD-VKSFGETEFILSMIKILAI 250

Query: 256 IGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEF 315
           +GF ILGIV+ CGG    G+IGGKYW DPGAF G     +FKG+ S  VTAAFS+   E 
Sbjct: 251 VGFTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGETSGTKFKGLCSVFVTAAFSYSGMEL 310

Query: 316 LAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKAS 374
            A++A+E  NPR+ IP AAK+  +   L Y+  + ++G LVPY++ +LL GSSS    +S
Sbjct: 311 TAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASS 370

Query: 375 PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRT 434
           P V+A+   G+R +P  +NA+ILI++ SVA+SA Y+ SR ++++AR    P+    VDR 
Sbjct: 371 PLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRK 430

Query: 435 GRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKV 494
           GRP    L+     +++F A S K+ EVF WL A+SGLS +F W  I LSHIRFR+AM  
Sbjct: 431 GRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAH 490

Query: 495 QGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPV 554
           QG S+DE+ Y S  GV GS Y  +++ L+++   W  + P+G   AD  +FF+ YL+ P+
Sbjct: 491 QGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPI 550

Query: 555 FIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYD 614
            IV Y+G+K++ R  RL I   D+DL+S R + D E+ R+E    +E+L     + R   
Sbjct: 551 LIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLH 610

Query: 615 FWC 617
            WC
Sbjct: 611 LWC 613

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  404 bits (1037), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/605 (38%), Positives = 349/605 (57%), Gaps = 25/605 (4%)

Query: 20  SSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQS 79
           SS K+++ +V +  S     E  +   T S   N   S +  +   H   ++      Q 
Sbjct: 7   SSVKYSNGEVKERKSKSEFVEYKSKQLTSSSSHNSNLSHQDDDDGEHSNRNI-----FQR 61

Query: 80  VFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
             D  K  +    D  N  LK+T++PRH++M++                 A  GP G+V+
Sbjct: 62  CVDSFKPPLDGSFDTSN--LKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVL 119

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPL 199
           G+ I  S I   I  +GE+ V +  +VG F  Y    +DP+++F ++ IY +QWF V PL
Sbjct: 120 GWTIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPL 178

Query: 200 ELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
           E++ A+MT+QYW + ++  I+V IFY +++ IN+FG ARG+ E EF  ++ K + + GF 
Sbjct: 179 EIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFG-ARGFGEAEFAFSTVKAITVCGFI 237

Query: 260 ILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319
           IL IV+ICGG  +  FIG KYW DPG        N F GV++ LV A++S G  E +   
Sbjct: 238 ILSIVLICGGGPDHEFIGAKYWHDPGCL-----ANGFPGVLAVLVVASYSLGGIE-MTCL 291

Query: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLA 379
           AS +++P K +P A K+V +R L  +LAS+ +VG LVPY +  LLG SS     SP+V+A
Sbjct: 292 ASGETDP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSSVDN--SPFVIA 348

Query: 380 VSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSL 439
           +  H ++V+P  +NAVILISV SV +S  ++SSR L ++A QG  P  F ++DR GRP +
Sbjct: 349 MKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLV 408

Query: 440 GFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSI 499
           G +  ++  ++AF   S    +VFNWL+AI+GL+    W  I LSHIRFR AMK QG+S+
Sbjct: 409 GIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSL 468

Query: 500 DEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSADVQAFFQDYLAMPVFI 556
           DE+ + S VG+WGSAY+ ++  LI+I Q +  + P+G    G    + FFQ+YL   + +
Sbjct: 469 DELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIML 528

Query: 557 VLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRV 612
            +++ +KI+ +     W      KDIDL + R   D EI++QE  E +  L + P + R 
Sbjct: 529 FIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQEIMERKMHLDSRPWYVRQ 588

Query: 613 YDFWC 617
           + FWC
Sbjct: 589 FHFWC 593

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  403 bits (1036), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/547 (40%), Positives = 329/547 (60%), Gaps = 20/547 (3%)

Query: 78  QSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGL 137
           Q   D  K  +    D  N  LK+T++PRH++M++                 A  GP G+
Sbjct: 59  QRCVDSFKSPLDGSFDTSN--LKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGV 116

Query: 138 VIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVC 197
           VIG+AI  S I   I  +GE+ V +  +VG F  Y    +DP+++F ++ IY +QWF V 
Sbjct: 117 VIGWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVL 175

Query: 198 PLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIG 257
           PLE++ A+MT+QYW + ++  I+V IFY ++++IN+FG  RG+ E EF  ++ K + + G
Sbjct: 176 PLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFG-VRGFGEAEFAFSTIKAITVCG 234

Query: 258 FFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLA 317
           F IL +V+ICGG  +  FIG KYW DPG        N F GV+S LV A++S G  E + 
Sbjct: 235 FIILCVVLICGGGPDHEFIGAKYWHDPGCL-----ANGFPGVLSVLVVASYSLGGIE-MT 288

Query: 318 ITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYV 377
             AS +++P K +PSA K+V +R L  +L S+ +VG LVPY +  LLG SS     SP+V
Sbjct: 289 CLASGETDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDN--SPFV 345

Query: 378 LAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRP 437
           +A+  H ++ +P  +NAVILISV SV +S  ++SSR L ++A QG  P  F ++DR GRP
Sbjct: 346 IAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRP 405

Query: 438 SLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGR 497
            +G +  ++  ++AF   S   +EVFNWL+AI+GL+    W  I LSHIRFR AMK QG+
Sbjct: 406 LVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGK 465

Query: 498 SIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSADVQAFFQDYLAMPV 554
           S+DE+ + S VG+WGSAY+ ++  LI+I Q +  + P+G    G    + FFQ+YL   +
Sbjct: 466 SLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALI 525

Query: 555 FIVLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWR 610
            + +++ +KI+ +     W      KDIDL + R   D EI++QE  E +  L + P + 
Sbjct: 526 MLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLDSRPWYV 585

Query: 611 RVYDFWC 617
           R + FWC
Sbjct: 586 RQFHFWC 592

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  403 bits (1035), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/624 (36%), Positives = 360/624 (57%), Gaps = 53/624 (8%)

Query: 5   PGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELP--TSSTTHSR--FRNFIDSFKP 60
           P SSK       I +SS+  ND   ID+ S   + E P     T   R  F+  IDSFKP
Sbjct: 19  PSSSKS---MEGIGRSSSYKNDKTFIDVYSRRSSTEGPPVAKGTKPPRNIFQRAIDSFKP 75

Query: 61  PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXX 120
           PE                  FD +              LKKT++ RH++M++        
Sbjct: 76  PE---------------DGSFDTSN-------------LKKTLKARHLIMIAIGGSIGTG 107

Query: 121 XXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180
                    A  GP  ++IG+AI  S I   I  +GE+ V +  +VG F  Y    +DP+
Sbjct: 108 LFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYSTRFLDPS 166

Query: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240
           ++F ++ IY IQWF V PLE+++++MT+QYW   ++  ++V IFY+ +++IN+FG  RG+
Sbjct: 167 ISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFG-VRGF 225

Query: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVV 300
            E EFI ++ K++ + GF +L I++I GG  +  ++G +YW +PG        N F GV+
Sbjct: 226 GEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYVGSRYWHNPGCL-----ANGFPGVL 280

Query: 301 STLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360
           S +V A++S G TE   + AS +++P K +PSA K+V +R L  +L S+ +VG LVPY +
Sbjct: 281 SVMVVASYSLGGTEMTCL-ASGETDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTN 338

Query: 361 SELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420
             LLG SS     SP+V+A+  H ++V+P  +NAVILIS+ SV +S  ++SSR L ++A 
Sbjct: 339 ENLLGGSSVDN--SPFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAH 396

Query: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480
           Q   P  F ++DR GRP +G +  ++  ++AF   S   +EVF+WL+AI+GL+    W  
Sbjct: 397 QHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLS 456

Query: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG--EG 538
           I +SHIRFR AMK QGRS++E+ + S VG+WGS Y+ ++  LI++ Q ++ + P+G  + 
Sbjct: 457 INVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKN 516

Query: 539 SAD-VQAFFQDYLAMPVFIVLYLGYKI--WKRDWRL--FIRAKDIDLISHRHIHDPEILR 593
           S D  + FFQ YL   + + +++G+KI  W++  ++  F    +IDL   R   D ++L+
Sbjct: 517 SEDRAKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLK 576

Query: 594 QEREEYQEKLRNGPVWRRVYDFWC 617
           QE  E +  L++ P + R Y +WC
Sbjct: 577 QEIHERKMYLKSRPWYIRFYHYWC 600

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  402 bits (1032), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/597 (37%), Positives = 356/597 (59%), Gaps = 31/597 (5%)

Query: 32  IDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVF----DDAKVE 87
           + + E   E+ TS++  +++    DS KP  ++        P+++ +++F    D  K  
Sbjct: 1   MSTKEFKEEIHTSTSEFTKY----DSQKPYYSSGE---SPEPVVTKRNIFQRCVDSFKPP 53

Query: 88  ISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASC 147
           +    D  N  LK+T++ RH++M++                 A  GP  ++IG+ I  S 
Sbjct: 54  VDGSFDTSN--LKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQ 111

Query: 148 IYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMT 207
           I   I  +GE+ V +  +VG F  Y    +DP+++F ++ IY IQWF V PLE++ +++T
Sbjct: 112 IVGTIHGLGEITVRF-PVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAIT 170

Query: 208 IQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIIC 267
           IQYW + ++  ++V IFY ++++IN+FG ARG+ E EF+ ++ K + + GF IL IV+IC
Sbjct: 171 IQYWNSSIDPVVWVAIFYGVIVSINLFG-ARGFGEAEFVFSTIKAITICGFIILCIVLIC 229

Query: 268 GGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPR 327
           GG  +  FIG KYW DPGA       + F GV+S LV A++S G TE   + AS +++P 
Sbjct: 230 GGGPDHEFIGAKYWHDPGAL-----AHGFPGVLSVLVVASYSLGGTEMTCL-ASGETDP- 282

Query: 328 KAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRV 387
           K +PSA K+V +R L  +LAS+ +VG LVPY +  LLG SS     SP+V+A+  H ++ 
Sbjct: 283 KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHHIKA 340

Query: 388 VPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVI 447
           +P  +NAVILIS+ SV +S  ++SSR L ++A QG  P+ F ++DR GRP  G +  ++ 
Sbjct: 341 LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLF 400

Query: 448 AVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQ 507
            ++AF   SS  +EVF+WL+AI+GL+    W  I LSHIRFR AMK Q +++DE+ + S 
Sbjct: 401 GLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSA 460

Query: 508 VGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSADVQAFFQDYLAMPVFIVLYLGYKI 564
           VG+WGSAY+ ++ +LI+I Q ++ + P+G   + S   + FFQ YL   + ++++  +K+
Sbjct: 461 VGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKV 520

Query: 565 WKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           + R     W      KDIDL + R   D ++++ E  E +  L+  P   R Y FWC
Sbjct: 521 YYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  400 bits (1027), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/574 (38%), Positives = 337/574 (58%), Gaps = 46/574 (8%)

Query: 51  FRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVM 110
           F+  +DSFKPP                   FD +              LK+T++PRH++M
Sbjct: 58  FQRCVDSFKPP---------------LDGSFDTSN-------------LKRTLKPRHLIM 89

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           ++                 A  GP G+V+G+ I  S I   +  +GE+ V +  +VG F 
Sbjct: 90  IAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRF-PVVGAFA 148

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
            Y    +DP+++F ++ IY +QWF V PLE++ A+MT+QYW + ++  I+V IFY ++++
Sbjct: 149 NYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVS 208

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS 290
           IN+FG ARG+ E EF  ++ K + + GF IL IV+ICGG  +  FIG KYW DPG     
Sbjct: 209 INLFG-ARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCL--- 264

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
              + F GV+S LV A++S G  E +   AS +++P K +PSA K+V +R +  +L S+ 
Sbjct: 265 --AHGFPGVLSVLVVASYSLGGIE-MTCLASGETDP-KGLPSAIKQVFWRIIFFFLVSLT 320

Query: 351 IVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYS 410
           +VG LVPY +  LLG SS     SP+V+A+  H ++V+P  +NAVILISV SV +S  ++
Sbjct: 321 LVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFA 378

Query: 411 SSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAIS 470
           SSR L ++A QG  P  F ++DR GRP +G +  ++  ++AF   S   +EVFNWL+AI+
Sbjct: 379 SSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIA 438

Query: 471 GLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWV 530
           GL+    W  I LSH+RFR AMK QG+S+DE+ + S VG+WGS Y+ ++  LI+I Q + 
Sbjct: 439 GLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYC 498

Query: 531 GIVPVGEGSAD---VQAFFQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDIDLISH 583
            + P+G  ++     + FFQ+YL   + + +++ +KI+ R     W      KDIDL + 
Sbjct: 499 SLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETD 558

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           R   D EI++QE  E ++ L + P + R + FWC
Sbjct: 559 RKDIDIEIVKQEIAEKKKYLDSRPWYVRQFHFWC 592

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  400 bits (1029), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/628 (36%), Positives = 353/628 (56%), Gaps = 20/628 (3%)

Query: 2   IDTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPP 61
           +D   SSK+   KN  T S  +  + ++  + S   N +     T H      ID   P 
Sbjct: 39  LDDQPSSKD--RKNLSTTSQQELKNGEIYSLQS---NLDF-QDGTNHFDNETQIDIVSPD 92

Query: 62  ETTHHIETDMNPILSHQSVFD--------DAKVEISQVDDE---LNEKLKKTIQPRHVVM 110
               +I  D + +     + D         + V  ++  DE   L   + K +  RH++ 
Sbjct: 93  YKNENINVDEDKLPFSDDIRDVKDRSDFSSSFVSSARDKDEETLLATDMNKDLSVRHLLT 152

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           ++                    GPA LVIG+ I+++ ++ +I ++GE+A  +  +VGGF+
Sbjct: 153 LAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAF-PVVGGFS 211

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
            Y    VDP+  F++   Y +QW  + PLELV AS+TI+YW + +N+D +V IFY+ +  
Sbjct: 212 VYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSDAWVSIFYVAIGL 271

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS 290
            N+    + + ETEF+ +  KIL +IGFFILGIV+ CGG  +  +IGGKYW DPGAF G+
Sbjct: 272 ANMLD-VKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAFVGT 330

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
              ++FKG+ S  VTAAFSF   E  A++A+E  NPR+ IP AAK+  +     Y++ + 
Sbjct: 331 TSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSILT 390

Query: 351 IVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFY 409
           +VG LVPY+   L+ GSSS    +SP V+A+    +  +P  +NA+ILI++ SVA+S+ Y
Sbjct: 391 LVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILSVANSSVY 450

Query: 410 SSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAI 469
           + SR ++++++    PKVF  VDR GRP           +++F A S K+ EVF WL A+
Sbjct: 451 ACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSAL 510

Query: 470 SGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCW 529
           SGLS +F W  I L HIRFR+ M VQ  S+DE+ + SQ G+WGS Y  V++ L+++   W
Sbjct: 511 SGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFW 570

Query: 530 VGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDP 589
             + PVG   A+  +FF+ YL+ P+ +  Y+ +K++ ++WR +I A  +DL S R   D 
Sbjct: 571 TSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDL 630

Query: 590 EILRQEREEYQEKLRNGPVWRRVYDFWC 617
           E++R+E    +E L     + R    WC
Sbjct: 631 EVVREELRLEKEHLAQRSFFYRFLHVWC 658

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  397 bits (1020), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/583 (37%), Positives = 335/583 (57%), Gaps = 18/583 (3%)

Query: 36  ERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDEL 95
           + N+ L    +T S   + +DS K P       TD   ++SH+             DD  
Sbjct: 27  DANFALEEKDSTLSPLAS-LDS-KVPHEKIQTTTDFASVISHE-------------DDIN 71

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           N  L K +  RH++ ++                 A  GPA LVI + I+++C++ +I A+
Sbjct: 72  NVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINAL 131

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  +  +VGGFN Y    +DP++ F++   Y  QW  + PLELV ASMTI+YW   +
Sbjct: 132 GEMAAAF-PVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETI 190

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           N+D +V IFY ++   N+    + + ETEF+ +  KIL +IGF ILGIV+ CGG  + GF
Sbjct: 191 NSDAWVAIFYCVIALANMLE-VKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGF 249

Query: 276 IGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAK 335
           IGGKYW  PG+F G +   +FKG+ S  VTAAFS+   E  A++A+E  +PR  IP AAK
Sbjct: 250 IGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAK 309

Query: 336 KVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVRVVPHFINA 394
           +  +     Y+  + ++G LVPYD   LL G+SS    +SP V+A+   G++ +P  +NA
Sbjct: 310 RTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNA 369

Query: 395 VILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCA 454
           +ILIS+ SVA+SA Y+ SR ++ +A  G  P++   VD  GRP    +      +++F A
Sbjct: 370 IILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVA 429

Query: 455 CSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSA 514
            S ++ +VF WL A+SGLS +F W  I LSHIRFR++M  Q RS+DE+ + SQ GVWGS 
Sbjct: 430 ASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSW 489

Query: 515 YAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIR 574
           Y  +++ L+++   W  + P+G  SAD ++FF+ YL+ P+ +  Y G+K++ R     + 
Sbjct: 490 YGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVG 549

Query: 575 AKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
             D+DL + R   D ++ R+E    +E+L     ++     WC
Sbjct: 550 LADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  389 bits (999), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 214/579 (36%), Positives = 337/579 (58%), Gaps = 46/579 (7%)

Query: 46  TTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQP 105
           +  + F+  +DSFKPP                     D   + S         LK+T++P
Sbjct: 53  SNRNIFQRCVDSFKPPL--------------------DGSFDTSN--------LKRTLKP 84

Query: 106 RHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTL 165
           RH++M++                 A  GP G+V+G+ I  S I   I  +GE+ V +  +
Sbjct: 85  RHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PV 143

Query: 166 VGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFY 225
           VG F  Y    +DP+++F ++ IY +QWF V PLE++ A+MT+QYW + ++  ++V IFY
Sbjct: 144 VGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFY 203

Query: 226 ILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPG 285
           +++++IN+FG  RG+ E EF  ++ K + + GF IL IV+I GG  +  ++G KYW DPG
Sbjct: 204 VIIVSINLFG-VRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPG 262

Query: 286 AFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIY 345
                   N F G++S LV A++S G  E +   AS +++P K +PSA K+V +R L  +
Sbjct: 263 CL-----ANGFPGILSVLVVASYSLGGIE-MTCLASGETDP-KGLPSAIKQVFWRILFFF 315

Query: 346 LASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVAD 405
           L S+ +VG LVPY +  LLG SS     SP+V+A+  H ++V+P  +N VILISV SV +
Sbjct: 316 LVSLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKVLPSIVNVVILISVLSVGN 373

Query: 406 SAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNW 465
           S  ++SSR L ++A QG  P  F ++DR GRP +G +  ++  ++AF   S    +VFNW
Sbjct: 374 SCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNW 433

Query: 466 LLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMI 525
           L+AI+GL+    W  I +SHIRFR AMK QG+ +DE+ + S VG+WGSAY+ ++  LI++
Sbjct: 434 LMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILL 493

Query: 526 GQCWVGIVPVG--EGSAD-VQAFFQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDI 578
            Q +  + P+G  + S+D  + FFQ+YL   + + +++ +KI+ +     W      KDI
Sbjct: 494 AQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDI 553

Query: 579 DLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           DL + R   D EI++QE  E +  L + P + R + +WC
Sbjct: 554 DLETDRKNIDIEIVKQEIAEKKMYLDSCPWYVRHFHYWC 592

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  387 bits (994), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 212/620 (34%), Positives = 355/620 (57%), Gaps = 55/620 (8%)

Query: 13  EKNDITKSSAKFNDVDVIDIDSAERNYELPTS-----STTHSR--FRNFIDSFKPPETTH 65
            + D+ K++++ ++   +     +R+  L  S     S T+ R   R  IDSFKPP    
Sbjct: 3   HQKDVEKAASELSNTSAVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPP---- 58

Query: 66  HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXX 125
            ++   +P                       + LK+T++ RH++M++             
Sbjct: 59  -VDGSFDP-----------------------DNLKRTLKSRHLIMIAIGGSIGTGLFIGS 94

Query: 126 XXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSI 185
               A  GP  ++IG+ +  + +   I  +GE+ V +  +VG F  Y    +DP+++F +
Sbjct: 95  GKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRF-PVVGAFANYSTRFLDPSVSFVV 153

Query: 186 AWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEF 245
           + IY +QWF V PLE++ +++T+++WTT V+  ++V +FY L+++IN+FG  R + + +F
Sbjct: 154 SSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFG-VRWFGKPKF 212

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVT 305
           + +  K++ + GF IL +V+I GG     FIG +YW DPGA       N FKGV + +VT
Sbjct: 213 VFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGAL-----ANGFKGVAAVMVT 267

Query: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365
           A++S G +E   + AS +++P K IP A K++ +R +  +L S+ +VG LVPY + +LLG
Sbjct: 268 ASYSLGGSEMTCL-ASGETDP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG 325

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
            S+     SP+V+A+  H +RV+PH IN VIL+S+ SV +S  ++SSR L ++A QG  P
Sbjct: 326 GSN--VNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLP 383

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           ++F +VDR GRP  G L  ++  ++AF   SS    VF WL+A++GL+    W  I +SH
Sbjct: 384 RIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSH 443

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSAD---- 541
           IRFR AMK QG+S+DE+ + S VG+WGS Y+ VM +++++ Q +V + P+ EG  D    
Sbjct: 444 IRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPI-EGWKDPRGR 502

Query: 542 VQAFFQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQERE 597
            +AFFQ+YL   + + +++ +KI+ R     W   +   +IDL S R   D E+++ E  
Sbjct: 503 TEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVA 562

Query: 598 EYQEKLRNGPVWRRVYDFWC 617
             ++ +     + R Y +WC
Sbjct: 563 ARKKYISEQRWYIRYYHYWC 582

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  386 bits (992), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/628 (36%), Positives = 358/628 (57%), Gaps = 56/628 (8%)

Query: 6   GSSKESYEKNDITKSSAK-------FNDVDVIDIDSAERNYELPTSSTTHSR--FRNFID 56
            SS ES++ N ++   +K       F+D   ID D  E    L   + T +R  F+  ID
Sbjct: 3   ASSWESHDNNGVSAKLSKNEFVTTIFSDNKNID-DKYEHAESLTDYTKTENRNIFQRVID 61

Query: 57  SFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXX 116
           SFKPP               H S                   LK++++ RH++M++    
Sbjct: 62  SFKPPANGSF----------HTS------------------NLKRSLKSRHLIMIAIGGS 93

Query: 117 XXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFL 176
                        A+ GP  LV+G++I  S I   I  +GE+ V +  +VG F  Y    
Sbjct: 94  IGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRF-PVVGAFANYQTRF 152

Query: 177 VDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGG 236
           +DP+L+F I+ IY +QWF V PLE++++++T+QYW   ++  +FV IFY  +++IN+FG 
Sbjct: 153 LDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAIVSINLFG- 211

Query: 237 ARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRF 296
            RG+ E EF+ ++ K++ + GF IL I++ICGG     FIG KYW DPG        N F
Sbjct: 212 VRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGCL-----ANGF 266

Query: 297 KGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356
           +G +S L+TA++S G TE   + AS +++P K +PSA K+V +R L  +L S+ +VG LV
Sbjct: 267 RGFLSVLITASYSLGGTEMTCL-ASGETDP-KELPSAIKQVFWRILFFFLVSLTLVGFLV 324

Query: 357 PYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLL 416
           PY +  LLG SS     SP+V+A+  H ++V+P  +NAVILIS+ SV +S  ++SSR L 
Sbjct: 325 PYTNENLLGGSSVDN--SPFVIAIKLHNIKVLPSIVNAVILISILSVGNSCIFASSRTLC 382

Query: 417 TLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVF 476
           ++A QG  P  F ++DR GRP  G ++ ++  ++AF   SS  +EVF+WL+AI+GL+   
Sbjct: 383 SMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCI 442

Query: 477 TWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG 536
            W  I + HIRFR AMK Q ++IDE+ + S VGVWGS Y+ ++  LI+I Q +V + P+G
Sbjct: 443 VWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIVQFYVSLWPIG 502

Query: 537 ---EGSADVQAFFQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDP 589
              +       FFQ+YL   V ++ ++ +K++ R     W   I  KDIDL + R   D 
Sbjct: 503 GWTDSKDRAGKFFQNYLCAIVSLIFFICHKLYFRYKTKKWWEIIPLKDIDLDTGRKNIDI 562

Query: 590 EILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +I+++E +E ++ L   P + R+   WC
Sbjct: 563 DIVKEEIKERKQYLATKPWYIRLMHHWC 590

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  386 bits (992), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/586 (36%), Positives = 337/586 (57%), Gaps = 52/586 (8%)

Query: 44  SSTTHSRFRNF----IDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKL 99
           + +T  R RN     IDSFKPP     ++   +P                         +
Sbjct: 47  NGSTEERKRNVVQRVIDSFKPP-----VDGSFDP-----------------------SNM 78

Query: 100 KKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMA 159
           K+ ++ RH++M++                 A  GP  L+IG+ +  + +   I  +GE+ 
Sbjct: 79  KRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELT 138

Query: 160 VNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADI 219
           V  L +VG F  Y    +DP+++F I+ IY +QWF V PLE++ + +T+++WT  V+  I
Sbjct: 139 VR-LPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPII 197

Query: 220 FVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGK 279
           +V +FY ++++IN+ G  RG+ E EFI +S K++ + GF IL IV+I GG     ++G +
Sbjct: 198 WVALFYTMIVSINLLG-VRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSR 256

Query: 280 YWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 339
           YW DPG        N FKGV + +VTA++S G +E   + AS +++P K +P A K++ +
Sbjct: 257 YWHDPGPL-----ANGFKGVAAVMVTASYSLGGSEMTCL-ASGETDP-KELPHAIKQIFW 309

Query: 340 RALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILIS 399
           R L  +L S+ +VG LVPY +  LLG SSA  + SP+VLA+  H V+VVPH +N VIL+S
Sbjct: 310 RILFFFLVSLTLVGFLVPYTNENLLGGSSA--ENSPFVLALYLHHVKVVPHIVNGVILVS 367

Query: 400 VFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKE 459
           + SV +S  ++SSR L ++A QG  P +F +VDR GRP +G L  ++  ++AF    S  
Sbjct: 368 ILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSI 427

Query: 460 TEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVM 519
           + VF+WL+AI+GL+    W  I +SH+RFR AMK Q +S+DE+ + S VGVWGS YA V+
Sbjct: 428 SNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVL 487

Query: 520 MILIMIGQCWVGIVPVGEGSAD----VQAFFQDYLAMPVFIVLYLGYKIWKR----DWRL 571
             L ++ Q ++ + PV EG  D     +AFF++YL   + I ++  +K + R     W  
Sbjct: 488 NFLTLVAQFYIALWPV-EGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWG 546

Query: 572 FIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
             +  ++DL + R   D EI+++E  E ++ LRN   + R Y +WC
Sbjct: 547 IKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAWYTRYYYYWC 592

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  384 bits (987), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/620 (35%), Positives = 340/620 (54%), Gaps = 59/620 (9%)

Query: 10  ESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFI----DSFKPP-ETT 64
           ESY +  +T    K  D        +E+     T        RN I    DSFKPP + +
Sbjct: 15  ESYVETCVTGQEIKIGD-------GSEKTSTPSTVVNHRGTKRNIIQRMVDSFKPPLDGS 67

Query: 65  HHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXX 124
            H                             ++ LKK+++ RH++M++            
Sbjct: 68  FH-----------------------------SDNLKKSLKARHLIMIAIGGSIGTGLFIG 98

Query: 125 XXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFS 184
                A  GP  L+IG+ +  + +   I  +GE+ V +  +VG F  Y    ++P+++F 
Sbjct: 99  SGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFV 157

Query: 185 IAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETE 244
           +  IY +QW  V PLE++ A+MT++YW + V    +V IFY  +  +N+ G  RG+ E E
Sbjct: 158 VVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLG-VRGFGEAE 216

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLV 304
           FI +  K+L +IGF IL +V+ICGG     F+G KYW DPG        N FKGV +  V
Sbjct: 217 FIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPL-----ANGFKGVAAVFV 271

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
            A++S G TE +A  AS +++P K +PSA K+V +R +  +L S+ +VG LVPY +  L+
Sbjct: 272 IASYSLGGTE-MACLASGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLM 329

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
           G SS     SP+V+A+  HG++ +P  +NAVIL+S+ SV +S  ++SSR L ++A QG  
Sbjct: 330 GGSS--VDNSPFVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLI 387

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           P++F ++DR GRP +G L      ++AF   SS   +VF WL+AI+GL+    W  I +S
Sbjct: 388 PRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVS 447

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG---EGSAD 541
           HIRFR AMK QG S+DE+ + S VGV+GS Y+  + +LI++ Q +V + PVG     S  
Sbjct: 448 HIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTR 507

Query: 542 VQAFFQDYLAMPVFIVLYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQERE 597
            + FFQ+YL   + ++L+ G+KI+ R     W  F   +DIDL++   + D E+ + E  
Sbjct: 508 TENFFQNYLCSLILLLLFAGHKIYYRISTGKWWGFKALRDIDLLTDMRVTDTELSKHELH 567

Query: 598 EYQEKLRNGPVWRRVYDFWC 617
           E + KL   P+  R+Y  WC
Sbjct: 568 EKRVKLAQKPLIVRLYHQWC 587

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  382 bits (982), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/604 (37%), Positives = 354/604 (58%), Gaps = 53/604 (8%)

Query: 23  KFNDVDVIDIDSAERNYELPTSSTTHSRF-RNFIDSFKPP-ETTHHIETDMNPILSHQSV 80
           KF+D     I S E   +L      +    R  IDSFKPP + ++H              
Sbjct: 25  KFSD----GIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPLDGSYH-------------- 66

Query: 81  FDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIG 140
                          ++ LK+ ++ RH++M++                 A  GP  ++IG
Sbjct: 67  ---------------SDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIG 111

Query: 141 YAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLE 200
           ++I  S +   I  +GE+ + +  +VG F  Y   L+DP+++F ++ IY  QW+ V P+E
Sbjct: 112 WSIAGSQMVGTIHGLGEITMRF-PVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIE 170

Query: 201 LVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFI 260
           L+ ++MT+Q+WTTKV+  ++V IFY++V+++N+F G + + E EF  +  K++ +IGF I
Sbjct: 171 LIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLF-GVKVFGEAEFAFSLVKVITIIGFII 229

Query: 261 LGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITA 320
           L I++ICGG  +  FIG +YW  PGA       N FKGV S  VTA++S G +E + + +
Sbjct: 230 LSIILICGGGPDHRFIGTEYWHHPGAL-----ANGFKGVASVFVTASYSLGGSEMVCLCS 284

Query: 321 SEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAV 380
           +E ++P K +P A K+V +R +  +L S+ +VG LVPY +  LLG SS     SP+V+A+
Sbjct: 285 AE-TDP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS--VNNSPFVIAI 340

Query: 381 STHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLG 440
              G+RV+P  INAVILIS+ SV +S  ++SSR L ++A QG  P+VF +VDR GRP +G
Sbjct: 341 KLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVG 400

Query: 441 FLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSID 500
            +V ++  ++AF   S+    VF+WL+AI+GL+    W  I +SHIRFR AMK Q RS+D
Sbjct: 401 IIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLD 460

Query: 501 EIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQ---AFFQDYLAMPVFIV 557
           E+ +KS VGV+GS Y+  + ILI+I Q ++ + PVG  ++  Q   +FF++YL   V + 
Sbjct: 461 ELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVF 520

Query: 558 LYLGYKIWKR----DWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVY 613
           +++ +KI+ +     W  F    +IDL + R   D EI++QE  E +  L + P + R Y
Sbjct: 521 VFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRFY 580

Query: 614 DFWC 617
           +FWC
Sbjct: 581 NFWC 584

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  365 bits (938), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 216/597 (36%), Positives = 348/597 (58%), Gaps = 36/597 (6%)

Query: 33  DSAERNYELPTSSTT---HSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEIS 89
           +S+ RN  + TS ++    S  RNF +SFK       ++ D N        FDD K   +
Sbjct: 8   NSSLRNDSVSTSISSIKDTSLLRNFKNSFK------RVDQDQNK-------FDDEKY--N 52

Query: 90  QVDDE----LNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMA 145
            VD+     +++ L+KT+Q RH+ M++                 A +GP  L+IGY I+ 
Sbjct: 53  SVDEGQKRLVDQPLRKTLQQRHLTMIAIGGTLGTGLFIGLGESLA-SGPGSLLIGYIIVG 111

Query: 146 SCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTAS 205
             ++C++Q+  E++  Y  + G +       ++ +  F++A  YC+ W    P ELV ++
Sbjct: 112 IAVFCVVQSAAELSCQY-PVSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSA 170

Query: 206 MTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVI 265
           M I+YW   VN+ +++ IF++ V+ +N+FG   GYAETEF  +  KI+ +I F I+GIV+
Sbjct: 171 MVIRYWNDSVNSCVWIAIFWVFVMCLNLFG-VEGYAETEFWLSIIKIIAIIIFIIIGIVL 229

Query: 266 ICGGAGND-GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQS 324
           ICGG  N  G+IG KYW DPG+F        FK + +T V+AA+SFG  E + +T++E S
Sbjct: 230 ICGGGPNSTGYIGTKYWHDPGSF----AHPVFKSLCNTFVSAAYSFGGCEIVVLTSAE-S 284

Query: 325 NPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTH 383
               +I  AAK   +R  + YL +I+I+G LVPY  ++L+  +SS    ASP+V+A+S  
Sbjct: 285 RKISSIARAAKGTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNC 344

Query: 384 GV--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGF 441
           G     V HF+N VIL+S  SV++S  Y+SSR++  L      P +  ++DR GRP +G 
Sbjct: 345 GAMGTRVSHFMNTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGI 404

Query: 442 LVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDE 501
            +  +  ++ F   +  E  +F WL +++ ++   TW  IC   +RFR A+K QGRS DE
Sbjct: 405 AICGLFGLLGFLVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDE 464

Query: 502 IGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLG 561
           I YKS +G++G     ++ I+++IG+ ++ I P+ E S     FFQ+ L++P+ +V + G
Sbjct: 465 IAYKSMLGIYGGYVGAILNIVLIIGEVYISIFPLNE-SPSANIFFQNCLSIPIMLVSFFG 523

Query: 562 YKIWKRDWR-LFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +KI+ + W+  F+RAKDIDL +   I D EI + E EE +E++ + P++ R+Y FWC
Sbjct: 524 HKIYCKGWKDWFVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  365 bits (938), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/574 (36%), Positives = 335/574 (58%), Gaps = 23/574 (4%)

Query: 49  SRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHV 108
           S  R++ DSFKP E +  I  D++    +  + +  K+++       N+  +K +  RH+
Sbjct: 29  SAVRSWKDSFKPSELSQ-IPEDLD----YHDLTEREKIQLRLA----NQPYQKVLHQRHL 79

Query: 109 VMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGG 168
            M++                   +GPA L+IGY ++ + ++C+IQ+  E+A  +  + G 
Sbjct: 80  SMIAIGGTLGTGLFIGLGAALT-SGPAALLIGYLLVGTSMFCVIQSAAELACQF-PVSGS 137

Query: 169 FNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILV 228
           + ++    VD +L F++A  Y + W  + P EL+  S+TI YW + +N  ++V IF + V
Sbjct: 138 YASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSSINPAVWVSIFLVFV 197

Query: 229 LAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGN-DGFIGGKYWRDPGAF 287
           L IN+FG  R +AETEFI +  K+L +I F I+GIV+I GG  +  G+IG KYW DPG F
Sbjct: 198 LWINLFG-VRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGGYIGTKYWHDPGPF 256

Query: 288 RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
                   FK +  T V AAFSFG TE + +T +E  N   +I  AAK   YR  + Y+ 
Sbjct: 257 ----AKPVFKNLCQTFVAAAFSFGGTEMVLLTGTESKNV-SSIARAAKGTFYRIAIFYVT 311

Query: 348 SIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGVR--VVPHFINAVILISVFSVA 404
           +++++G LVPY+   LL  SSS    ASP+V+A+S  G     V HF+NAVIL++V SV 
Sbjct: 312 TVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAKVSHFMNAVILVAVVSVC 371

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           +S  Y+SSR++  L   G  PK+F ++DR GRP +G  V A   ++ F   + K++EVF 
Sbjct: 372 NSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFGLLGFLVATKKQSEVFT 431

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           WL A+  ++   TW  ICL+ +R+R AM+ + RS+D I YKS +G+WG     ++  L++
Sbjct: 432 WLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSILGIWGGVVGCIVNFLLV 491

Query: 525 IGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDW-RLFIRAKDIDLISH 583
            G+ +V   P    S+  + FF+  L++P+ IV++LG+KI + DW   +++ KD+DL + 
Sbjct: 492 AGEVYVSAFPANAKSS-AEGFFKYTLSIPIMIVVFLGHKIHRNDWGNWYVKRKDMDLDTG 550

Query: 584 RHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
             I D E+ + ++E  +  L + P++ RVY FWC
Sbjct: 551 CSIEDFELFQAQKEAEKRALASRPLYYRVYRFWC 584

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  365 bits (938), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 208/572 (36%), Positives = 335/572 (58%), Gaps = 24/572 (4%)

Query: 61  PETTHHIETDMNPI---LSHQSVFDDAKVEISQVDDE-------LNEKLKKTIQPRHVVM 110
           P     + + MN I      Q   + A V++S +D++        N+ L+KT+  RH++M
Sbjct: 37  PFQRKQMSSRMNRITQSFRRQDAVEYADVDLSMMDEQQRRNYVLANQPLQKTLSQRHLMM 96

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           ++                 + +GP  L+IG+ I+   ++C++Q+  E+A  Y  + G + 
Sbjct: 97  IAIGGTLGTGLFIGIGYSLS-SGPGSLLIGFLIVGLMMFCVVQSAAELACQY-PVSGSYA 154

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
            +    ++P++ F++A  Y + W    P EL+  +MT+QYW   VN  ++V IFY+ +++
Sbjct: 155 VHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNKSVNPAVWVAIFYVFIMS 214

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND-GFIGGKYWRDPGAFRG 289
           +N+FG  R Y E EF  +  K++ ++ F I+GIV+ICGG  N  G+IG KYW DPG+F  
Sbjct: 215 LNMFG-VRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIGTKYWHDPGSF-- 271

Query: 290 SDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASI 349
                 FKG+ +T V+AAFSFG  E + +TASE S   +++  AAK   +R  + Y+ ++
Sbjct: 272 --AKPVFKGLCNTFVSAAFSFGGAELVVLTASE-SRKVESVSRAAKGTFWRIAIFYITTV 328

Query: 350 IIVGLLVPYDSSELLGSSSAAT-KASPYVLAVSTHGV--RVVPHFINAVILISVFSVADS 406
           I++G LVPY + +LLG  +     ASP+V+A+S  G       HF+N VILI+V SV +S
Sbjct: 329 IVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASHFMNTVILIAVLSVCNS 388

Query: 407 AFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWL 466
           A Y+SSR++  L   G  PK+  +VD+ GRP +G  +  V  ++ F   S  E +VF WL
Sbjct: 389 AVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLLGFLVASDNEGDVFTWL 448

Query: 467 LAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIG 526
            A+  +S  FTW  IC S +RFR A++ QGRS DEI +KS +G++G     ++  L++ G
Sbjct: 449 FALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSMLGIYGGFLGCLLNALLIAG 508

Query: 527 QCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW-KRDWRLFIRAKDIDLISHRH 585
           + +V I P+G G    + FFQ  L++P+ I +Y+G+K++  +  R+ I A++IDL + R 
Sbjct: 509 EIYVSIFPLG-GDPSAKQFFQYCLSIPIMIAVYIGHKLFANKSKRVLIPAQEIDLETGRK 567

Query: 586 IHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           I D E  + E  E +EKL + P++ R+Y FWC
Sbjct: 568 IKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC 599

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  363 bits (933), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/579 (36%), Positives = 341/579 (58%), Gaps = 28/579 (4%)

Query: 47  THSRFRNFIDSFKPPE--TTHHIETDMNPILSHQSV-FDDAKVEISQVDDELNEKLKKTI 103
           + S F    DSFK  E   T  I+ D   +  +Q   +  AK           +  +K +
Sbjct: 30  SRSLFTRVKDSFKRQELVETEGIDLDTYSMTDYQRTNYLLAK-----------QPYQKNL 78

Query: 104 QPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYL 163
             RH+ M++                 A +GP  L+IG+ +    I+C++Q   E++  Y 
Sbjct: 79  SQRHLTMIAIGGTLGTGLFIGIGWSLA-SGPGNLLIGFLLTGLAIFCVVQCAAELSCQY- 136

Query: 164 TLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLI 223
            + G F ++    VDP+  F++   YC+ W    P EL+  +MTI YW + VN  ++V+I
Sbjct: 137 PVSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNPVVWVII 196

Query: 224 FYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGN-DGFIGGKYWR 282
           F++ ++A+N+FG  RG+AETE++ +  KIL +I F I+G+V+ICGG  N +G+IG KYW 
Sbjct: 197 FWLFIMALNLFG-VRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNGYIGTKYWH 255

Query: 283 DPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 342
           DPG+F+       FK + +T V+AAFSFG TE + +TA+E S   ++I  AAK   +R +
Sbjct: 256 DPGSFKAP----VFKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESISRAAKGTFWRVI 310

Query: 343 LIYLASIIIVGLLVPYDSSELLGS-SSAATKASPYVLAVSTHGV--RVVPHFINAVILIS 399
           + Y+++++++G LVPY    LLG  +S    ASP+V+A++  G     V +F+NAVILI+
Sbjct: 311 VFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNFMNAVILIA 370

Query: 400 VFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKE 459
           V SV +S  Y++SR++ +L   G  P +  +VDR GRP  G LV  +   + F   S+K 
Sbjct: 371 VLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLPFIVASNKV 430

Query: 460 TEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVM 519
           +EVF+WL A+  +S +F W  IC S++R+R A+K Q RS DEI YKS +G+WG+    ++
Sbjct: 431 SEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAYLGLLL 490

Query: 520 MILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLF-IRAKDI 578
             L+++G+ +V + P+GE S   +AFF+  L++P+ I +Y+G+K +  +W+ F I    I
Sbjct: 491 SALLIVGEIYVSLFPLGE-SPSAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVIPLSGI 549

Query: 579 DLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           DL +     D EI++ E E  + KL + P++ R++ FWC
Sbjct: 550 DLDTGLSHSDVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  363 bits (931), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 213/608 (35%), Positives = 343/608 (56%), Gaps = 31/608 (5%)

Query: 16  DITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPIL 75
           +  K   KF   + +   S+  +     S++   R +N   SFK  E T         ++
Sbjct: 2   NFEKEPVKFAKTEAL---SSSVSLNTSESNSLMGRIKN---SFKRHELT---------LI 46

Query: 76  SHQSVFDDAKVEISQVDDEL-NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGP 134
           S     +D   E  ++   L ++  +K +  RH+ M++                 A +GP
Sbjct: 47  SEDQEINDVP-EQERIQRRLASQPYQKVLDQRHLTMIAIGGTLGTGLFIGLGYSLA-SGP 104

Query: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194
             L+IG+ ++ + ++C++Q+  E++  Y  + G +  +    VD ++ F+++  Y + W 
Sbjct: 105 GALLIGFLLVGTSMFCVVQSAAELSCQY-PVSGSYATHVSRFVDESVGFTVSTNYALAWL 163

Query: 195 CVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILM 254
              P EL+  S+TI YW   VN  ++V IFYI ++ +N+FG  RG+AETEF  +  K+L 
Sbjct: 164 ISFPSELIGCSITITYWNQSVNPAVWVAIFYIFIMGLNLFG-VRGFAETEFFLSIIKVLA 222

Query: 255 MIGFFILGIVIICGGA-GNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQT 313
           +I F I+GIV+I GG   + G+IG KYW  PG+F        FK + +T V+AAFSFG +
Sbjct: 223 IIIFIIIGIVLIAGGGPDSSGYIGTKYWHQPGSF----AQPVFKNLCNTFVSAAFSFGGS 278

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATK 372
           E + +T++E  N   +I  AAK   +R  + Y+ +++I+G LVPY    LL GSSS    
Sbjct: 279 ELVLLTSTEARNV-SSIARAAKGTFWRIAVFYITTVVIIGCLVPYTDERLLNGSSSEDVS 337

Query: 373 ASPYVLAVSTHGVR--VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTF 430
           ASP+V+A+S  G     V +F+N +ILI+V SV +S  Y+SSR++  L   G  PK  +F
Sbjct: 338 ASPFVIALSNSGSMGGKVANFMNVIILIAVLSVCNSCVYASSRIIQALGAAGQLPKACSF 397

Query: 431 VDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRR 490
           +D+ GRP +G  +  V  ++ F     KE EVF WL A+  +S  FTW  ICLS +RFR 
Sbjct: 398 IDKKGRPLVGIAISGVFGLLGFLVACDKEGEVFTWLFALCSISSFFTWFCICLSQVRFRM 457

Query: 491 AMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYL 550
           A++ QGR   +I YKS +GV+G     V+  L++ G+ +V   PVG G +  + FF+  L
Sbjct: 458 ALRAQGRPKSDIAYKSMLGVYGGIVGCVLNFLLIAGEIYVASSPVG-GESSARGFFEYCL 516

Query: 551 AMPVFIVLYLGYKIWKRDW-RLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVW 609
           ++P+ IV+Y G++ ++ DW   +I+ ++IDL +   I + E+ RQ+RE+ QEK+ + P +
Sbjct: 517 SIPIMIVVYFGHRFYRNDWGNWYIKRRNIDLDTGCSIENVELFRQQREQEQEKISSRPFY 576

Query: 610 RRVYDFWC 617
            R+Y FWC
Sbjct: 577 YRIYRFWC 584

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  360 bits (924), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/499 (38%), Positives = 302/499 (60%), Gaps = 42/499 (8%)

Query: 51  FRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVM 110
           F   IDSFKPPE                  FD              + LK++++ RH++M
Sbjct: 57  FHRCIDSFKPPE---------------NGSFDP-------------DSLKRSLKSRHLIM 88

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           ++                 A  GP  ++IG+ I  + +   I  +GE+ V +  +VG F 
Sbjct: 89  IAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRF-PVVGAFA 147

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
            Y    +DP+L+F ++ IY +QWF V PLE++ ++MTIQ+W T ++  ++V IFY+ ++A
Sbjct: 148 DYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIFYVTIVA 207

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS 290
           IN+FG  RG+ E EF+ +S K++ + GF IL IV+I GG     ++G +YW DPGA    
Sbjct: 208 INLFG-VRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPGAL--- 263

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
              + FKGV S  VTA++S G +E +A  AS +++P K +PSA K+V +R +  +L S+ 
Sbjct: 264 --AHGFKGVASVFVTASYSLGGSE-MACLASGETDP-KELPSAIKQVFWRIIFFFLVSLT 319

Query: 351 IVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYS 410
           +VG LVPY +  LLG SS     SP+V+A + + ++V+P  INAVIL+S+ SV +S  ++
Sbjct: 320 LVGFLVPYTNQNLLGGSS--VNNSPFVIACNLYHIKVLPSIINAVILVSIMSVGNSCIFA 377

Query: 411 SSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAIS 470
           SSR L ++A QG  P++F +VDR GRP +G +  ++  ++AF   SS  +EVFNWL+AI+
Sbjct: 378 SSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIA 437

Query: 471 GLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWV 530
           GL+    W  I +SHIRFR AMK Q +++DE+ + S VG+WGS Y+ V+ +LI+I Q ++
Sbjct: 438 GLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVNVLILIAQFYI 497

Query: 531 GIVPVG---EGSADVQAFF 546
            + PVG   + ++ V+ FF
Sbjct: 498 SLWPVGGWTDSASRVKLFF 516

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  360 bits (924), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/608 (34%), Positives = 358/608 (58%), Gaps = 26/608 (4%)

Query: 16  DITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPIL 75
           +I  SS +F  V+  +  + E +     + +  + F  F DSF          T ++ I 
Sbjct: 17  NIRSSSKEFVKVEE-EAFTEESSASYTRNYSEGTFFERFKDSF----------TRVDNIE 65

Query: 76  SHQSVFDDAKVEISQVDDELN-EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGP 134
            +  +  D   +  Q+   L  +  KK++  RH+ M++                 A +GP
Sbjct: 66  PYSELDGDKYTKDEQIQMTLAAQPYKKSLHQRHLTMIAIGGTLGTGLFIGLGYSLA-SGP 124

Query: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194
           A L+IG+ I+ + ++C++Q+  E++  Y  + G +  +    +D +L F+++  Y + W 
Sbjct: 125 ASLLIGFLIVGTSMFCVVQSAAELSCQY-PVSGSYATHVSRFLDESLGFTVSTNYALAWL 183

Query: 195 CVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILM 254
              P EL+  SMTI YW   +N  +++ IFY+ ++ +N+FG  +G+AETEF  +  K++ 
Sbjct: 184 ISFPSELIGISMTISYWNDSINPCVWIAIFYVFIMILNLFG-VKGFAETEFWLSLIKVIA 242

Query: 255 MIGFFILGIVIICGGA-GNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQT 313
           +I F I+GIV+ICGG   + G+IG KYW DPG+F     P  FKG+ +T V+AAFSFG +
Sbjct: 243 IIIFIIVGIVLICGGGPESSGYIGTKYWHDPGSF----APPVFKGLCNTFVSAAFSFGGS 298

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAA-TK 372
           E + +TA+E  N   AI  AAK   +R  + Y+A+++I+G LVPY+   LLG +S     
Sbjct: 299 ELVLLTAAESKNI-SAISRAAKGTFWRIAVFYIATVVIIGCLVPYNDRRLLGGASDEDVS 357

Query: 373 ASPYVLAV--STHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTF 430
           ASP+VLA+  ST   R + +F+N VILI+V SVA+S  Y+SSR++  L   G  P +  +
Sbjct: 358 ASPFVLALGSSTDLGRKLSNFMNFVILIAVVSVANSCVYASSRVIQALGSSGQLPSICGY 417

Query: 431 VDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRR 490
           +D++GRP +G  +  V  ++ F   SS E  VF WL A+  +S  FTW  IC S +RFR 
Sbjct: 418 IDKSGRPLVGIAICGVFGLLGFLVASSNERTVFTWLFALCSISSFFTWFCICFSQVRFRL 477

Query: 491 AMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYL 550
           A+K Q RS D+I +KS +G++G     ++ IL+++G+ +V   P+GE S+  +AFF++ L
Sbjct: 478 ALKKQNRSTDDIAFKSMLGIYGGILGSILNILLIMGEIYVSASPLGEPSS-AEAFFENCL 536

Query: 551 AMPVFIVLYLGYKIWKRDWRLFIRAKD-IDLISHRHIHDPEILRQEREEYQEKLRNGPVW 609
           ++P+ +++++ ++ ++++WR + ++ D IDL +     D E+ + +RE+ + K+++ P++
Sbjct: 537 SIPLMLLVFIAHRFYRKNWRDWYKSLDEIDLDTGCSYDDIELFKHQREQIKHKIQSKPLY 596

Query: 610 RRVYDFWC 617
            ++Y FWC
Sbjct: 597 YKIYRFWC 604

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  358 bits (918), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/581 (36%), Positives = 331/581 (56%), Gaps = 38/581 (6%)

Query: 49  SRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDE-------LNEKLKK 101
           S  + F DSFK  E          PIL          V++SQ++D         ++  K+
Sbjct: 32  SALKRFRDSFKKHE----------PILPEN-------VDLSQMEDYERTNYLLAHQPYKR 74

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
           T+  RH+ M+S                   +GP  L+IG+ I+   I+C++Q   E++  
Sbjct: 75  TLSQRHLTMISIGGTLGTGLFIGLGYSLT-SGPGNLLIGFTIIGISIFCVVQCAAELSCQ 133

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFV 221
           Y  + G F  +    +D ++ F+++  Y + W    P EL+  ++T++YW   VN  +++
Sbjct: 134 Y-PVSGSFATHVSRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYWNDSVNPAVWI 192

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA-GNDGFIGGKY 280
            IFY+ ++ +N+FG  RG+AETEF  +  KI  ++ F I+GIV+ICGG   ++G+IG KY
Sbjct: 193 AIFYVFIMCLNLFG-VRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGAKY 251

Query: 281 WRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYR 340
           W DPGAF        FKG+ +T V+AAFSFG  E + +TA+E S   ++I  AAK   +R
Sbjct: 252 WHDPGAFV----KPVFKGLCNTFVSAAFSFGGAELVVLTANE-SRKIESISRAAKGTFWR 306

Query: 341 ALLIYLASIIIVGLLVPYDSSELLGSSSAA-TKASPYVLAVSTHGV--RVVPHFINAVIL 397
             + Y+ +++I+G LVP     LLG++S     ASP+V+A+S  G     V HF+NAVIL
Sbjct: 307 IAVFYITTVVIIGCLVPSTDERLLGAASDVDVTASPFVIALSNTGSFGDKVSHFMNAVIL 366

Query: 398 ISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSS 457
           I+V SV +S  Y++SR++ +L      P    ++DR GRP +G  +  V  ++ F   SS
Sbjct: 367 IAVLSVCNSCVYAASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFGLLGFLVASS 426

Query: 458 KETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAF 517
           KE EVF WL A+  +S  FTW  IC S +RFR A++ QGRS DEI YKS +G WG     
Sbjct: 427 KEGEVFTWLFALCSISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGC 486

Query: 518 VMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR-LFIRAK 576
           V+ IL++ G+ +V + P+G GS + + FFQ  L++P+ I +Y  ++I++ +W    I  K
Sbjct: 487 VLNILLIAGEIYVSLFPLG-GSPNAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTK 545

Query: 577 DIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            IDL + R   D E+++ E    + ++ + P++ R+Y FWC
Sbjct: 546 KIDLDTGRKAEDLELMKHEILTEKARIASKPLYYRIYRFWC 586

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  354 bits (908), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/578 (35%), Positives = 333/578 (57%), Gaps = 19/578 (3%)

Query: 45  STTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQ 104
           ST  +   N I  FK     +  + + +P +    ++ +   E     D  N+  KK + 
Sbjct: 20  STPSNEGNNLIHRFK-----NSFKRNDSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLD 74

Query: 105 PRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLT 164
            RH+ M++                 A +GPA L+IG+ ++ + + C++Q   E++  Y  
Sbjct: 75  QRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQY-P 132

Query: 165 LVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIF 224
           + G +  +    +DP++ FSI   Y + W    P ELV  S+TI YW   VN   +V I 
Sbjct: 133 VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIA 192

Query: 225 YILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND-GFIGGKYWRD 283
           ++L + +N+FG ARG+AE+EF  +  KI+ +  F I+GIV+I GG  +  G+IG KYW D
Sbjct: 193 FVLSMLLNLFG-ARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKYWHD 251

Query: 284 PGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALL 343
           PG+F        FK + +T V+AA+SF  TE + +T++E +    ++  AAK   +R ++
Sbjct: 252 PGSF----AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSVSSVSRAAKGTFWRIII 306

Query: 344 IYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGV--RVVPHFINAVILISV 400
            Y+ ++II+G LVPY+   L+ GSSS    ASP+V+A+S  G     V HF+NAVILI+V
Sbjct: 307 FYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAV 366

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
           FSV +S  Y+SSR++  LA  G  PK+  ++DR GRP +G  +     ++ F   S  + 
Sbjct: 367 FSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQG 426

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
            VF WL A+  +S   TW  IC   +RFR AMK QGRS D+I Y+S +G++G  +  ++ 
Sbjct: 427 TVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILN 486

Query: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR-LFIRAKDID 579
           +L++IG+ +V   PVG  S+    FF+  +++P+ I +Y+G++I++RDWR  +I+  DID
Sbjct: 487 VLLVIGEIYVSAAPVGSPSSAAN-FFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDID 545

Query: 580 LISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           L S   + D E  + ER+E ++ + + P++ R+Y F+C
Sbjct: 546 LDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC 583

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  352 bits (904), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 213/603 (35%), Positives = 349/603 (57%), Gaps = 25/603 (4%)

Query: 20  SSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQS 79
           SS    +V  I  DS +   E  +S      +R F DSFK  +    I+ D +   + + 
Sbjct: 3   SSVVNKEVSKIYTDSVKTGSEFSSSEKGTFLYR-FRDSFKRVDLDATIDEDDSKYTAEEK 61

Query: 80  VFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
           V    ++ +++      + LKK +  RH+ M++                 A +GP  L+I
Sbjct: 62  V----QLRLAK------QPLKKALMQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPGCLLI 110

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPL 199
           G+ ++   ++C++Q+  E++  Y  + G +  +    +D ++ F+++  Y + W    P 
Sbjct: 111 GFILVGLSMFCVVQSAAELSCQY-PVSGSYATHVTRFIDESIGFTVSTNYALAWLISFPS 169

Query: 200 ELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
           EL+ ++M IQYW   V+  +++ IFY+ V+ +N+FG   G+AETEF  +  KIL +I F 
Sbjct: 170 ELMGSAMVIQYWNDSVDPAVWIAIFYLFVMFLNLFG-VEGFAETEFWLSIIKILAIIIFI 228

Query: 260 ILGIVIICGGA-GNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318
           I+GIV+ICGG  G+ G+IG KYW +PG+F        FK + +T V+AAFSFG  E + +
Sbjct: 229 IIGIVLICGGGPGSSGYIGTKYWHNPGSF----AHPVFKSLCNTFVSAAFSFGGAELVLL 284

Query: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAA-TKASPYV 377
           TA+E S    AI  AAK   +R  + Y+ +++I+G LVPY    LLG+SS     ASP+V
Sbjct: 285 TAAE-SKKISAISRAAKGTFWRIAVFYITTVVIIGCLVPYTDERLLGASSDEDVTASPFV 343

Query: 378 LAVSTHGV--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTG 435
           +A++  G     V +F+N +IL++V SV +S  Y+SSR++  L   G  P++  ++D+ G
Sbjct: 344 IALTNAGSMGSSVANFMNVIILVAVISVCNSCVYASSRVIQALGSAGQLPRICGYIDKKG 403

Query: 436 RPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQ 495
           RP +G ++  +  ++AF    S+E  VF WL A+  +S  FTW  IC S +R+R A+K Q
Sbjct: 404 RPLVGIVICGIFGLLAFLIDCSEEGTVFTWLFALCSISSFFTWFCICFSQVRYRIALKKQ 463

Query: 496 GRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVF 555
            RS DEI YKS +G++G     ++ IL+++G+ +V I P+ E S    AFF++ L++P+ 
Sbjct: 464 NRSNDEIAYKSMLGIYGGILGSLLNILLIMGELYVSISPLDE-SPSASAFFENCLSIPIM 522

Query: 556 IVLYLGYKIWKRDWR-LFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYD 614
           IV+Y+ +K +K+ WR LFI  K IDL + R + +  + +Q+REE +  + + P + RVY 
Sbjct: 523 IVVYIFHKTYKKGWRSLFIPLKHIDLDTGRAVENLALFKQQREEQKIIIASKPFYYRVYR 582

Query: 615 FWC 617
           FWC
Sbjct: 583 FWC 585

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  350 bits (899), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/578 (35%), Positives = 336/578 (58%), Gaps = 19/578 (3%)

Query: 45  STTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQ 104
           STT +   N I  FK     +      + +L +  + ++ K++     D  N+  KK + 
Sbjct: 20  STTSNDGNNLIHRFKNSFKRNDSSAIQDGLL-YSELTEEEKIQW----DLANQPYKKVLS 74

Query: 105 PRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLT 164
            RH+ M++                 A +GPA L+IG+ ++ + + C++Q   E++  Y  
Sbjct: 75  QRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQY-P 132

Query: 165 LVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIF 224
           + G +  +    +DP++ FSI   Y + W    P ELV  S+TI YW   VN   +V I 
Sbjct: 133 VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIA 192

Query: 225 YILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND-GFIGGKYWRD 283
           ++L + +N+FG ARG+AE+EF  +  KI+ +  F I+GI++I GG  +  G+IG KYW D
Sbjct: 193 FVLSMLLNMFG-ARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPDSTGYIGTKYWHD 251

Query: 284 PGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALL 343
           PG+F     P  FK + +T V+AA+SF  TE + +T++E  N   ++  AAK   +R ++
Sbjct: 252 PGSF----APPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARNV-SSVSRAAKGTFWRIVI 306

Query: 344 IYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGV--RVVPHFINAVILISV 400
            Y+ ++II+G LVPY+ S L+ GSSS    ASP+V+A+S  G   + V HF+NAVILI+V
Sbjct: 307 FYIVTVIIIGCLVPYNDSRLINGSSSEDITASPFVIALSNTGTMGKRVSHFMNAVILIAV 366

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
           FSV +S  Y+SSR++  LA  G  P++  ++DR GRP +G  +     ++ F   S  + 
Sbjct: 367 FSVCNSCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQG 426

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
            VF WL A+  +S   TW  IC   +RFR AMK QGRS D+I Y+S +G++G     ++ 
Sbjct: 427 TVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGIVGCILN 486

Query: 521 ILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR-LFIRAKDID 579
           +L++IG+ +V   PVG  S+    FF+  +++P+ I +Y+G++I+++DWR  +I+ +DID
Sbjct: 487 VLLVIGEIYVSAAPVGSPSSAAN-FFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKRRDID 545

Query: 580 LISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           L S   + D E  + ER+  +  + + P++ R+Y F+C
Sbjct: 546 LDSGHSLEDFEATKLERDHDKRYVASRPLYYRIYRFFC 583

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/604 (32%), Positives = 345/604 (57%), Gaps = 31/604 (5%)

Query: 21  SAKF--NDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQ 78
           S KF  ND D + + +++ +          S  R++ DSFK  +       +M   L + 
Sbjct: 5   SDKFIKNDTDTLSVSASKEH------GAYSSAVRDWRDSFKRQDLL-----EMPDALEYN 53

Query: 79  SVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
            + +  K ++       ++  KK +  RH+ M+S                   +GPA L+
Sbjct: 54  DLTEREKTQLKLA----SQPYKKVLSQRHLTMISIGGTLGTGLFIGLGAALT-SGPAALL 108

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           IGY ++ + ++C+IQ+  E+A  +  + G ++++    VD ++ F++   Y + W  + P
Sbjct: 109 IGYLLVGASMFCVIQSASELACQF-PVTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFP 167

Query: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGF 258
            EL+  S+TI YW + +N  ++V IF + VL IN+FG  R +AETEF+ +  K+L ++ F
Sbjct: 168 SELIGCSLTISYWNSTINPAVWVAIFLVFVLWINLFG-VRLFAETEFVLSIIKVLAIVIF 226

Query: 259 FILGIVIICGGAGNDG-FIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLA 317
            I+GIV+I GG  + G +IG +YW DPG F        FK + +T V+AAFS+G +E + 
Sbjct: 227 IIIGIVLIAGGGQDSGGYIGTRYWHDPGPF----AKPVFKNLCNTFVSAAFSYGGSEMVL 282

Query: 318 ITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPY 376
           +T +E  N   +I  AAK   YR  + Y+ +++++G LVPY+   LL  SSS    ASP+
Sbjct: 283 LTGTESKNI-SSIARAAKGTFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSEDISASPF 341

Query: 377 VLAVSTHGV--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRT 434
           V+A+   G     V +F+NA+IL+SV SV +S  Y+SSR++  L   G+ P +  ++D  
Sbjct: 342 VIALGNTGSMGSKVSNFMNAIILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMK 401

Query: 435 GRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKV 494
           GRP +G  +     ++ F   ++K++EVF WL A+  ++   TW  ICL+ +RFR AMK 
Sbjct: 402 GRPLVGIAITGAFGLLGFLVATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKA 461

Query: 495 QGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPV 554
           + RS + I Y+S +G++G     ++  L++ G+ +V   PV +G +  + FF+  L++P+
Sbjct: 462 RKRSKEHIAYRSMLGIYGGIAGCIVNFLLIAGEIYVSAWPV-DGKSSAEGFFEYDLSIPI 520

Query: 555 FIVLYLGYKIWKRDWR-LFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVY 613
            I+++LG+KI++ DW+  +++ +D+DL +   I + E+ + ++E  +E L   P++ R+Y
Sbjct: 521 MIIVFLGHKIYRNDWKNWYVKRRDMDLDTGCSIENLELFQSQKESEKEDLACKPLYYRIY 580

Query: 614 DFWC 617
            FWC
Sbjct: 581 RFWC 584

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/609 (34%), Positives = 346/609 (56%), Gaps = 30/609 (4%)

Query: 16  DITKSSAKFNDVDVIDIDSAERNYELPTSST-THSRFRNFIDSFKPPETTHHIETDMNPI 74
           DI K   + +    I+ +S      +P  S  + S  R   DSFK     H I  D+   
Sbjct: 2   DILKRGNESDKFTKIETESTT----IPNDSDRSGSLIRRMKDSFKQ-SNLHVIPEDLE-- 54

Query: 75  LSHQSVFDDAKVEISQVDDEL-NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAG 133
                  +  + E  ++  +L ++  +K +  RH+ M++                 A +G
Sbjct: 55  -------NSEQTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SG 106

Query: 134 PAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQW 193
           PA L+IG+ ++ + ++C++Q+  E++  +  + G +  +    +D ++ F++A  Y + W
Sbjct: 107 PAALLIGFLLVGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAW 165

Query: 194 FCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKIL 253
               P EL+  ++TI YW   VN  ++V IFY+ ++ +N+FG  RG+AETEF  +  K++
Sbjct: 166 LISFPSELIGCALTISYWNQTVNPAVWVAIFYVFIMVLNLFG-VRGFAETEFALSIIKVI 224

Query: 254 MMIGFFILGIVIICGGAGND-GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQ 312
            +  F I+GIV+I GG  N  G+IG KYW DPGAF        FK + +T V+AAFSFG 
Sbjct: 225 AIFIFIIIGIVLIAGGGPNSTGYIGAKYWHDPGAF----AKPVFKNLCNTFVSAAFSFGG 280

Query: 313 TEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAAT 371
           +E + +T++E  N   AI  AAK   +R  + Y+ +++I+G LVPY+   LL GS+S   
Sbjct: 281 SELVLLTSTESKNI-SAISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDV 339

Query: 372 KASPYVLAVSTHGVR--VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFT 429
            ASP+V+A+S  G     V +F+N VIL++V SV +S  Y+SSR++  L   G  P V +
Sbjct: 340 SASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCS 399

Query: 430 FVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFR 489
           ++DR GRP +G  +     ++ F   S KE EVF WL A+  +S  FTW  IC+S IRFR
Sbjct: 400 YMDRKGRPLVGIGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFR 459

Query: 490 RAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDY 549
            A+K QGRS DEI YKS +GV+G     V+  L++ G+ +V   PVG  S+  +AFF+  
Sbjct: 460 MALKAQGRSNDEIAYKSILGVYGGILGCVLNALLIAGEIYVSAAPVGSPSS-AEAFFEYC 518

Query: 550 LAMPVFIVLYLGYKIWKRDWRLF-IRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPV 608
           L++P+ IV+Y  ++ ++RDW+ F I+  +IDL +   + + E+ + ++E  ++ + + P 
Sbjct: 519 LSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPF 578

Query: 609 WRRVYDFWC 617
           + ++Y FWC
Sbjct: 579 YYKIYRFWC 587

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/608 (34%), Positives = 347/608 (57%), Gaps = 25/608 (4%)

Query: 16  DITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPIL 75
           DI K   + +    I+ +S      L  S  + S  R   DSFK     H I  D+    
Sbjct: 2   DILKKGNESDKFTKIETESTMIPTGLERSDKSESLIRRMKDSFKQ-SNLHVIPEDLE--- 57

Query: 76  SHQSVFDDAKVEISQVDDEL-NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGP 134
                 +  + E  ++  +L ++  +K +  RH+ M++                 A +GP
Sbjct: 58  ------NSEQTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SGP 110

Query: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194
           A L+IG+ I+ + ++C++Q+  E++  +  + G +  +    +D ++ F++A  Y + W 
Sbjct: 111 AALLIGFLIVGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWL 169

Query: 195 CVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILM 254
              P EL+  S+TI YW   VN  ++V IFY  ++ +N+FG  +G+AETEF  +  K++ 
Sbjct: 170 ISFPSELIGCSLTISYWNQTVNPAVWVAIFYTFIMVLNLFG-VKGFAETEFALSIIKVVA 228

Query: 255 MIGFFILGIVIICGGAGND-GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQT 313
           +I F I+GIV+I GG  N  G+IG KYW +PGAF        FK + +T V+AAFSFG +
Sbjct: 229 IIIFIIIGIVLIAGGGPNSTGYIGTKYWHNPGAF----AKPVFKNLCNTFVSAAFSFGGS 284

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATK 372
           E + +T++E S    AI  AAK   +R  + Y+ +++I+G LVPY+ S LL GS+S    
Sbjct: 285 ELVLLTSTE-SKDISAISRAAKGTFWRIAIFYITTVVIIGCLVPYNDSRLLSGSTSEDIS 343

Query: 373 ASPYVLAVSTHGVR--VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTF 430
           ASP+V+A+   G     V +F+N VIL++V SV +S  Y+SSR++  L   G  P V ++
Sbjct: 344 ASPFVIALRNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSY 403

Query: 431 VDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRR 490
           +DR GRP +G  +     ++ F   S+KE EVF WL A+  +S  FTW  ICLS +RFR 
Sbjct: 404 MDRKGRPLVGIGISGAFGLLGFLVASNKEDEVFTWLFALCSISSFFTWFCICLSQVRFRM 463

Query: 491 AMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYL 550
           A+K QGRS DEI YKS +GV+G     V+  L++ G+ +V   PVG  S+  +AFF+  L
Sbjct: 464 ALKTQGRSKDEIAYKSILGVYGGVLGCVLNALLIAGEVYVSAAPVGSPSS-AKAFFEYCL 522

Query: 551 AMPVFIVLYLGYKIWKRDWRL-FIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVW 609
           ++P+ IV+Y+ ++I+++D R  +I+  +IDL +   + + E+ + ++E  ++ + + P +
Sbjct: 523 SIPIMIVVYIAHRIYRKDRRRWYIKRSEIDLDTGCSVENLELFKAQKEAEKQLIASKPFY 582

Query: 610 RRVYDFWC 617
            ++Y FWC
Sbjct: 583 YKIYRFWC 590

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/596 (34%), Positives = 341/596 (57%), Gaps = 34/596 (5%)

Query: 37  RNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDE-- 94
           R +   TS +  +RF+      K     H    D+      Q   +   V++S + +E  
Sbjct: 20  RTWNGETSGSLINRFKQ-----KSRRQIH----DIAHSFQRQEAPNSEGVDLSLLSEEQR 70

Query: 95  -----LNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIY 149
                 N+  +K++  RH++M+S                 A +GP  L+IG+ I+   ++
Sbjct: 71  RNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSLA-SGPGSLLIGFLIVGLMMF 129

Query: 150 CIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQ 209
           C++Q+  EMA  Y  + G F+ +    ++P++ F+++  Y + W    P EL+  ++T++
Sbjct: 130 CVVQSAAEMACQY-PVSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLR 188

Query: 210 YWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGG 269
           YW++ VN  ++V IFY+ ++ +N+FG  RGY E EF  +  K++ ++ F I+GIV+ICGG
Sbjct: 189 YWSS-VNGAVWVAIFYVFIMQLNLFG-VRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGG 246

Query: 270 A-GNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
              + G+IG KYW +PG+F        FKG+ +T ++AAFSFG  E + +TASE S   +
Sbjct: 247 GPHSSGYIGTKYWHNPGSF----AKPVFKGLCNTFISAAFSFGGAELVVLTASE-SKKVE 301

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAAT-KASPYVLAVSTHGV-- 385
           ++  AAK   +R  + Y+ +++++G LVPY    LLG  +     ASP+V+A+S  G   
Sbjct: 302 SVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMG 361

Query: 386 RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGA 445
             V HF+NAVILI+V SV +S  Y+SSR++  L   G  P+   ++D+ GRP +G  +  
Sbjct: 362 TKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICG 421

Query: 446 VIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYK 505
           V  ++ F     K+ +VF WL A+  +S  FTW  IC+S +RFR A++ QGRS DEI +K
Sbjct: 422 VFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHK 481

Query: 506 SQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW 565
           S +G++G     V+ IL++ G+ +V I P+G GS   + FFQ  +++P+ IV+Y  +K +
Sbjct: 482 SMLGIYGGILGGVLNILLIAGEIYVSIFPLG-GSPSAEQFFQYCMSIPIMIVVYALHKTY 540

Query: 566 K---RDW-RLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           K   RD  R+ +   +IDL S R I D E+ + E EE + ++   P++ R+Y FWC
Sbjct: 541 KATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAKPLYYRIYRFWC 596

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  342 bits (878), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/594 (34%), Positives = 339/594 (57%), Gaps = 26/594 (4%)

Query: 32  IDSAERNYELPTSST---THSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEI 88
           ++  E + EL  S++   + S FR F++SFK  +    + +D    L +  + ++ KV+ 
Sbjct: 12  VEIRESDVELIASASATGSRSHFREFMESFKR-DGAVTVPSD----LEYDELTEEEKVQW 66

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
               D   +  KK +  RH+ M++                 A +GP  L+IG+ ++   +
Sbjct: 67  ----DLATQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGLSLA-SGPGSLLIGFMLVGISM 121

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
            C++Q   E++  Y  + G +  +    +DP++ FS+   Y + W    P ELV  S+T+
Sbjct: 122 LCVVQCGAELSCQY-PVSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSLTL 180

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
            YW   VN  ++V IF++ V+ +N+FG  RG+AETEF  +  K++ +  F I+GIV+I G
Sbjct: 181 SYWNNSVNPAVWVAIFFVFVMLLNLFG-VRGFAETEFYMSIFKVISLFVFIIIGIVLITG 239

Query: 269 GA-GNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPR 327
           G  GN G+IG KYW+DPG+F        FK   +T V+AA+SF  TE + +T++E  +  
Sbjct: 240 GGPGNTGYIGTKYWQDPGSF----ATPAFKNFCNTFVSAAYSFSGTEMVVLTSTEVRDI- 294

Query: 328 KAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGV- 385
            +I  AAK   +R  L Y+ +++I+G LVPY+   LL G++S    ASP+V+A+S  G  
Sbjct: 295 SSISRAAKGTFWRIALFYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALSNTGSM 354

Query: 386 -RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVG 444
                +F+N VIL++V SV +   Y+SSR++  LA  G  P +  ++DR GRP +G  + 
Sbjct: 355 GSKAANFMNVVILVAVVSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLVGIAIT 414

Query: 445 AVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGY 504
            V  ++ F   S  ++ VF WL A+  +S   TW  IC   IRFR AMK Q RS D+I Y
Sbjct: 415 GVFGLLGFLVASKDQSTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSADDIVY 474

Query: 505 KSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKI 564
            S +G++G     V+ +L++ G+ +V   PVG+ S+  + FFQ  +++P+ IV+YLG++I
Sbjct: 475 ISPLGIYGGVLGCVLNVLLVAGEIYVSAFPVGQPSS-AENFFQYCMSIPIMIVVYLGHRI 533

Query: 565 WKRDW-RLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           +++DW   +I+AKDID  S   + + + ++  +E+ +  + + P + +VY F+C
Sbjct: 534 YRKDWSHWYIKAKDIDRDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  335 bits (860), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/510 (36%), Positives = 284/510 (55%), Gaps = 46/510 (9%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           S  E+Y      KSS  F++    + D   R       ST  +  +  +DSFKPPE    
Sbjct: 16  SHLEAYASGQEIKSS-DFSEKTTPENDGVRRR------STNRNVLQRMVDSFKPPE---- 64

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
                           D            ++ LKK+++ RH+VM++              
Sbjct: 65  ----------------DGSFH--------SDNLKKSLKARHLVMIAIGGSIGTGLFIGSG 100

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
              A  GP  L+IG+ I  + +   I  +GE+ V +  +VG F  Y    ++P+++F + 
Sbjct: 101 KALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVV 159

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
            IY +QW  V PLE++ A+MT++YW T V+  ++V IFY ++  IN+ G  RG+ E EF+
Sbjct: 160 LIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVG-VRGFGEAEFV 218

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTA 306
            +  K++ ++GF IL IV+ICGG     F+G KYW DPG        N FKGV   LV A
Sbjct: 219 FSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPL-----ANGFKGVAGVLVIA 273

Query: 307 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS 366
           ++S G TE +A  AS +++P K +PSA K+V +R +  +L S+ +VG LVPY +  L+G 
Sbjct: 274 SYSLGGTE-MACLASGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGG 331

Query: 367 SSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPK 426
           SS     SP+V+A+  HG+  +P  +NAVIL+S+ SV +S  ++SSR L ++A QG  P+
Sbjct: 332 SS--VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPR 389

Query: 427 VFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHI 486
           VF ++DR GRP  G L   +  ++AF   S    +VF WL+AI+GL+    W  I +SHI
Sbjct: 390 VFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHI 449

Query: 487 RFRRAMKVQGRSIDEIGYKSQVGVWGSAYA 516
           RFR AMK QG  ++E+ + S VG++GS Y+
Sbjct: 450 RFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/604 (33%), Positives = 339/604 (56%), Gaps = 35/604 (5%)

Query: 30  IDIDSAERNYELPTSSTT----------HSRFRNFIDSFKPPETTHHIETDMNPILSHQS 79
           +D    ++N +L T++T            S  +   DSFK        ++++ PI    S
Sbjct: 1   MDYGDDDKNGKLQTTNTLTQIESQQDDFSSPLKRLKDSFK--------QSELAPI-DEDS 51

Query: 80  VFDDAKVEISQVDDEL-NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
            FD    E  ++  +L ++  +K +  RH+ M++                 A  GP  L+
Sbjct: 52  GFDGLS-EKEKIQLKLASQPYEKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-CGPGALL 109

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           IG+ ++ + I+C++Q+  E++  +  + G +  +    +D ++ F++A  Y + W    P
Sbjct: 110 IGFLLVGTSIFCVVQSAAELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLISFP 168

Query: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICN-SCKILMMIG 257
            EL+  S+TI YW    N  ++V IFY+ ++ +N+FG  RG+AE EF+ +    + ++I 
Sbjct: 169 SELIGCSLTISYWDQTTNPAVWVAIFYVFIMTLNLFG-VRGFAEVEFVLSVIKILAIIIF 227

Query: 258 FFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLA 317
             I  I+I  GG  + G+IG KYW DPG+F   + P  FK + +T V+AAFSFG +E + 
Sbjct: 228 IIIGIILIAGGGPDSKGYIGTKYWHDPGSF---NNP-VFKNLCNTFVSAAFSFGGSELVL 283

Query: 318 ITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAATKASPY 376
           +T S++S    AI  AAK   +R  + Y+ +++I+G LVPY    LL G S     ASP+
Sbjct: 284 LT-SKESKSVSAISRAAKGTFWRIAIFYITTVVIIGCLVPYTDDRLLNGRSDEDVTASPF 342

Query: 377 VLAVSTHGV--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRT 434
           V+A+S  G   + V  F+N VILI+V SV +S  Y++SR++  L   G  PK+  ++DR 
Sbjct: 343 VIALSNTGSMGKKVSDFMNVVILIAVVSVCNSCVYAASRVIQALGASGQLPKICGYIDRR 402

Query: 435 GRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKV 494
           GRP +G  +  +  ++ F   SS+E++VF WL A+  +S  FTW  IC S IRFR A+K 
Sbjct: 403 GRPLVGIAISGIFGLLGFLVASSEESKVFTWLFALCSISSFFTWFCICYSQIRFRMALKY 462

Query: 495 QGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPV 554
           QGRS D+I YKS +GV+G     ++ IL++ G+ +V   PVGE S   + FF+  L++P+
Sbjct: 463 QGRSTDQIAYKSMLGVYGGILGCILNILLIAGEIYVSASPVGEKST-AEGFFEYCLSIPI 521

Query: 555 FIVLYLGYKIWKRDW-RLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVY 613
            I +Y+ ++I+++DW   +I+  DIDL +   + + E+ +++REE +      P + ++Y
Sbjct: 522 MISVYVLHRIYRKDWTHWYIKRSDIDLDTGCSVENIELFKEQREEEKIYAATKPFYYKIY 581

Query: 614 DFWC 617
            F C
Sbjct: 582 RFLC 585

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  335 bits (860), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/510 (36%), Positives = 284/510 (55%), Gaps = 46/510 (9%)

Query: 7   SSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHH 66
           S  E+Y      KSS  F++    + D   R       ST  +  +  +DSFKPPE    
Sbjct: 16  SHLEAYASGQEIKSS-DFSEKTTPENDGVRRR------STNRNVLQRMVDSFKPPE---- 64

Query: 67  IETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
                           D            ++ LKK+++ RH+VM++              
Sbjct: 65  ----------------DGSFH--------SDNLKKSLKARHLVMIAIGGSIGTGLFIGSG 100

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
              A  GP  L+IG+ I  + +   I  +GE+ V +  +VG F  Y    ++P+++F + 
Sbjct: 101 KALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVV 159

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
            IY +QW  V PLE++ A+MT++YW T V+  ++V IFY ++  IN+ G  RG+ E EF+
Sbjct: 160 LIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVG-VRGFGEAEFV 218

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTA 306
            +  K++ ++GF IL IV+ICGG     F+G KYW DPG        N FKGV   LV A
Sbjct: 219 FSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPL-----ANGFKGVAGVLVIA 273

Query: 307 AFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS 366
           ++S G TE +A  AS +++P K +PSA K+V +R +  +L S+ +VG LVPY +  L+G 
Sbjct: 274 SYSLGGTE-MACLASGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGG 331

Query: 367 SSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPK 426
           SS     SP+V+A+  HG+  +P  +NAVIL+S+ SV +S  ++SSR L ++A QG  P+
Sbjct: 332 SS--VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPR 389

Query: 427 VFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHI 486
           VF ++DR GRP  G L   +  ++AF   S    +VF WL+AI+GL+    W  I +SHI
Sbjct: 390 VFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHI 449

Query: 487 RFRRAMKVQGRSIDEIGYKSQVGVWGSAYA 516
           RFR AMK QG  ++E+ + S VG++GS Y+
Sbjct: 450 RFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/492 (38%), Positives = 307/492 (62%), Gaps = 20/492 (4%)

Query: 131 HAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYC 190
            +GP  L+IG+ I+   I+C+IQ+  E++  Y  + G F+++    ++P+L F+++  Y 
Sbjct: 21  QSGPGTLLIGFLIVGVSIFCVIQSAAELSCQY-PVSGSFSSHVSRFIEPSLGFTVSCAYA 79

Query: 191 IQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSC 250
           + W    P ELV  +MTI YW   +   ++VLI Y+LV+ +N+F   RG+AE+EF  +  
Sbjct: 80  LSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVIGLNLFA-VRGFAESEFWLSII 138

Query: 251 KILMMIGFFILGIVIICGGAGN--DGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAF 308
           K+L +I F I+GIVIICGG  N  +G++GGKYW DPGAFR    P  F  +  T V+AAF
Sbjct: 139 KVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR----PPFFSSLCQTFVSAAF 194

Query: 309 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSS 368
           +FG  E + +TA+E S   ++I  AAK   +R  + Y++++I++G LVPY S  L G S 
Sbjct: 195 TFGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPALDGES- 252

Query: 369 AATKASPYVLAVSTHGV--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPK 426
              +ASP+V+A+S  G     V HF+NAVI+ +V SV +S  Y++SR++ +L   G  P+
Sbjct: 253 --IRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGACGQLPE 310

Query: 427 VFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHI 486
           +F ++D+ GRP +G  V AV  ++AF   ++K  +VFNWL A+  ++  F W  IC+S +
Sbjct: 311 IFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFCICVSQL 370

Query: 487 RFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFF 546
           R+RRA+KVQG   +EI Y+S +G W      ++  L++ G+ +V +        DV+ FF
Sbjct: 371 RYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSV-----KDGDVETFF 425

Query: 547 QDYLAMPVFIVLYLGYKIWKRDWRLF-IRAKDIDLISHRHIHDPEILRQEREEYQEKLRN 605
           Q+ +++P+ I+ Y  +++++RDW+ + I A+D+DL + R   D E+++ E    + ++ +
Sbjct: 426 QNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHELIVSRARIAS 485

Query: 606 GPVWRRVYDFWC 617
            P + R Y FWC
Sbjct: 486 SPWYYRAYRFWC 497

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/571 (35%), Positives = 327/571 (57%), Gaps = 23/571 (4%)

Query: 52  RNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMM 111
           R F +SFK  + +   E      L +  + ++ KV+     D  N+  KK +  RH+ M+
Sbjct: 31  RRFKNSFKRKDASVIQEG-----LLYSELSEEEKVQW----DLANQPYKKVLDQRHLTMI 81

Query: 112 SXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNA 171
           +                 A +GPA L+IG+ ++ + + C++Q   E++  Y  + G +  
Sbjct: 82  AIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQY-PVSGSYAL 139

Query: 172 YPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAI 231
           +    +DP+  FS+   Y + W    P ELV  S+T+ YW   VN  ++V I + L + +
Sbjct: 140 HASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFTLSMLL 199

Query: 232 NIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA-GNDGFIGGKYWRDPGAFRGS 290
           N+FG ARG+AE+EF  +  KI+ +  F I+GI++I GG   + G+IG KYW DPG+F   
Sbjct: 200 NLFG-ARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSF--- 255

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
             P  FK   +T V+AA+SF  TE + +T++E  +   ++  AAK   +R  + Y+ ++I
Sbjct: 256 -APPAFKNFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRAAKGTFWRIAVFYIVTVI 313

Query: 351 IVGLLVPYDSSELL-GSSSAATKASPYVLAVSTHGV--RVVPHFINAVILISVFSVADSA 407
           I+G LVPY+   L+ GSSS    ASP+V+A+S  G     V  F+NAVILI+VFSV +S 
Sbjct: 314 IIGCLVPYNDPRLINGSSSEDITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSC 373

Query: 408 FYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLL 467
            Y+SSR++  LA  G  PK+  ++DR GRP +G  +     ++ F   S  +  VF WL 
Sbjct: 374 VYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLF 433

Query: 468 AISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQ 527
           A+  +S   TW  IC   IRFR AMK QG+  D+I YKS +G++G      + +L++IG+
Sbjct: 434 ALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGE 493

Query: 528 CWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR-LFIRAKDIDLISHRHI 586
            +V   PVG  S+    FF+  +++P+ I +Y+G++I++RDWR  +I+ +DIDL S   +
Sbjct: 494 IYVSAAPVGMPSSAAN-FFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSL 552

Query: 587 HDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
            D E  +  R++ +E + + P++ R+Y F+C
Sbjct: 553 EDLEATKLRRDQEKEYVASRPLYYRLYRFFC 583

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/593 (33%), Positives = 345/593 (58%), Gaps = 30/593 (5%)

Query: 16  DITKSSAKFNDVDVIDIDSAERNYELPTSST-THSRFRNFIDSFKPPETTHHIETDMNPI 74
           DI K+  + +    I+ +SA     +P  S  + S  R   DSFK        ++++N I
Sbjct: 2   DIQKTENESDKFTKIETESAT----IPGGSDHSGSLMRRMKDSFK--------QSNLNVI 49

Query: 75  LSHQSVFDDAKVEISQVDDEL-NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAG 133
              + + +  + E  ++  +L ++  +K ++ RH+ M++                 A +G
Sbjct: 50  --TEDLENSEQSEQEKIQWKLASQPYQKVLKQRHLTMIAIGGTLGTGLFIGLGYSLA-SG 106

Query: 134 PAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQW 193
           PA L+IG+ ++ + ++C++Q+  E++  +  + G +  +    +D ++ F++A  Y + W
Sbjct: 107 PAALLIGFLLVGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSW 165

Query: 194 FCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKIL 253
               P EL+  S+TI YW   VN  ++V IFY+ ++ +N+FG  +G+AETEF  +  K++
Sbjct: 166 LISFPSELIGCSLTISYWNQTVNPAVWVAIFYVFIMCLNLFG-VKGFAETEFALSIIKVI 224

Query: 254 MMIGFFILGIVIICGGAGND-GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQ 312
            +  F I+GIV+I GG  N  G+IG +YW +PG+F        FK + +T V+AAFSFG 
Sbjct: 225 SIFIFIIIGIVLIAGGGPNSTGYIGTRYWHNPGSF----AKPVFKNLCNTFVSAAFSFGG 280

Query: 313 TEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL-GSSSAAT 371
           +E + +T++E  N   +I  AAK   +R  + Y+ +++I+G LVPY+   LL GS+S   
Sbjct: 281 SELVLLTSTESKNI-SSISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLNGSTSEDI 339

Query: 372 KASPYVLAVSTHGV--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFT 429
            ASP+V+A+S  G     V +F+N VIL++V SV +S  Y+SSR++  L   G  P++  
Sbjct: 340 SASPFVIALSNTGSMGTRVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPEICA 399

Query: 430 FVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFR 489
           ++DR GRP +G  +  +  ++ F   S+KE EVF WL A+  +S  FTW  IC+S +RFR
Sbjct: 400 YMDRKGRPLVGIGISGIFGLLGFLVASNKEGEVFTWLFALCSISSFFTWFCICMSQVRFR 459

Query: 490 RAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDY 549
            A+K QGRS +EI YKS +GV+G     V+  L++ G+ +V   PVG G++  + FF+  
Sbjct: 460 MALKAQGRSKNEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSAAPVG-GTSTAKGFFEYC 518

Query: 550 LAMPVFIVLYLGYKIWKRDWR-LFIRAKDIDLISHRHIHDPEILRQEREEYQE 601
           L++P+ IV+Y+ ++I++ DW+  +I+   IDL +   + + E+  ++++  +E
Sbjct: 519 LSIPIMIVVYISHRIYRGDWKNWYIKKSKIDLDTGCSVENLELFNEQKQAEKE 571

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/546 (33%), Positives = 298/546 (54%), Gaps = 24/546 (4%)

Query: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXX 127
           E D + ++   S+ +DA V +  +      ++K+ ++PRH+ M++               
Sbjct: 12  EKDGSHLIIKPSIAEDA-VSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISIST 70

Query: 128 XXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187
             ++AGP G +I Y  + +  Y + Q++GEMA  ++ +   F  +    + PAL  +  +
Sbjct: 71  PLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGY 129

Query: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247
           +Y + W     LEL      IQ+WT  V    ++ IF++++   N+F   + Y E EF  
Sbjct: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP-VKYYGEVEFWI 188

Query: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RFKG 298
              K+L ++GF I   +++CG AG  G +G +YWR+PG +    GP          RF G
Sbjct: 189 ACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW----GPGIISKDVNEGRFLG 243

Query: 299 VVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPY 358
            VS+L++AAF++  TE + ITA E +NPRK +P A  KV +R L  Y+ S++ +GLLVP+
Sbjct: 244 WVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPF 303

Query: 359 DSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTL 418
           +  +L  S  +   +SP+V+A+   G +V+PH  NAVIL ++ S  +S  Y  SR+  ++
Sbjct: 304 NDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSM 362

Query: 419 ARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTW 478
           A  G APK  T+  ++G P    L  +V+  +A+   SS  + VFNWLL I+ ++  FTW
Sbjct: 363 AMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTW 422

Query: 479 ALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEG 538
            LI +SHIRF +A+K QG S D++ +K++   WG+ YA   + +I+I Q +    P    
Sbjct: 423 ILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP---- 478

Query: 539 SADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDL-ISHRHIHDPEILRQERE 597
              V  FF  Y+++ +F V ++G++IW R   LFI+ +DIDL    R I D     Q+  
Sbjct: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPR 537

Query: 598 EYQEKL 603
              EK 
Sbjct: 538 NLWEKF 543

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  322 bits (825), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 205/597 (34%), Positives = 328/597 (54%), Gaps = 45/597 (7%)

Query: 36  ERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDM---------NPILSHQSVFDDAKV 86
            + Y+         RF  FI SF+  E     + D+         N IL+HQ        
Sbjct: 21  NQEYDSEKGGKAGKRFDKFIGSFQRHEAIIPEDVDLSLLNDYERSNFILAHQ-------- 72

Query: 87  EISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMAS 146
                        +KT+  RH+ M+S                 A    A L+    +  S
Sbjct: 73  -----------PYQKTLSQRHLTMISIGGTLGTGLFIGIGSSLASGPGALLLGFLLVGLS 121

Query: 147 CIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASM 206
            I+C+IQA  E++  Y  + G F+ +    ++P++ F ++  Y + W    P ELV  ++
Sbjct: 122 -IFCVIQAAAELSCQY-PVSGSFSTHVSRFIEPSVGFMVSTSYALSWLISFPSELVGLTL 179

Query: 207 TIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVII 266
           TI YW   V+  I+V IFY+L++A+N+F   RG+AETE+  +  KI+ +  F I+GIV+I
Sbjct: 180 TIGYWNNSVSPGIWVAIFYLLIMAMNLFS-VRGFAETEYWLSIIKIIAITIFIIIGIVVI 238

Query: 267 CGGAGND--GFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQS 324
           CGG  N+  G++G KYW DPGAF+       F G+ +T V+AAFSFG  E + +TA+E S
Sbjct: 239 CGGGPNNQAGYLGTKYWHDPGAFK----KPYFSGICNTFVSAAFSFGGAELVLLTANE-S 293

Query: 325 NPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHG 384
              ++I  AAK   +R  + Y++++ ++  LVPYD+  LLG+       SP+V++++  G
Sbjct: 294 RKVESISRAAKGTFWRIAIFYISTVAVISCLVPYDNETLLGNGEGVAN-SPFVISLANTG 352

Query: 385 V--RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFL 442
              + V HF+NA+IL +V SV +S+ Y++SR++  L   G  P V  ++D+ GRP +G  
Sbjct: 353 QFGKNVSHFMNAIILAAVLSVCNSSVYAASRVIQALGACGQLPSVCGYIDKKGRPLVGIA 412

Query: 443 VGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEI 502
           +  V  ++AF       TEVFNWL A+  ++   TW  ICLS +RFRRA+KVQG   +EI
Sbjct: 413 ICGVFGLLAFLVEYDNVTEVFNWLFALCSIAAFVTWWSICLSQLRFRRALKVQGLGKEEI 472

Query: 503 GYKSQVGVWGSAYAFVMMILIMIGQCWVGI-VPVGEGSADVQAFFQDYLAMPVFIVLYLG 561
            Y+S +G+W      V+  +++ G+ +V I   + E SA  + FFQ  +++PV I +Y  
Sbjct: 473 AYESMMGIWSGVVGIVLNTMLICGEIYVAIHASIDEHSA--KTFFQYCMSIPVMITVYAA 530

Query: 562 YKIWKRDWRL-FIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617
           ++I+ ++W   F+RAKDIDL + +   D E+++ E    + K+   P++ R+Y FWC
Sbjct: 531 HRIYNKNWHTWFVRAKDIDLSTGKKAEDIELMKHEIMVSRAKIAASPLYYRIYRFWC 587

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/586 (32%), Positives = 310/586 (52%), Gaps = 30/586 (5%)

Query: 34  SAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDD 93
           S E  YE+ +SS        F+D        +  E     I + + V DDA  E      
Sbjct: 10  SKEGQYEINSSSIIKEE--EFVDE------QYSGENVTKAITTERKVEDDAAKETESSPQ 61

Query: 94  ELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQ 153
           E  E +K+ ++ RH+ M++                 AHAGP G +I Y  M + IY + Q
Sbjct: 62  ERRE-VKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 154 AVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT 213
           ++GEM V ++ +   F+ +    + PAL  +  ++Y + W     LEL      IQYWT 
Sbjct: 121 SLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTE 179

Query: 214 KVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND 273
            V    +++IF+ L+ ++N+F   + Y E EF   S K++ ++GF I    ++CG   +D
Sbjct: 180 AVPLAAWIVIFWCLLTSMNMFP-VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238

Query: 274 GFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           G IG +YWR+PGA+            RF G VS+L+ AAF++  TE + ITA E +NPRK
Sbjct: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 298

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVV 388
           A+P A KKV+ R L+ Y+ S+  +GLLVPY+  +L  S      +SP+++++   G +V+
Sbjct: 299 ALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVL 357

Query: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448
           P   NAV+LI++ S  +S  Y  SR+L +L++   AP+  + V R G P    L  +V  
Sbjct: 358 PDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFG 417

Query: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508
            +AF   S+   + FNWLL I+G++  F W LI  SHIRF +A++ +G S D++ YK+Q+
Sbjct: 418 FLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQM 477

Query: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568
             + + YA   + LI++ Q +    P  +    V A    Y+++ +F+ ++L +++W + 
Sbjct: 478 MPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA----YISIFLFLAIWLSFQVWFKC 533

Query: 569 WRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYD 614
            RL  + +DID+ S R        RQ  E    +      W+RV+D
Sbjct: 534 -RLLWKLQDIDIDSDR--------RQIEELVWIEPECKTRWQRVWD 570

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  320 bits (819), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 305/555 (54%), Gaps = 21/555 (3%)

Query: 65  HHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXX 124
            + E D +  ++  S  ++   + ++       ++++ ++ RH+ M++            
Sbjct: 32  QYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGGTIGTGLIIG 91

Query: 125 XXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFS 184
                AHAGP G +I Y  M + IY + Q++GEMA  ++ +   F+ +    + PAL  +
Sbjct: 92  IGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAT 150

Query: 185 IAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETE 244
             ++Y + W     LEL      IQYWT  V    +++IF+ L+  +N+F   + Y E E
Sbjct: 151 NGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFP-VKYYGEFE 209

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGV 299
           F   S K++ ++GF I    I+CG    DG IG +YWR+PGA+       +    RF G 
Sbjct: 210 FCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSNKNEGRFLGW 269

Query: 300 VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYD 359
           VS+L+ AAF++  TE + ITA E +NPRKA+P A KKV+ R L+ Y+ S+  +GLLVPY+
Sbjct: 270 VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLFFIGLLVPYN 329

Query: 360 SSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLA 419
             +L  S      ASP+++++   G +V+P   NAV+LI++FS  +S  Y  SR+L +L+
Sbjct: 330 DPKL-DSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLS 388

Query: 420 RQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWA 479
           +   APK  + V R G P L  L+ ++   +AF   S+   + FNWLL I+G++  F W 
Sbjct: 389 KNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWL 448

Query: 480 LICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGS 539
           LI  SHIRF +A+K +G S D++ YK+++  + + YA   + LI++ Q +    P  +  
Sbjct: 449 LISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPV 508

Query: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599
             V A    Y+++ +F +++L +++W +  RL  + +DID+ S R     EI  Q   E 
Sbjct: 509 DFVAA----YISVFLFAIIWLSFQLWFKC-RLICKLQDIDIDSDRR----EIEEQVWIEP 559

Query: 600 QEKLRNGPVWRRVYD 614
           + K R    W+RV+D
Sbjct: 560 ECKTR----WQRVWD 570

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/545 (33%), Positives = 307/545 (56%), Gaps = 22/545 (4%)

Query: 62  ETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNE----KLKKTIQPRHVVMMSXXXXX 117
           ++   I T +N   SH S   +A++   + D +  E    K+K+ ++PRH+ M++     
Sbjct: 64  DSKSDIFTSVNRYASHPS---EARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTI 120

Query: 118 XXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLV 177
                         +GP G +I Y  M + +Y + QA+GEMA  ++ +      +    +
Sbjct: 121 GTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMA-TFIPVTSSITVFSSRFL 179

Query: 178 DPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGA 237
            PA   S  ++Y   W     +E+      I++WTTKV    ++ IF++LV A+N F   
Sbjct: 180 SPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFP-V 238

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG---SDGPN 294
             Y E EF   S K+L ++G+ I  +VI+CGG+   G IG +YWR   A  G   S   N
Sbjct: 239 SVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRHGYAMGGGMISKDKN 297

Query: 295 --RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIV 352
             RF G V++L+ AAF++  TE + ITA E +NPRK++P A  KV++R ++ Y+ S+  +
Sbjct: 298 EARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFI 357

Query: 353 GLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSS 412
           GLLVPY+  +L  S+++   +SP+V+++   G R +PH  NA+I+I++ S A+S  Y SS
Sbjct: 358 GLLVPYNDPKL-NSATSYIASSPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSS 416

Query: 413 RMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGL 472
           R+L +LA  G+APK+F  V   G P LG +V A++ ++AF   ++   E FNWL+ IS L
Sbjct: 417 RVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTL 476

Query: 473 SQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGI 532
           + +  W  I +SH+RF  A+K +G S D++ +K++   +GS YA   + +I+  Q +   
Sbjct: 477 AGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAF 536

Query: 533 VPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEIL 592
            P      DV +FF  Y+++ +  VL++G +++ R  R F + +DID+ + R   D EI+
Sbjct: 537 SP----KFDVASFFTAYISLILLAVLFIGCQLYYR-CRFFWKVEDIDIDTDRREID-EIV 590

Query: 593 RQERE 597
            ++ E
Sbjct: 591 WEDDE 595

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  317 bits (813), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 183/496 (36%), Positives = 278/496 (56%), Gaps = 19/496 (3%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           + ++K+ ++PRH+ M++                 + +GP G +I Y  M S +Y + Q++
Sbjct: 99  DTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSL 158

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +      +    + PAL  S  ++Y   W      EL      IQYWT KV
Sbjct: 159 GEMA-TFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKV 217

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               ++ IF+++V  +N F   + Y E EF  +S K+L ++G+ I  +VI+CGG+   G 
Sbjct: 218 PLAAWIPIFWVIVAVLNFFP-VKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS-RQGP 275

Query: 276 IGGKYWRDPGAFRGSDG-------PNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           IG +YWR   AF   DG         RF G VS+L+ AAF++  TE + I+A E +NPRK
Sbjct: 276 IGFRYWRHGYAF--GDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVV 388
            +P A  KVI+R  L Y+ S+  +GLLVPY+   L    SA   +SP+V+++   G   +
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL-SDGSAIIASSPFVISMLNAGTSAL 392

Query: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448
           P   NAVILI+V S A+S  Y +SR+L  LA QG APK FT+V+R G P LG  V  ++ 
Sbjct: 393 PDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVG 452

Query: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508
            +AF   S+     FNWL+ IS L+ +  W  IC +HIRF +A+K +G S D++ +K++ 
Sbjct: 453 WLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARF 512

Query: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD 568
             WG+ YA   + LI+  Q +    P      D ++FF  Y+++ +F VLYLG  I+ R 
Sbjct: 513 MPWGAYYAAFFVGLIIFIQGYDAFTP-----WDTKSFFTSYISLILFGVLYLGCLIYYRG 567

Query: 569 WRLFIRAKDIDLISHR 584
            RL I+ +DID+ + R
Sbjct: 568 -RLLIKIEDIDIDTDR 582

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  311 bits (797), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 183/601 (30%), Positives = 318/601 (52%), Gaps = 35/601 (5%)

Query: 3   DTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPE 62
           D+ G++    E N++         +++I+ +S + + + P  +   S+    I S     
Sbjct: 27  DSIGNNSTMKENNEV---------IELINTNSFKDSSDKPPITLRKSKLSE-IGSLHSGS 76

Query: 63  TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXX 122
             H   T         S+ DD + +  +   + + ++K+ ++ RH+ M++          
Sbjct: 77  NLHQHGT--------TSLHDDEESDTEEAQYQ-DTRVKRALKQRHIGMIALGGTIGTGLF 127

Query: 123 XXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALN 182
                  ++AGP G +I Y  M S +Y + Q++GEMA  ++ +      +    + PA  
Sbjct: 128 VGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMAT-FIPVTSSITVFSKRFLSPAFG 186

Query: 183 FSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAE 242
            +  ++Y   W     +E+      IQYWT  V    ++ IF+++V  +N F   + Y E
Sbjct: 187 VANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFP-VKVYGE 245

Query: 243 TEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFK 297
            EF   S K+L ++G+ I  ++I+CGG+ + G IG +YWR+PG +         G  RF 
Sbjct: 246 FEFWIASIKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGPWGPGIISDKTGEARFL 304

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G VS+L+ AAF++  TE + ITA E +NPRK++P A  KV++R  L Y+ S+  +GLLVP
Sbjct: 305 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVP 364

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           ++   L  + SA   +SP+V+++   G R +P   NAV+L+++ S A+S  Y  SR+L  
Sbjct: 365 FNDDRL-ANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYA 423

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA  G APK+F++V + G P +G +  A + ++AF   ++     FNWL+ IS L+ +  
Sbjct: 424 LALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCA 483

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W  I LSHIRF +A+K +G S D++ +K+++  WG+ YA   + +I+  Q +    P   
Sbjct: 484 WLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTP--- 540

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE 597
              DV  FF  Y+++ +  VL+ G +++ R  R   + +DID+ S R   + E +  E +
Sbjct: 541 -KFDVSTFFTSYISLILLAVLFSGCQLYYRC-RFIWKVEDIDIDSDR--REIEAIIWEED 596

Query: 598 E 598
           E
Sbjct: 597 E 597

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  310 bits (793), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 187/587 (31%), Positives = 304/587 (51%), Gaps = 63/587 (10%)

Query: 49  SRFRNFIDSFKPPETTHHI----------ETDMNPILSHQSVFDDAKV-EISQVDDELNE 97
           SRFRN I S    + T  I          E  +  I   + VFD  K+   +Q + ++N 
Sbjct: 2   SRFRNLISSNSEEKDTSEIHSIEEGNNVYENGIETINDEKIVFDKKKLAHTNQFNADINS 61

Query: 98  ------------------------------KLKKTIQPRHVVMMSXXXXXXXXXXXXXXX 127
                                         ++K+ ++ RH+ M++               
Sbjct: 62  ITHSLTRSRIATHHEDDQEEEAEEAQYHDTQVKRALKQRHLGMIALGGTIGTGLFIGIAT 121

Query: 128 XXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187
              ++GP G +I Y  M S IY I Q++GEMA  ++ +      +    + PA   +  +
Sbjct: 122 PLTNSGPVGSLIAYLFMGSIIYFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGY 180

Query: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247
           +Y   W     +E+      I+YWT KV    ++ IF++L+  +N F   + Y E EF  
Sbjct: 181 MYWFNWAITFAVEISVVGQVIEYWTDKVPLAAWIAIFWVLITLLNFFP-VKVYGEIEFWI 239

Query: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RFKG 298
              K+L ++G+ +  ++I+CGG+ + G IG +YWR+PG +    GP          RF G
Sbjct: 240 AFIKVLAIMGYLLYALIIVCGGS-SQGPIGFRYWRNPGPW----GPGIISKDVNTGRFLG 294

Query: 299 VVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPY 358
            VS+L+ AAF++  TE + ITA E +NPRK +P A  KV++R  L Y+ S+  +G+LVPY
Sbjct: 295 WVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIALFYIMSLFFIGMLVPY 354

Query: 359 DSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTL 418
           +  E L S+SA   +SP+V+++   G +V+P   NA+++I++ S A+S  Y  SR+L  L
Sbjct: 355 ND-ERLASTSAVIASSPFVISIQNAGTKVLPDIFNAIVMITIISAANSNVYVGSRVLYAL 413

Query: 419 ARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTW 478
           A  G APK F FV R G P LG +V + + ++AF   ++     FNWL+ IS L+ +  W
Sbjct: 414 ALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFLVVNNNANTAFNWLINISTLAGLCAW 473

Query: 479 ALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEG 538
             I +SHIRF +A+K +G S D++ +K+++  +G+ YA   + +I+  Q +    P    
Sbjct: 474 LFISISHIRFMQALKFRGISRDDLPFKAKLMPFGAYYATFFVTVIIFIQGFQAFSP---- 529

Query: 539 SADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
             D  AFF  Y+++ +  VL++G +I+ R  R F R +DID+ S R 
Sbjct: 530 HWDTTAFFTSYISLIILAVLFIGCQIFYRC-RFFWRVEDIDIDSDRR 575

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  308 bits (788), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 179/567 (31%), Positives = 295/567 (52%), Gaps = 18/567 (3%)

Query: 37  RNYELPTSSTTHSRFRNFIDSFKPPETTHH-IETDMNPILSHQSVFDDAKVEISQVDDEL 95
            N EL T            +S +  +  HH  ET    I  +Q    +   E+  +    
Sbjct: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQ----ENMSEVESLYGND 58

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           +  +K+ ++PRH+ M+S                   AGP G ++ Y  M +  +C+ Q++
Sbjct: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +   F  Y    + PAL  +  ++Y   W     LEL      IQYWT  V
Sbjct: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
              +++++F+IL+ A N+    R Y E EF   + K+L + GF I  +V++CGG+ ++G 
Sbjct: 178 PLSVWIVVFWILLTASNMIP-VRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGA 235

Query: 276 IGGKYWRDPGAF-RGSDGPN----RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
           +G +YW++PG +  G    N    RF G VS+L+ AAF++  TE + ITA E  NPRK +
Sbjct: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P A  KV +R L  Y+ S+  VGLLVPY    L  +S +    SP+V+A+   G +V+P 
Sbjct: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
             N VIL+++ S  +S  Y  SR+L  L++ G AP +F   ++ G P    L  ++   +
Sbjct: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           A+   S    +VF+WLL I+ ++  F W LI LSHIRF + +K +G S +++ +K++   
Sbjct: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
           WG+ YA   + +I++ Q +    P          F  DY+++ +FIV +LG+++  +  R
Sbjct: 476 WGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-R 530

Query: 571 LFIRAKDIDLISHRHIHDPEILRQERE 597
           L +R +D+D+ + R   D  +   + E
Sbjct: 531 LILRKEDVDIDTDRREIDALVWSDDDE 557

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  307 bits (787), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/511 (33%), Positives = 284/511 (55%), Gaps = 24/511 (4%)

Query: 66  HIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXX 125
           ++ ++  PI SH    D+A  E  + D    E +K+ ++PRH+ M++             
Sbjct: 26  YVSSETLPIYSHSG--DNAPCEKGEGDCRETE-VKRALKPRHISMIALGGTIGTGLFVGI 82

Query: 126 XXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSI 185
               + +GP G +I Y  + S +Y + Q++GEMA  ++ +      +    + PA   + 
Sbjct: 83  ASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVAN 141

Query: 186 AWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEF 245
            ++Y   W     +E+      IQYWT  V    ++ IF++LV   N F   + Y E EF
Sbjct: 142 GYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFP-VKFYGEVEF 200

Query: 246 ICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RF 296
              S K++ ++G+ I  +VI+CGG+ + G IG +YWR+PG +    GP          RF
Sbjct: 201 WVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPW----GPGIISKDVNEGRF 255

Query: 297 KGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356
            G VS+L+ AAF++  TE + ITA E +NPRK +P A  KV +R L  Y+ S+  +GLLV
Sbjct: 256 LGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLV 315

Query: 357 PYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLL 416
           PYD   L  +++A   +SP+V+++   G +V+PH  NA+++I++ S A+S  Y  SR+L 
Sbjct: 316 PYDDLRL-SNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLY 374

Query: 417 TLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVF 476
           +LA  G APK F +V + G P LG +V A++ ++AF   ++   E FNWL+ IS L+ + 
Sbjct: 375 SLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLC 434

Query: 477 TWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG 536
            W  I LSH+RF + +K +G S +++ +K+++  WG+ YA   + +I+I Q +    P  
Sbjct: 435 AWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTP-- 492

Query: 537 EGSADVQAFFQDYLAMPVFIVLYLGYKIWKR 567
                V  FF  Y+++ +  VL+LG +++ R
Sbjct: 493 --KFRVSDFFTSYISLILLAVLFLGCQLFYR 521

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  306 bits (785), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 172/546 (31%), Positives = 298/546 (54%), Gaps = 26/546 (4%)

Query: 65  HHI---ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXX 121
           HH    E +   ++S  S   D  V +  +      ++K+ ++PRH+ M++         
Sbjct: 6   HHSSEKEKNSEELVSEFSRSKDV-VSLESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64

Query: 122 XXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPAL 181
                   ++AGP G +I Y  + +  Y + Q++GEMA  ++ +   F  +    + PAL
Sbjct: 65  FISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPAL 123

Query: 182 NFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYA 241
             +  ++Y + W     LEL      IQ+WT  V    +++I ++++++ N+    + Y 
Sbjct: 124 GAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANL-APVKFYG 182

Query: 242 ETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN------- 294
           E EF     K+L ++GF I   +++CG AG  G +G +YWR+PG +    GP        
Sbjct: 183 EVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW----GPGIISKDVN 237

Query: 295 --RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIV 352
             RF G VS+L++AAF++  TE + ITA E +NPRK +P A  KV +R L  Y+ S++ +
Sbjct: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFI 297

Query: 353 GLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSS 412
           GLLVP++  +L  S  +   +SP+V+A+   G +V+PH  NAVIL ++ S  +S  Y SS
Sbjct: 298 GLLVPFNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISS 356

Query: 413 RMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGL 472
           R+L ++   G APK  T+  ++G P    L  +++  +A+   S   + VF+WLL I+ +
Sbjct: 357 RVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAV 416

Query: 473 SQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGI 532
           +  F W LI ++HIRF +A+K QG S D++ +K++   WG+ YA   + +I+I Q +   
Sbjct: 417 AGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAF 476

Query: 533 VPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEIL 592
            P      +V  FF  Y+++ +F  +++G++IW R   LF + +DIDL + R   D ++ 
Sbjct: 477 AP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVW 531

Query: 593 RQEREE 598
            ++  +
Sbjct: 532 EEDEPK 537

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  307 bits (787), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 187/601 (31%), Positives = 315/601 (52%), Gaps = 43/601 (7%)

Query: 21  SAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDM-NPILSHQ- 78
           +++  D+++ID      N    T+S T+ ++    DS    E +   +  M   + S Q 
Sbjct: 6   ASQSEDIELIDNPEYTSNNLSTTASNTNKKY----DSDTDMEPSQRKKAAMAGKLFSDQL 61

Query: 79  ----SVFDDAKVEISQVDDELNE--------KLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
               SV D++      +D    E        ++K+ ++ RH+ M++              
Sbjct: 62  SYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGIS 121

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
               +AGP G +I Y  M S IY I Q++GEMA  ++ +      +    + PA   +  
Sbjct: 122 TPLGNAGPVGALIAYIFMGSIIYFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVTNG 180

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
           ++Y   W     +E+      IQYWT  V    ++ IF++ V  +N F   + Y E EF 
Sbjct: 181 YMYWFNWAITYAVEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFP-VKVYGEVEFW 239

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RFK 297
             S K+L +IG+ I  +VI+CGG+ + G IG +YWR+PG +    GP          RF 
Sbjct: 240 VASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRYWRNPGPW----GPGIISKDVNEGRFL 294

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G VS+L+ AAF++  TE + ITA E +NPRK++P A  KV++R  L Y+ S+  +GLLVP
Sbjct: 295 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVP 354

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           Y+    L S  +   +SP+V+++   G   +P   NAV+++++ S A+S  Y  SR+L  
Sbjct: 355 YND-HTLSSGDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYA 413

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA+ G APK F +V + G P LG +V A + ++AF   ++     FNWL+ IS L+ +  
Sbjct: 414 LAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCA 473

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W  I LSHIRF +A+K +G S D++ +K+++  WG+ Y+   + +I+  Q +    P   
Sbjct: 474 WFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP--- 530

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE 597
              D   FF  Y+++ + +V+++G +++ R  R  ++ +DID+ + R   + E +  E +
Sbjct: 531 --WDTTTFFTSYISLILLVVVFIGCQLYYRC-RFLLKVEDIDIDTDR--REIEAIIWEDD 585

Query: 598 E 598
           E
Sbjct: 586 E 586

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  306 bits (785), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 174/549 (31%), Positives = 298/549 (54%), Gaps = 21/549 (3%)

Query: 42  PTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKK 101
           P   T   ++   +    P      + T  N       V D  + E ++     + ++K+
Sbjct: 17  PVGKTEQDKYGYELHPLDPVTQQVTLRTVTN-------VCDGLEEEDAEEAGYHDTRVKR 69

Query: 102 TIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVN 161
            ++ RH+ M++                 ++AGP G +I Y  M S +Y I Q++GEMA  
Sbjct: 70  ALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEMA-T 128

Query: 162 YLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFV 221
           ++ +      +    + PA   +  ++Y   W     +E+      IQ+WT+ V    ++
Sbjct: 129 FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLAAWI 188

Query: 222 LIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYW 281
            IF++ V  +N F   + Y E EF   S K++ ++G+ I  +VI+CGG+ + G IG +YW
Sbjct: 189 AIFWVFVSLLNFFP-VKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQGPIGFRYW 246

Query: 282 RDPGAFRG---SDGPN--RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKK 336
           R+PG +     SD  N  RF G VS+L+ AAF++  TE + ITA E +NPRK++P A  K
Sbjct: 247 RNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINK 306

Query: 337 VIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVI 396
           V++R ++ Y+ S+  VG+LVP++   L  S+ A   +SP+V+++   G RV+PH  NAV+
Sbjct: 307 VVFRIVIFYIMSLFFVGMLVPFNDPRL-ASNVAVIASSPFVISIQNAGTRVLPHIFNAVV 365

Query: 397 LISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACS 456
           ++++ S A+S  Y  SR+L  L++ G APK F +V R G P LG +  +++ ++AF   +
Sbjct: 366 MLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVN 425

Query: 457 SKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYA 516
           +     FNWL+ IS L+ +  W  I LSHIRF +A+K +G S D++ +K+++  WG+ YA
Sbjct: 426 NNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYA 485

Query: 517 FVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAK 576
              + +I+  Q +    P      DV  FF  Y+++ + +VL +G +++ R  R   + +
Sbjct: 486 AFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVLLIGCQLYYRC-RFLWKLE 540

Query: 577 DIDLISHRH 585
           DID+ + R 
Sbjct: 541 DIDIDTDRR 549

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  306 bits (784), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 185/601 (30%), Positives = 314/601 (52%), Gaps = 56/601 (9%)

Query: 8   SKESYEKNDITKSSAKFNDVDVIDI---DSAERNYE--LPTS---STTHSRFRNFIDSFK 59
           +++S E ND   S+  +++ ++I+I   DS + + +  +P S   S TH+  R+ ++   
Sbjct: 13  NEDSTESND--DSTTSYDNFEIIEIQHNDSKDNSIKKKIPNSELASLTHAYSRSRVE--- 67

Query: 60  PPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXX 119
            PE              H    ++A  E  QV  EL +        RH+ M++       
Sbjct: 68  -PE--------------HDEDAEEADYEDKQVKRELKQ--------RHIGMIALGGTIGT 104

Query: 120 XXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDP 179
                     A AGP G +I Y  M S +Y + QA+GEMA  ++ +      +    + P
Sbjct: 105 GLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMA-TFIPVTSSITVFSQRFLSP 163

Query: 180 ALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARG 239
           A   +  ++Y   W     +E+      IQYWT  V    ++ IF++LV  +N F   + 
Sbjct: 164 AFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFP-VKV 222

Query: 240 YAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG---SDGP--- 293
           Y E EF     K++ ++G+ +  ++I+CGG+   G IG +YWR+PGA+     SDG    
Sbjct: 223 YGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIY 282

Query: 294 -----NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLAS 348
                 RF G V++L+ AAF++  TE + ITA E +NPRK +P A  KV++R +L Y+ S
Sbjct: 283 SSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMS 342

Query: 349 IIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAF 408
           +  +GLLVP+  S L    +    +SP+V+++   G +++P   NA+++++V S A+S  
Sbjct: 343 LFFIGLLVPFTDSRL-SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNV 401

Query: 409 YSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLA 468
           Y  SR+L +LA    APK+F  V R G P +G +  +++ ++AF    +     FNWL+ 
Sbjct: 402 YVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVD 461

Query: 469 ISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQC 528
           IS L+ +  W  I L+H+RF + +K +G S D++ +K++   WGS YA   + +I+  Q 
Sbjct: 462 ISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQG 521

Query: 529 WVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLIS-HRHIH 587
           +    P      DV  FF DY+++ +  V+++G +++ R  R   + +D+D+ S  R I 
Sbjct: 522 FQAFSP----HFDVTTFFTDYISLILLAVVFIGAQLYYRC-RFLWKLEDVDIDSDRREIE 576

Query: 588 D 588
           D
Sbjct: 577 D 577

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  305 bits (781), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 189/596 (31%), Positives = 320/596 (53%), Gaps = 24/596 (4%)

Query: 9   KESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSS-TTHSRFRNFIDSFKPPETTHHI 67
            E  EKN+ + S++  ++ D+  I S   N +  +++  TH +        K   T    
Sbjct: 9   NEKNEKNEASASTSHASE-DIEIIPSRYDNEKFYSATEATHKK--------KTGSTGFDD 59

Query: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXX 127
              +   LS   +    + E ++  +  + ++K+ ++ RH+ M++               
Sbjct: 60  TISLTHTLSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGMIALGGTIGTGLFVGIST 119

Query: 128 XXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187
             +++GP G +I Y  M + IY + Q++GEMA  ++ +      +    + PA   +  +
Sbjct: 120 PLSNSGPVGALIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGY 178

Query: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247
           +Y   W     +E+      IQYWT KV    ++ IF++L+  +N F   + Y E EF  
Sbjct: 179 MYWFNWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLMNFFP-VKIYGEFEFWV 237

Query: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG----SD-GPNRFKGVVST 302
            S K++ ++G+ I  ++I+CGG+ + G IG +YWR+PGA       SD G  RF G VS+
Sbjct: 238 ASIKVIAIVGYLIYALIIVCGGS-HQGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSS 296

Query: 303 LVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSE 362
           L+ AAF++  TE + ITA E +NPRK++P A  KV++R +L Y+ S+  VGLLVPY+   
Sbjct: 297 LINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPR 356

Query: 363 LLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQG 422
           L  +SSA   +SP+V+++   G +V+P   NAV+L++V S A+S  Y  SR+L  LA+ G
Sbjct: 357 LS-ASSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSG 415

Query: 423 YAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALIC 482
            APK F +V R G P LG +  A++ ++AF   +      FNWL+ IS L+ +  W  I 
Sbjct: 416 NAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFIS 475

Query: 483 LSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADV 542
           L+HIRF +A+K +G S D++ +K++   WG+ YA   + +I+  Q +    P      DV
Sbjct: 476 LAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYASFFVTVIIFIQGFQAFAP----KFDV 531

Query: 543 QAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
             FF  Y+++ + +VL+ G +++ R  R   + +DID+ S R   D  +   +  +
Sbjct: 532 SEFFTAYISLILLVVLFAGCQLYYRC-RFLWKLEDIDIDSDRREIDAIVWEDDEPQ 586

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  305 bits (782), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 177/571 (30%), Positives = 301/571 (52%), Gaps = 17/571 (2%)

Query: 34  SAERNYELPTSSTTHSRFR--NFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQV 91
           S  ++  +   ++ HSR R  +   + +P    H  + +M      +   D    +    
Sbjct: 47  SVPKHPGMTEKNSLHSRARRGSGATAGEPKLKAHSDDFEMYVYSQDEPSTDPLGSDTESG 106

Query: 92  DDELNE-KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYC 150
           + ++ E K+K+ ++PRHV M++                 +++GP G +I Y  M + +Y 
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 151 IIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQY 210
           + Q++GEMA  ++ +      +    + PA   +  ++Y   W     +EL      I+Y
Sbjct: 167 VTQSMGEMA-TFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEY 225

Query: 211 WTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270
           WT  V    ++ IF++LV   N F   + Y E EF   S K+L ++G+ I  +VI+CGG+
Sbjct: 226 WTEAVPRAAWIAIFWVLVTLANFFP-VQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS 284

Query: 271 GNDGFIGGKYWRDPGAFRGS-----DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN 325
              G IG +YWR+PG +            RF G V++L+ A+F++  TE + ITA E +N
Sbjct: 285 -KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAAN 343

Query: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGV 385
           PR+ +P A  KV +R L  Y+ S+  VGLLVPY+ S L   ++    +SP+V+++   G 
Sbjct: 344 PRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL-DKTTTVIASSPFVISIQNAGT 402

Query: 386 RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGA 445
           R +P   NAV+L+++ S A+S  Y  SR+L +LA  G APKVF+ V   G P +G +V +
Sbjct: 403 RALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTS 462

Query: 446 VIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYK 505
           ++ ++AF   +    E FNWL+ IS L+ +  W  I +SHIRF + +K +G S D++ +K
Sbjct: 463 LLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFK 522

Query: 506 SQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW 565
           S++  +G+ YA   + +I+  Q +    P       V  FF  Y+++ + +V++ G +++
Sbjct: 523 SKLMPYGAYYAAFWVTVIIFVQGFQAFSP----HFKVTEFFTSYISLMLLVVVFCGAQLF 578

Query: 566 KRDWRLFIRAKDIDLISHRHIHDPEILRQER 596
            R  R F R +DID+ S R   D  I   + 
Sbjct: 579 YRC-RFFNRLEDIDIDSDRREADALIWEDDE 608

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  303 bits (777), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 175/536 (32%), Positives = 292/536 (54%), Gaps = 24/536 (4%)

Query: 87  EISQVDDELNEK--LKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIM 144
           +++   DEL E   +K++++ RH+ M++                 A+AGP G ++ Y  M
Sbjct: 52  DLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFM 111

Query: 145 ASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTA 204
            + ++ + Q++GEMA  ++ +   F+ +    + PAL  +  ++Y + W     LEL   
Sbjct: 112 GTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170

Query: 205 SMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIV 264
              IQ+WT KV    ++ IF++L+ A N+F   + Y E EF   S K+L ++GF I  + 
Sbjct: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLC 229

Query: 265 IICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319
           I+CG AG  G IG +YWR+PGA        + G  RF G VS+L+ AAF++  TE + IT
Sbjct: 230 IVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGIT 288

Query: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLA 379
           A E +NPRKA+P A +KV+ R LL Y+ S+  +GL VPY+  +L  S+ +   +SP+++ 
Sbjct: 289 AGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIIT 347

Query: 380 VSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSL 439
           +   G RV+PH  NAVIL ++ S  +S  Y  SR+L ++A+ G APK        G P L
Sbjct: 348 IQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYL 407

Query: 440 GFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSI 499
             L  +    +++   S+   + FNWLL I+G++  F W LI  SH+RF +A+K +G S 
Sbjct: 408 SVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISR 467

Query: 500 DEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLY 559
           D++ YK+    W + YA   M++I++ Q +    P   G    + F   Y+++ +F+V +
Sbjct: 468 DDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG----RDFVAAYISVGLFLVFW 523

Query: 560 LGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDF 615
             ++I+ R  R+  + +D+D+ + R        R+      E      +W + +DF
Sbjct: 524 GFFQIYFRC-RIIWKLEDVDIDTDR--------REIESVVWEDDAPKTLWDKFWDF 570

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  303 bits (777), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 167/522 (31%), Positives = 280/522 (53%), Gaps = 13/522 (2%)

Query: 82  DDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGY 141
           D+   E  Q  D    ++K+ ++ RH+ M++                   AGP G +I Y
Sbjct: 43  DEFPEEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAY 102

Query: 142 AIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLEL 201
             M + +Y I Q++GEMA  ++ +      +    + PA   +  ++Y   W     +EL
Sbjct: 103 IFMGTVVYSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVEL 161

Query: 202 VTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFIL 261
                 I YWT+ V    ++ IF+I+V  +N F   R Y E EF   S K++ ++G+ I 
Sbjct: 162 SVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFP-VRFYGEIEFWIASVKVITIVGYLIY 220

Query: 262 GIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFL 316
             +++CGG+ + G IG + WR+PG +       +    RF G VS+L+ AAF++  TE +
Sbjct: 221 AFIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELV 279

Query: 317 AITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPY 376
            ITA E  NPRK +P A  KV +R L  Y+ S+  VGLLVPY+   +  +S     ASP+
Sbjct: 280 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPF 339

Query: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436
           V+++   G +++P   NAV+L++V S A+S  Y  SR++ +LA+ G APK F +V+R G 
Sbjct: 340 VISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGV 399

Query: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496
           P LG +V A++ +MAF   ++     FNWL+ IS L+ +  W  I L+HIRF + +K +G
Sbjct: 400 PVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRG 459

Query: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFI 556
            S D + +K++   W + YA   + +I+  Q +    P      DV  FF  Y+++ + +
Sbjct: 460 ISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSP----KFDVTQFFTAYISLMLML 515

Query: 557 VLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           V+++G +I+ +  R   + +DID+ ++R   D  +   +  +
Sbjct: 516 VVFIGCQIYYKC-RFLWKLEDIDIDTNRREIDAIVWEDDEPK 556

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  301 bits (771), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 170/528 (32%), Positives = 290/528 (54%), Gaps = 17/528 (3%)

Query: 65  HHIETDMNPILSHQSVFDDAKVEIS-QVDDELNE-KLKKTIQPRHVVMMSXXXXXXXXXX 122
           H +   +     +  V D A+ + S +++ E++E K+K+ ++ RH+ M++          
Sbjct: 56  HSVTGSLTRSRLNSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLF 115

Query: 123 XXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALN 182
                  + AGP G +I Y  M + IY + Q++GEMA  ++ +      +    + PA  
Sbjct: 116 VGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFG 174

Query: 183 FSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAE 242
            +  ++Y   W     +E+      IQYWT  V    ++ IF++LV  +N F   + Y E
Sbjct: 175 VANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFP-VKVYGE 233

Query: 243 TEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFK 297
            EF     K+L ++G+ I  +VI+CGG+ + G IG +YWR PGAF       +    +F 
Sbjct: 234 VEFWIAFVKVLAIVGYLIYALVIVCGGS-HQGPIGFRYWRHPGAFGPGIISKNKNTGKFL 292

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
           G V++L+ AAF++  TE + ITA E +NPRK +P A  KV++R +L Y+ S+  +G+L+P
Sbjct: 293 GWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLP 352

Query: 358 YDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
           Y+   L  +  A   +SP+V+++     +V+P   NAV++++V S A+S  Y  SR+L  
Sbjct: 353 YNDKRL-SAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYA 411

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           LA  G APK F++V R G P LG +  A + ++AF   ++     FNWL+ IS L+ +  
Sbjct: 412 LALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCA 471

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGE 537
           W  I L+HIRF +A+K +G S D++ +K+++  WG+ YA   + +I+  Q +    P   
Sbjct: 472 WLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP--- 528

Query: 538 GSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
              DV  FF  Y+++ +  VL +G +++ R  R  ++ +DID+ + R 
Sbjct: 529 --WDVSTFFTSYISLILLAVLVVGCQLYYRG-RFLLKLEDIDIDTDRR 573

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  300 bits (768), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 169/525 (32%), Positives = 282/525 (53%), Gaps = 20/525 (3%)

Query: 77  HQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAG 136
           H S F+D + ++ +       ++K+ ++PRHV M++                 + AGP G
Sbjct: 38  HNSSFEDDEGDLQE------GQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVG 91

Query: 137 LVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCV 196
            +I Y  M S +Y + Q++GEMA  ++ +      +    + PA   +  ++Y   W   
Sbjct: 92  ALIAYIFMGSIVYFVTQSMGEMA-TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAIT 150

Query: 197 CPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMI 256
             +E+      IQYWT  V    ++ IF++ +   N F   R Y E EF   S K++ ++
Sbjct: 151 YAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFP-VRFYGEVEFWVASIKVIAIV 209

Query: 257 GFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFG 311
           G+ +  ++I+CGG+   G IG +YWR+PG +      G     RF G V++L+ A+F++ 
Sbjct: 210 GYLLYALIIVCGGS-KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQ 268

Query: 312 QTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAAT 371
            TE + ITA E +NPRK +P A  KV +R L  Y+ S+  VGLLVPY+   L    ++  
Sbjct: 269 GTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVI 327

Query: 372 KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431
            +SP+V+++ + G R++P   NAV+L+++ S A+S  Y  SR+L +LA  G APK F++V
Sbjct: 328 ASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYV 387

Query: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491
              G P LG +  A++ ++AF        E FNWL+ IS L+ +  W  I +SHIRF + 
Sbjct: 388 TNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQC 447

Query: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551
           +K +G S D++ +KS++  +G+ YA   + +I+  Q +    P       V  FF  Y++
Sbjct: 448 LKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYIS 503

Query: 552 MPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQER 596
           + +  V++   +++ R  R F R +DID+ S R   D  I  +E 
Sbjct: 504 LILLAVVFCLAQLYYRC-RFFNRLEDIDIDSDRREIDALIWEEEE 547

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  300 bits (767), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 173/550 (31%), Positives = 297/550 (54%), Gaps = 21/550 (3%)

Query: 70  DMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXX 129
           D    ++ +S  ++   + ++       ++K+ ++ RH+ M++                 
Sbjct: 37  DTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPL 96

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIY 189
           AHAGP G +I Y  M + IY + Q++GEMA  ++ +   F+ +    + PAL  +  ++Y
Sbjct: 97  AHAGPVGALISYLFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMY 155

Query: 190 CIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
            + W     LEL      IQYWT  V    +++IF+ L+  +N+F   + Y E EF   S
Sbjct: 156 WLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFP-VKYYGEFEFCIAS 214

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLV 304
            K++ ++GF      I+CG   + G IG +YWR+PGA+       +    RF G VS+L+
Sbjct: 215 IKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 274

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
            AAF++  TE + ITA E +NPR+A+P A KKV+ R L+ Y+ S+  +GLLVPY+  +L 
Sbjct: 275 NAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL- 333

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
            S      +SP+++++   G +V+P   NAV+LI++ S  +S  Y  SR+L +L++   A
Sbjct: 334 DSEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           P+  + V + G P    L  +    +AF   S+   +VFNWLL I+G++  F W LI LS
Sbjct: 394 PRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLS 453

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQA 544
           HIRF +A+K +G S D++ Y++++  + + YA   + LI++ Q +    P  +       
Sbjct: 454 HIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPI----D 509

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
           F   Y+++ +FI ++L +++W +  R   + +D+D+ S R     +I  Q   E + K R
Sbjct: 510 FIAAYISVFLFIAIWLLFQVWFKC-RFVWKLQDVDIDSDRR----DIEEQVWIEPECKTR 564

Query: 605 NGPVWRRVYD 614
               W+ V+D
Sbjct: 565 ----WQHVWD 570

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  300 bits (769), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 166/494 (33%), Positives = 277/494 (56%), Gaps = 15/494 (3%)

Query: 97  EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVG 156
           + +K+ ++ RH+ M++                 ++AGP G +I Y  M + IY I Q++G
Sbjct: 104 KHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLG 163

Query: 157 EMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVN 216
           EMA  ++ +      +    + PA   S  ++Y   W     +E+      IQYWT KV 
Sbjct: 164 EMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVP 222

Query: 217 ADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFI 276
              ++ IF++L+  +N F   + Y E EF   S K+L ++G+ I  +VI+CGG+ + G I
Sbjct: 223 LAAWIAIFWVLITLMNFFP-VKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPI 280

Query: 277 GGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIP 331
           G +YWR+PGA+       +    RF G VS+L+ AAF++  TE + ITA E +NPRK +P
Sbjct: 281 GFRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 340

Query: 332 SAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHF 391
            A  KV++R ++ Y+ S+  +GLLVPY+   L   SSA   +SP+V+++   G   +P  
Sbjct: 341 RAINKVVFRIVIFYIMSLFFIGLLVPYNEPRL-SPSSAVIASSPFVISIQNAGTYALPDI 399

Query: 392 INAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMA 451
            NAV+LI+V S A+S  Y  SR+L +LA+ G APK F +V + G P +G L  A + ++A
Sbjct: 400 FNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLA 459

Query: 452 FCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVW 511
           F   ++     FNWL++IS L+ +  W  I L+HIRF +A+K +G S D++ +K+++  +
Sbjct: 460 FLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPY 519

Query: 512 GSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRL 571
           G+ YA   + +I+  Q +    P       V  FF  Y+++ +  V+++  +++ +  R 
Sbjct: 520 GAYYASFFVTIIIFIQGFQAFCPF-----SVSEFFTSYISLILLAVVFISCQLYYKC-RF 573

Query: 572 FIRAKDIDLISHRH 585
             + +DID+ S R 
Sbjct: 574 IWKLEDIDIDSDRR 587

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  300 bits (768), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 172/514 (33%), Positives = 281/514 (54%), Gaps = 15/514 (2%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           + ++K+ ++ RH+ M++                  ++GP G +I Y  M S IY I Q++
Sbjct: 98  DTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSL 157

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +      +    + PA   +  ++Y   W     +E+      I+YWT KV
Sbjct: 158 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               ++ IF++ V  +N F   + Y E EF     K+L + G+ +  ++I+CGG+ + G 
Sbjct: 217 PLAAWIAIFWVFVTLMNFFP-VKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGP 274

Query: 276 IGGKYWRDPGAFRG-----SDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
           IG +YWR+PG +           +RF G VS+L+ AAF++  TE + ITA E +NPRK++
Sbjct: 275 IGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 334

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P A  KV++R  L Y+ S+  +GLLVPYD   L  S SA   +SP+V+++   G +++P 
Sbjct: 335 PRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLS-SDSAVVASSPFVISIQNAGTKILPD 393

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
             NA+++I+V S A+S  Y  SR+L  LA+ G APK F +V R G P LG L  A + ++
Sbjct: 394 IFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLL 453

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           AF   ++     FNWL+ IS L+ +  W  I +SHIRF +A+K +G S D++ +K++   
Sbjct: 454 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMP 513

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
           W + YA   + +I+  Q +    P      DV AFF  Y+++ +  VL++G +I+ R  R
Sbjct: 514 WAAYYATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQIYYRC-R 568

Query: 571 LFIRAKDIDL-ISHRHIHDPEILRQEREEYQEKL 603
            F + +DID+    R I +      E + Y +K 
Sbjct: 569 FFWKLEDIDIDTDRREIEEVIWEDDEPKTYWDKF 602

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  299 bits (765), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 180/603 (29%), Positives = 310/603 (51%), Gaps = 32/603 (5%)

Query: 2   IDTPGSSKESYEKNDITKSSAKF-NDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP 60
           + TP    E  EK+  T+ +  F +DV+               +S TH R  +     + 
Sbjct: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVE---------------ASQTHHRRGSLSLKDEK 45

Query: 61  PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXX 120
            +  + + +  N +    +   +  ++     +  N ++K+ ++ RH+ M++        
Sbjct: 46  SKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTG 105

Query: 121 XXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180
                     +AGP G +I Y  M S  Y + Q++GEMA  ++ +   F  +    + PA
Sbjct: 106 LFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPA 164

Query: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240
              +  ++Y   W     LEL      IQ+WT  V    ++ IF++++ A+N+F   + Y
Sbjct: 165 FGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFP-VKYY 223

Query: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNR 295
            E EF   S K++ +IGF I    ++CG AG  G +G +YWR+PGA+       +    R
Sbjct: 224 GEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEAR 282

Query: 296 FKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLL 355
           F G VS+L+ AAF+F  TE + ITA E +NPRK +P A KKV++R L  Y+ S++ +GLL
Sbjct: 283 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLL 342

Query: 356 VPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRML 415
           VPY+  +L  S+++    SP+++A+   G +V+PH  NAVIL ++ S A+S  Y  SR+L
Sbjct: 343 VPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVL 401

Query: 416 LTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQV 475
             L++   APK F+   + G P +     ++   +A+   S+   +VF WLL I+G++  
Sbjct: 402 FGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGF 461

Query: 476 FTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV 535
           F W  I +SHIRF +A+K +G S DE+ +K+++    + YA   M++I++ Q +    P 
Sbjct: 462 FAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT 521

Query: 536 GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQE 595
             G   + A+   +L + ++I+  L ++      R   + +D+D+ S R   D E +  E
Sbjct: 522 FNGVNFLAAYISVFLFLAIWILFELIFRC-----RFVWKIEDVDIDSDR--RDIEAIVWE 574

Query: 596 REE 598
             E
Sbjct: 575 EPE 577

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  299 bits (765), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 168/508 (33%), Positives = 279/508 (54%), Gaps = 16/508 (3%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           N ++K+ ++ RH+ M++                 A+AGP G +I Y  M S  Y + Q++
Sbjct: 81  NAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSL 140

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL      I++WT KV
Sbjct: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKV 199

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               ++ IF++++  +N+F   + Y E EF   S K+L +IGF I    ++CG AG  G 
Sbjct: 200 PLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257

Query: 276 IGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
           +G +YWR+PGA+            RF G VS+L+ AAF+F  TE + ITA E +NPRK +
Sbjct: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P A KKV++R L  Y+ S++ +GLLVPY+  +L  ++S  +  SP+++A+   G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVS-VSPFIIAIENSGTKVLPH 376

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
             NAVIL ++ S A+S  Y  SR+L  L++   APK  +   + G P +   + AV   +
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGAL 436

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           A+   S+   +VF WLL I+G++  F W LI +SHIRF +A+K +G S DE+ +K+++  
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
             + +A   MI+I++ Q +    P  +G   + A+   +L + ++I+  + ++      R
Sbjct: 497 GLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRC-----R 551

Query: 571 LFIRAKDIDLISHRHIHDPEILRQEREE 598
              + +D+D+ S R   D E +  E  E
Sbjct: 552 FIWKIEDVDIDSDR--RDIEAIVWEDHE 577

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  298 bits (763), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 172/517 (33%), Positives = 287/517 (55%), Gaps = 19/517 (3%)

Query: 74  ILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAG 133
           ++SH++  ++ + E    D  +   LK+    RH+ M++                 ++AG
Sbjct: 85  VVSHETDINEDEEEAHYEDKHVKRALKQ----RHIGMIALGGTIGTGLFVGISTPLSNAG 140

Query: 134 PAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQW 193
           P G +I Y  M + +Y + Q++GEMA  ++ +      +    + PA   S  ++Y   W
Sbjct: 141 PVGSLIAYIFMGTIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNW 199

Query: 194 FCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKIL 253
                +E+      I+YWT KV    ++ IF++++  +N F   + Y E EF   S K+L
Sbjct: 200 AITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFP-VKVYGEFEFWVASVKVL 258

Query: 254 MMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAF 308
            ++G+ I  ++I+CGG+ + G IG +YWR+PGA+            RF G VS+L+ AAF
Sbjct: 259 AIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAF 317

Query: 309 SFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSS 368
           ++  TE + ITA E +NPRK +P A  KV++R +L Y+ S+  +GLLVPY+ S L  +SS
Sbjct: 318 TYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLS-ASS 376

Query: 369 AATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428
           A   +SP+V+++   G   +P   NAV+LI+V S A+S  Y  SR+L +LAR G APK F
Sbjct: 377 AVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQF 436

Query: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488
            +V R G P LG +  A + ++AF   ++     FNWL+ IS L+ +  W  I L+HIRF
Sbjct: 437 GYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRF 496

Query: 489 RRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQD 548
            +A+K +G S D++ +K+++  +G+ YA   + +I+  Q +    P       V  FF  
Sbjct: 497 MQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPF-----KVSEFFTS 551

Query: 549 YLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
           Y+++ +  V+++G +I+ +  R   + +DID+ S R 
Sbjct: 552 YISLILLAVVFIGCQIYYKC-RFIWKLEDIDIDSDRR 587

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  296 bits (758), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 178/570 (31%), Positives = 300/570 (52%), Gaps = 21/570 (3%)

Query: 31  DIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQ 90
           ++DS++ N + P+ + T+ +  +   S  P E   +     N      SV D  K E+  
Sbjct: 13  ELDSSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDDSV-DGEKGEVRS 71

Query: 91  VDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYC 150
            +      +K+ ++PRH+ M++                  +AGP G++I Y  MA+  + 
Sbjct: 72  TE------VKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFS 125

Query: 151 IIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQY 210
           ++Q++GEMA  Y+ +   F+ +    + PA   +  ++Y   W     LEL      +QY
Sbjct: 126 VMQSLGEMA-TYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQY 184

Query: 211 WTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270
           WT KV    ++ IF++L+  +N F   + Y E EF     K++ ++GF I   +++CG A
Sbjct: 185 WTFKVPVAAWISIFWVLIAGLN-FCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCG-A 242

Query: 271 GNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN 325
           G  G +G +YWR   AF       +    RF G VS+L+ AAF++  TE + ITA E +N
Sbjct: 243 GKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 302

Query: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGV 385
           PRK +P + K+ ++R L+ Y+ S++ VGLLVP++   L  S S A  +SP++LA+   G 
Sbjct: 303 PRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAA-SSPFILAIKNSGT 361

Query: 386 RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGA 445
           + +P   NAVIL +V S A+S  Y  SR++ ++AR   AP +     + G P    L  +
Sbjct: 362 KALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTS 421

Query: 446 VIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYK 505
            I  +A+   SS    VFNWL+ I+G++  F+W LI  SH+RF +A+K +G S +++ +K
Sbjct: 422 AIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFK 481

Query: 506 SQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW 565
           +    W + Y+F  M LI++ Q +    P  + S     F   Y+++ +F V++  ++IW
Sbjct: 482 ASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQAS----DFVASYISVGLFFVIWAVFQIW 537

Query: 566 KRDWRLFIRAKDIDLISHRHIHDPEILRQE 595
            R   L +   +ID+ + R   D E+   E
Sbjct: 538 FRC-PLLVPIAEIDIDTDRRDVDAEVWEDE 566

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  296 bits (757), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/508 (33%), Positives = 273/508 (53%), Gaps = 16/508 (3%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           N ++K+ ++ RH+ M++                  +AGP G +I Y  M S  Y + Q++
Sbjct: 81  NAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSL 140

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL      IQ+WT KV
Sbjct: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               ++ IF++++  +N+F   + Y E EF   S K+L +IGF I    ++CG AG  G 
Sbjct: 200 PLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257

Query: 276 IGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
           +G +YWR+PGA+            RF G VS+L+ AAF+F  TE + ITA E +NPRK++
Sbjct: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P A KKV++R L  Y+ S++ +GLLVPY+  +L  S+S  +  SP+++A+   G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLPH 376

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
             NAVIL ++ S A+S  Y  SR+L  L++   APK  +   + G P +   V A    +
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           A+   S+   +VF WLL I+G++  F W  I +SHIRF +A+K +G S DE+ +K+++  
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
             + YA   M +I+I Q +    P   G +   A+   +L + V+I+    ++      R
Sbjct: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----R 551

Query: 571 LFIRAKDIDLISHRHIHDPEILRQEREE 598
              +  D+D+ S R   D E +  E  E
Sbjct: 552 FIWKIGDVDIDSDR--RDIEAIVWEDHE 577

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  294 bits (752), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 170/540 (31%), Positives = 291/540 (53%), Gaps = 29/540 (5%)

Query: 83  DAKVEISQVDDELNEK------LKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAG 136
           D + + SQ D +L         +++ ++PRHV M++                  +AGP G
Sbjct: 32  DQEAQSSQ-DSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVG 90

Query: 137 LVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCV 196
            +I Y  M S  YC+ Q++GEMA  ++ +   F  +    +   L  +  ++YC  W   
Sbjct: 91  ALISYLFMGSIAYCVTQSLGEMA-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVT 149

Query: 197 CPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMI 256
             LEL      I+YWT+ V    ++ IF++ +   N+    + Y E +F     K++ +I
Sbjct: 150 YALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVP-VKFYGEFQFWIALIKVVAII 208

Query: 257 GFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDG-------PNRFKGVVSTLVTAAFS 309
           GF +  + ++CG AG  G +G +YWR+PG +   DG         RF G VS+LV AAF+
Sbjct: 209 GFLVYCLCMVCG-AGKTGPVGFRYWRNPGPW--GDGIISHDIHEGRFLGWVSSLVNAAFT 265

Query: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369
           +  TE + I+A E +NPRK +P A  KV +R LL Y+ S+  +GLLVP++  E L SS +
Sbjct: 266 YQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFND-EKLTSSDS 324

Query: 370 ATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFT 429
            +  SP+++A+   G +++P   NAVIL ++ S A+S  Y  SR+L  LA++  AP+ F 
Sbjct: 325 YSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFA 384

Query: 430 FVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFR 489
             +R G P +  L  A    + + + S+  ++ F+WLL I+ ++  F+W  I L H+RF 
Sbjct: 385 RTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFM 444

Query: 490 RAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDY 549
           +A+K+QG S D++ +K+++  WG+ Y+   + LI+I Q +  + P    + +V  FF  Y
Sbjct: 445 QALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAP----TFNVSNFFAAY 500

Query: 550 LAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVW 609
           +++ +F+V++  ++ W R  R+  R + +D+ S R     E+  Q+ +  +     G  W
Sbjct: 501 ISVFMFLVIWAVFQCWYRT-RIIHRIEHVDIDSDRR----EVDAQQWDNTEPTTLWGKFW 555

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  291 bits (746), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 167/490 (34%), Positives = 275/490 (56%), Gaps = 21/490 (4%)

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIY 189
           AHAGP G +I Y  M + IY + Q++GEMA  ++ +   F+ +    + PAL  +  ++Y
Sbjct: 21  AHAGPVGALISYIFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMY 79

Query: 190 CIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
            + W     LEL      IQYWT  V    +++IF+ L+  +N+F   + Y E EF   S
Sbjct: 80  WLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFP-VKYYGEFEFCIAS 138

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLV 304
            K++ ++GF I    ++CG    DG IG +YWR+PGA+            RF G VS+L+
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
            AAF++  TE + ITA E +NPRKA+P A KKV+ R L+ Y+ S+  +GLLVPY+  +L 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL- 257

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
            S  +   ASP+++++   G +V+P   NAV+LI++ S  +S  Y  SR+L +L++   A
Sbjct: 258 DSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           P+  + V + G P    L  +V   +AF   S+   + FNWLL I+G++  F W LI  S
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQA 544
           HIRF +A+  +G S +++ YK+++  + + YA   + LI++ Q +    P    S     
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SFQPVD 433

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
           F   Y+++ +F+ ++  +++W +   + ++ +D+D+ S R     EI   E + + E LR
Sbjct: 434 FVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDRR----EI---EEQVWIEPLR 485

Query: 605 NGPVWRRVYD 614
               W+ V+D
Sbjct: 486 KTK-WQCVWD 494

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  292 bits (747), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 173/532 (32%), Positives = 284/532 (53%), Gaps = 25/532 (4%)

Query: 85  KVEISQVDDELN-EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAI 143
           K EI ++  E+  E +++ ++ RH+ M++                  +AGP G +I Y  
Sbjct: 12  KEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLF 71

Query: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203
           MA+  Y + Q++GEMA  ++ +   F  +    V PA   +  ++Y   W     LEL  
Sbjct: 72  MATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 130

Query: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263
               IQ+WT  V    ++ IF++L+  +N+F   + Y E EF     K++ ++GF I   
Sbjct: 131 VGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGFLIYCF 189

Query: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTE 314
            ++CG AG  G +G +YWR PGAF    GP          RF G VS+L+ AAF+F  TE
Sbjct: 190 CMVCG-AGVTGPVGFRYWRHPGAF----GPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244

Query: 315 FLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS 374
            + ITA E +NPRK +P A KKV++R L  Y+ S+  +GLLVPYD  +L  S+ +   AS
Sbjct: 245 LVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLT-STDSYVSAS 303

Query: 375 PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRT 434
           P+++A+   G  V+PH  NAVI+ ++ S  +S  Y  SR++  L+    AP + +   + 
Sbjct: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363

Query: 435 GRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKV 494
           G P +  LV ++   +A+   S+   + FNWLL I+G++  FTW  I LSHIRF +A+++
Sbjct: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423

Query: 495 QGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPV 554
           +G S D++ +K++     + Y    M LI+I Q +    P      +   F   Y+++ +
Sbjct: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFM 478

Query: 555 FIVLYLGYKIWKRDWRLFIRAKDIDL-ISHRHIHDPEILRQEREEYQEKLRN 605
           FI +++ ++ W R  RL  R +D+D+    R + +   + QE   + +K  N
Sbjct: 479 FIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  294 bits (753), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 193/614 (31%), Positives = 320/614 (52%), Gaps = 46/614 (7%)

Query: 15  NDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPI 74
            DI K    F D +++   S++  Y+  + S  H              T+ H  +D+  +
Sbjct: 18  EDIEKQQL-FGDDNIVIERSSQLFYDGQSDSKVHGI------------TSGH-GSDVKNV 63

Query: 75  LSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGP 134
           ++H S FD     I         +LKK ++ RHV M++                 A AGP
Sbjct: 64  VTHTSEFDGKHDGI---------RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGP 114

Query: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194
           A ++I YA +   ++ ++  +GEMA  Y+ L  GF +Y     DPAL F++ + Y  +++
Sbjct: 115 AAILIAYAFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAYLFKYW 172

Query: 195 CVCPLELVTASMTIQYWTT--KVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKI 252
            + P +L   ++ IQYW    KVN  +++ I  + ++ IN F G R + E E+  ++ KI
Sbjct: 173 IIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN-FLGVRFFGEIEYYISAVKI 231

Query: 253 LMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG-----SDGPNRFKGVVSTLVTAA 307
            +M+G  IL +V+ CGG  N   +G KYW++PGAF+      +    RF    S  V A 
Sbjct: 232 TVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLAL 291

Query: 308 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS 367
           F++  TE   I  SE  NPRKA+P A K  +YR ++ YL SI ++G+ VP++   L+ + 
Sbjct: 292 FAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAK 351

Query: 368 SAATKAS--PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
           SA T AS  P+V+A+   G+ V+PH +NA ILI VFS A+S  Y +SR L  LA    AP
Sbjct: 352 SAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAP 411

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           ++F   ++ G P    LVG + A++A+   SS  +EVF + +    +  + +W  I +++
Sbjct: 412 RIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITY 471

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA-DVQA 544
           IRF +A +VQG     + Y+S +  +G+ ++    ILI + + +    P   G   D ++
Sbjct: 472 IRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF----PAFLGDTFDYKS 527

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
           F   Y+ +P +I+ Y+GYK+W +     I ++++DL+S +   D   L +E  +  ++ R
Sbjct: 528 FITGYIGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVD---LEEEEGKMLDEER 582

Query: 605 NGPVWRRVYDF-WC 617
              +     D  WC
Sbjct: 583 AAHLAAHGKDLKWC 596

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/556 (30%), Positives = 292/556 (52%), Gaps = 27/556 (4%)

Query: 65  HHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXX 124
           H  + D N   +  S  DD        D E  + +K+ ++ RH+ M++            
Sbjct: 9   HSFQVDSNDTPTTISTLDD--------DQEKQQDVKRELKKRHISMIALGGTIGTGLFLG 60

Query: 125 XXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFS 184
                  AGP G +I Y  M + ++ + Q++GEM   ++ +   F  +    + PA   +
Sbjct: 61  IARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAA 119

Query: 185 IAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETE 244
             ++Y   W     LEL      IQ+WT  V    ++ I ++L+   N+F   R Y E E
Sbjct: 120 NGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFP-VRIYGEIE 178

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGV 299
           F   S K+L ++GF I+  + I  GAG  G +G +YW++PG +       +    RF G 
Sbjct: 179 FWIASVKVLAILGF-IIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGW 237

Query: 300 VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYD 359
           VS+L+ AAF+F  TE + ITA E   PRK +P A KKV++R L+ Y+ S++++GLLVPY+
Sbjct: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297

Query: 360 SSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLA 419
             +L  S+ +   +SP+++ +   G +++PH  NAVILI++ S  +S  Y  SR+L  LA
Sbjct: 298 DPKL-QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356

Query: 420 RQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWA 479
           +   APK FT   + G P +  L  ++   +A+   ++   + F WLL I G++  F W 
Sbjct: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416

Query: 480 LICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGS 539
           LI  SHIRF +A+K +G S +++ YK+ +  W + YA   M++I++ Q +    P     
Sbjct: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----K 472

Query: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599
             V  FF  Y+++ +FI+ ++ ++IW +  RL  + +D+DL + R   + E+   + E+ 
Sbjct: 473 FKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED- 530

Query: 600 QEKLRNGPVWRRVYDF 615
               +N   W R +++
Sbjct: 531 ----KNKNWWDRFWNY 542

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  293 bits (750), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/517 (33%), Positives = 282/517 (54%), Gaps = 19/517 (3%)

Query: 90  QVDDE---LNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMAS 146
           Q +DE    N ++K+ ++ RH+ M++                 A+AGP G +I Y  M S
Sbjct: 72  QDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGS 131

Query: 147 CIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASM 206
             + + Q++GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL     
Sbjct: 132 LAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190

Query: 207 TIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVII 266
            IQ+WT KV    ++ IF++L+  +N+F   + Y E EF   S K++ +IGF I    ++
Sbjct: 191 VIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249

Query: 267 CGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITAS 321
           CG AG  G +G +YWR+PGA+       +    RF G VS+L+ AAF+F  TE + ITA 
Sbjct: 250 CG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308

Query: 322 EQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVS 381
           E +NPRK +P A KKV++R L  Y+ S++ +GLLVPY+  +L  ++S  +  SP+++A+ 
Sbjct: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS-TSPFIVAIQ 367

Query: 382 THGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGF 441
             G +V+PH  NAVIL ++ S A+S  Y  SR+L  L++   APK  +   + G P +  
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427

Query: 442 LVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDE 501
              AV   +A+   S+   +VF WLL I+G++  F W  I +SHIRF +A+K +G S DE
Sbjct: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 502 IGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLG 561
           + +K+++    + Y+   MI+I+I Q +    P   GS+ + A+   +L + V+I+    
Sbjct: 488 LPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547

Query: 562 YKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           ++      R   + +D+D+ S R   D E +  E  E
Sbjct: 548 FRC-----RFIWKIEDVDIDSDR--RDIEAIVWEDHE 577

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  292 bits (747), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 170/512 (33%), Positives = 279/512 (54%), Gaps = 24/512 (4%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           +  +K+ ++PRH+ M++                  +AGP G +I Y  + + I+ + Q++
Sbjct: 90  HRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSL 149

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEM V ++ +   F  +    + PA   +  ++Y   W     +EL      IQ+WTT V
Sbjct: 150 GEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAV 208

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               +++IF+ L+   N+F   + Y E EF     K+L ++GF I  + I   GAG  G 
Sbjct: 209 PLAAWIVIFWFLLTLSNMFP-VKYYGEIEFWIAFLKVLSLVGFLIFCLCI-TSGAGPHGP 266

Query: 276 IGGKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTEFLAITASEQSNP 326
            G +YWRDPGA+    GP          RF G VS+L+ AAF++  TE + ITA E +NP
Sbjct: 267 FGFRYWRDPGAW----GPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 322

Query: 327 RKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVR 386
           RKA+P A KKVI R L  Y+ S+  +G+LVP++  +L  S+++   +SP+++A+   GV 
Sbjct: 323 RKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLT-SATSFVSSSPFIIAIQNSGVS 381

Query: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446
           ++P   N VILI++ S  +S  Y  SR+L  LA    AP+ FT   +TG P +  L  ++
Sbjct: 382 LLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSL 441

Query: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506
              +AF   ++   +VFNWLL+I  ++  F W LI LSHIRF +A++ +G S + + +K+
Sbjct: 442 FGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKA 501

Query: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
               W + YA   +ILI++ Q +    P      +V  F   Y+++ +F++++  ++  K
Sbjct: 502 IFMPWLAYYATAFIILIILIQGFTAFAP----RFNVSDFVASYISLLLFVIIWGVFQAMK 557

Query: 567 RDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           +  R+F + +DIDL S R   D E +R E + 
Sbjct: 558 KC-RIFWKVEDIDLDSDR--KDIEDIRWEDDS 586

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/549 (30%), Positives = 296/549 (53%), Gaps = 16/549 (2%)

Query: 55  IDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEK--LKKTIQPRHVVMMS 112
           + SF+     H  E  +       S+ D    + SQ+D   +++  +++ ++PRHV M++
Sbjct: 3   MQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIA 62

Query: 113 XXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAY 172
                              AGP G +I Y  M S  + + Q++GEMA  ++ +   F  +
Sbjct: 63  LGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMA-TFIPVASSFTVF 121

Query: 173 PGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAIN 232
               + PAL  +  ++YC  W     LEL      IQYWT  V    +++IF++ +   N
Sbjct: 122 TRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSN 181

Query: 233 IFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF----- 287
           +    + Y E +F     K++ ++GF I  + ++CG AG  G +G +YWR+PG +     
Sbjct: 182 LVS-VKFYGEFQFWIALIKVIAIVGFLIYCLCMVCG-AGKTGPVGFRYWRNPGPWGDGII 239

Query: 288 RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
             S    RF G VS+LV AAF++  TE + ++A E +NPRK +P A +KV  R LL Y+ 
Sbjct: 240 SKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVG 299

Query: 348 SIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSA 407
           S+  +GLLVP++  +L  S++  + +SP+++A+   G R +P   NAVIL ++ S A+S 
Sbjct: 300 SLFFIGLLVPFNDPKL-DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANSN 358

Query: 408 FYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLL 467
            Y  SR+L  LA++G APK+   ++R G P +   + ++   + + + SS   + F+WLL
Sbjct: 359 VYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLL 418

Query: 468 AISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQ 527
            I+ ++  F W  I L HIRF +A+K QG S D++ +K+++  WG+ YA   ++LI+I Q
Sbjct: 419 NITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQ 478

Query: 528 CWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIH 587
            +    P      +V  FF  Y+++ +FI +++ +++  +  RL  + +D+D+ S R   
Sbjct: 479 GFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFKS-RLIHKVEDVDIDSDRREI 533

Query: 588 DPEILRQER 596
           + E+   + 
Sbjct: 534 EAEVWEDDE 542

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  291 bits (744), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 275/495 (55%), Gaps = 15/495 (3%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           ++ +++ ++ RH+ M++                 ++AGP G +I Y  M + +Y + Q++
Sbjct: 103 DKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSL 162

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +      +    + PA   S  ++Y   W     +E+      I+YWTTKV
Sbjct: 163 GEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
              +++ IF++L+  +N F   + Y E EF   S K+L ++G+ I  +VI+CGG+   G 
Sbjct: 222 PLGVWIAIFWVLITLMNFFP-VKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGP 279

Query: 276 IGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
           IG +YWR+PGA+            RF G VS+L+ AAF++  TE + ITA E +NPRK +
Sbjct: 280 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 339

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P A  KV++R +L Y+ S+  +GLLVPY    L  +SSA   +SP+V+++   G   +P 
Sbjct: 340 PRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLS-ASSAVIASSPFVISIQNAGTYALPD 398

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
             NA++LI+V S A+S  Y  SR+L +LA+ G APK F +V + G P LG L  A + ++
Sbjct: 399 IFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 458

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           AF   ++     FNWL+ IS L+ +  W  I LSHIRF +A+  +G S D++ +K++   
Sbjct: 459 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMP 518

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
           +G+ YA   + +I+  Q +    P       V  FF  Y+++ +  V++ G +++ +  R
Sbjct: 519 YGAYYASFFVTVIIFIQGFQSFCPF-----RVADFFTSYISLILLAVVFTGCQLYYKC-R 572

Query: 571 LFIRAKDIDLISHRH 585
              + +DID+ S R 
Sbjct: 573 FIWKLEDIDIDSDRR 587

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  290 bits (743), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 277/495 (55%), Gaps = 15/495 (3%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           ++ +K+ ++ RH+ M++                 + AGP G +I Y  M + +Y I Q++
Sbjct: 104 DKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSL 163

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +      +    + PA   +  ++Y   W     +E+      IQYWT KV
Sbjct: 164 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
              +++ IF++L+  +N F   + Y E EF   S K+L ++G+ I  +VI+CGG+ + G 
Sbjct: 223 PLAVWIAIFWVLITLMNFFP-VKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGP 280

Query: 276 IGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330
           IG +YWR+PGA+            RF G VS+L+ AAF++  TE + ITA E +NPRK +
Sbjct: 281 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 340

Query: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390
           P A  KV++R +L Y+ S+  +GLLVPY+   L  +SSA   +SP+V+++   G   +P 
Sbjct: 341 PRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLS-ASSAVIASSPFVISIQNAGTYALPD 399

Query: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450
             NAV+LI+V S A+S  Y  SR+L +LA+ G APK F +V + G P LG L  A + ++
Sbjct: 400 IFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 459

Query: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510
           AF   ++     FNWL+ IS L+ +  W  I L+HIRF +A++ +G S D++ +K+++  
Sbjct: 460 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMP 519

Query: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
           +G+ YA   + +I+  Q +    P       V  FF  Y+++ +  V++ G +++ +  R
Sbjct: 520 YGAYYAAFFVTVIIFIQGFQAFCPF-----KVSDFFTSYISLILLAVVFTGCQLYYKC-R 573

Query: 571 LFIRAKDIDLISHRH 585
              + +DID+ + R 
Sbjct: 574 FIWKLEDIDIDTDRR 588

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  289 bits (739), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 175/534 (32%), Positives = 295/534 (55%), Gaps = 15/534 (2%)

Query: 70  DMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXX 129
           +++ +     ++D A+ E  + D    E +K+ ++PRHV M++                 
Sbjct: 45  ELSDVQVSSELYDHAESEEGEGDFHETE-VKRALKPRHVSMIALGGTIGTGLFVGIAKPL 103

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIY 189
           + +GP G +I Y  M S +Y + Q++GEMA  ++ +      +    + PA   +  ++Y
Sbjct: 104 SLSGPVGSLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMY 162

Query: 190 CIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNS 249
              W     +EL      I YWT  V    ++ IF++L+ A N F   + Y E EF   S
Sbjct: 163 WFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFP-VKWYGEFEFCVAS 221

Query: 250 CKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-RGSDGPN----RFKGVVSTLV 304
            K++ ++G+ +  ++I+CGG+ + G IG +YWR+PG +  G+   N    RF G V +LV
Sbjct: 222 IKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLV 280

Query: 305 TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL 364
            A+F++  TE + ITA E SNPRK +P A  KV +R L+ Y+ S+  VGLLVPY+S +L 
Sbjct: 281 NASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL- 339

Query: 365 GSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYA 424
            S+SA   +SP+V+++   G +V+P   NAV+L+++ S  +S  Y  SR+L +LA  G A
Sbjct: 340 ESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNA 399

Query: 425 PKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLS 484
           PK F++V + G P LG +  A++ ++AF A +      FNWL+ IS L+ +  W  I ++
Sbjct: 400 PKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVA 459

Query: 485 HIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQA 544
           HIRF + +K++G S D + +K+++  WG+ YA   + LI+  Q +    P      DV  
Sbjct: 460 HIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP----RFDVSE 515

Query: 545 FFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           FF  Y+++ + +VL++  +++ R  R   + +DID+ S R   D  I   +  +
Sbjct: 516 FFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRREIDAIIWEDDEPK 568

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 163/491 (33%), Positives = 272/491 (55%), Gaps = 13/491 (2%)

Query: 75  LSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGP 134
           L+ +++ DD+             ++K+ ++PRHV M++                  +AGP
Sbjct: 49  LTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGP 108

Query: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194
            G +I + ++ +  Y + Q++GEMA  ++ +   F  +    + PA+  +  ++Y   W 
Sbjct: 109 VGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWA 167

Query: 195 CVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILM 254
               LEL      IQYWT  V  + ++ IF++L+++ N+F   + Y E EF   S K++ 
Sbjct: 168 ITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFP-VKWYGEFEFWVASIKVIA 226

Query: 255 MIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-RGSDGPN----RFKGVVSTLVTAAFS 309
           +IGF I  + ++CG AG +G IG +YWR PG +  G    N    RF G VS+L++AAF+
Sbjct: 227 IIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFT 285

Query: 310 FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSA 369
           +  TE + ITA E  NPRKA+P A  KV +R L+ Y+ S+  +GLLVPY+  +L GS + 
Sbjct: 286 YQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNG 345

Query: 370 ATKA-SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428
           +  A SP+++A+      V+PH  NAVIL ++ S  +S  Y  SR+L  L++   APK F
Sbjct: 346 SYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFF 405

Query: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488
           +   + G P +  L+ AV   +A+   S+   EVF+WLL I+ ++   TW LI +SHIRF
Sbjct: 406 SKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRF 465

Query: 489 RRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQD 548
            + +K +G S D++ YK++   + + YA   + +I+I Q +    P      +V  FF  
Sbjct: 466 MQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAP----HFNVSDFFAA 521

Query: 549 YLAMPVFIVLY 559
           Y+++ +F +++
Sbjct: 522 YISVFLFFIVW 532

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/540 (30%), Positives = 293/540 (54%), Gaps = 25/540 (4%)

Query: 56  DSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNE-KLKKTIQPRHVVMMSXX 114
            S++  +   H  T+    +  Q   +  + EI+  + ++ E ++K+ ++ RH+ M++  
Sbjct: 17  SSYELDDYPLHRRTNSVHSIPSQITIESQEEEIA--NGQIREAEVKRELKQRHIGMIALG 74

Query: 115 XXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPG 174
                           +AGP G +I Y  M + +Y + Q++GEMA  ++ +   F  +  
Sbjct: 75  GTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMA-TFIPVTSSFTVFSQ 133

Query: 175 FLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIF 234
             + P+   +  ++Y   W     LEL      IQ+WT+ V    ++ IF++L++A+N+F
Sbjct: 134 RFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMF 193

Query: 235 GGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN 294
              R Y E EF   S K+L ++GF I  + ++CG AG  G +G +YWR+PG      GP 
Sbjct: 194 P-VRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPM----GPG 247

Query: 295 ---------RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIY 345
                    +F G VS+L+ AAF++  TE + ITA E +NPRK++P A KKV++R L  Y
Sbjct: 248 IIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFY 307

Query: 346 LASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVAD 405
           + S+  +GLLVPY+  +L  S  +   ASP+++++   G  ++PH  NAVIL ++ S A+
Sbjct: 308 IGSLFFIGLLVPYNDPKLT-SDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAAN 366

Query: 406 SAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNW 465
           S  Y  SR++  L++   AP++ +  ++ G P +  +   +   +A+   S+     FNW
Sbjct: 367 SNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNW 426

Query: 466 LLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMI 525
           LL I+G++  F+W  I +SH+RF +A++ +G S D++ +K++     + YA   M LI+I
Sbjct: 427 LLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIII 486

Query: 526 GQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRH 585
            Q +    P    S D   F   Y++  +FI +++ +++W R  RL  + +D+D+ + R 
Sbjct: 487 IQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-RLIWKIEDVDIDTDRR 541

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  286 bits (732), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 275/500 (55%), Gaps = 15/500 (3%)

Query: 92  DDELNE-KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYC 150
           + +++E ++K+ ++ RH+ M++                 ++AGP G +I Y  MA+ +Y 
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 151 IIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQY 210
           ++Q++GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL      I++
Sbjct: 129 VVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187

Query: 211 WTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270
           WTT V    ++ IF++L+   N+F   + Y E EF     K++ ++GF I  + ++CG A
Sbjct: 188 WTTAVPMAAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245

Query: 271 GNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN 325
           G  G +G +YWR+PGA+            RF G VS+L+ AAF++  TE + ITA E +N
Sbjct: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGV 385
           PRK++P A KKV++R L+ Y    + +GLLVPY+  +L  SS +   +SP+++A+   G 
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGT 364

Query: 386 RVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGA 445
           +V+PH  NAV+L ++ S  +S  Y  SR++  LA+   AP  F   +  G P       +
Sbjct: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424

Query: 446 VIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYK 505
               +A+   S+     FNWLL I+G++  FTW LI   HIRF +A+K +G S D++ +K
Sbjct: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484

Query: 506 SQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIW 565
           ++   W + YA   M++I++ Q +    P   G      F   Y+++ +FI ++LG +IW
Sbjct: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIW 540

Query: 566 KRDWRLFIRAKDIDLISHRH 585
            R  R+F R  ++D+ + R 
Sbjct: 541 FRC-RIFHRLDEVDIDTDRR 559

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  285 bits (730), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 158/537 (29%), Positives = 282/537 (52%), Gaps = 22/537 (4%)

Query: 84  AKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAI 143
           +K  +S+ + +   ++K+ +  RH+ M++                   +GP G +I Y  
Sbjct: 45  SKENVSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLF 104

Query: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203
           + + +Y + Q++GEMA  ++ +   F  +    + PAL  +  ++Y   W     LEL  
Sbjct: 105 LGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163

Query: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263
               IQ+WT  V    ++ IF++++   N+F   R Y E EF     K+  ++GF I   
Sbjct: 164 VGQIIQFWTFAVPLPAWISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCF 222

Query: 264 VIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318
            I+CG AG  G +G +YWR+PG +       +    RF G  S+L+ AAF+F  TE + I
Sbjct: 223 CIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281

Query: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVL 378
           TA E +NPR+ +P A +KV++R L+ Y+ S+  +GLLVPYD  +L  S ++   +SP+++
Sbjct: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFII 340

Query: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438
           A+   G +++PH  N VIL+++ S  +S  Y  SR+L  LA+ G  PK+F    ++G P 
Sbjct: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400

Query: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498
              +  ++   +AF   S+   E F WLL + G++  F+W LI  +HIRF + ++ +G S
Sbjct: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460

Query: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVL 558
            +++ +K++   + + YA ++MI+I+  Q +    P      DV  FF  Y+++ +F + 
Sbjct: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIF 516

Query: 559 YLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDF 615
           +  +++W +  R   +  DID+   R        R+  +   +      +W + +DF
Sbjct: 517 WGSFQLWFKC-RYVWKLVDIDIDKDR--------REIEDRVWQDTTPANLWGKFWDF 564

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  284 bits (727), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/517 (31%), Positives = 273/517 (52%), Gaps = 16/517 (3%)

Query: 89  SQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCI 148
           ++  D    ++K+ ++ RH+ M++                   AGP G ++ Y  + + +
Sbjct: 45  TEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVV 104

Query: 149 YCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTI 208
           Y I Q++GEMA  ++ +      +    + PA   +  ++Y   W     +EL      I
Sbjct: 105 YSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQII 163

Query: 209 QYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICG 268
           QYWT +V    +++IF++LV  +N F   R Y E EF   S K+L ++G+ I   +I+CG
Sbjct: 164 QYWTDRVPIAAWIVIFWVLVTLVNFFP-VRFYGEIEFWIASVKVLTIVGYLIYAFIIVCG 222

Query: 269 GAGNDGFIGGKYWRDPGAFRGSDGPNR-------FKGVVSTLVTAAFSFGQTEFLAITAS 321
           G+   G IG        A RG+   +R       F G VS+L+ AAF++  TE + ITA 
Sbjct: 223 GS-KQGPIGLPATGGIPA-RGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAG 280

Query: 322 EQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVS 381
           E +NPRK +P A  KV +R L  Y+ S++ VGLLVPYD   L   SS    ASP+V+++ 
Sbjct: 281 ESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIK 340

Query: 382 THGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGF 441
             G +++P   NAV+LI+V S A+S  Y  SR+  +LA  G APK   FV + G P  G 
Sbjct: 341 NAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGV 400

Query: 442 LVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDE 501
           L+ +++ +M+F   +   +  F+WL+ IS L+ +  W  I L+HIRF + +K +G S D+
Sbjct: 401 LITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDD 460

Query: 502 IGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLG 561
           + +K++   W + YA   + +I+  Q +    P      DV  FF  Y+++ + +++++G
Sbjct: 461 LPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISLFLMLLVFIG 516

Query: 562 YKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
            +I+ +  R     +DID+ S R   D  +  ++  +
Sbjct: 517 CQIYYKC-RFLWAVEDIDIDSDRREIDAIVWEEDEPK 552

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/492 (31%), Positives = 263/492 (53%), Gaps = 22/492 (4%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           + ++K+ ++PRH+ M++                 A AGP G +I Y  M +  Y + Q++
Sbjct: 79  DAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSL 138

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL      IQ+WT  V
Sbjct: 139 GEMA-TFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAV 197

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               ++ IF++++   N+F   + Y E EF     K+L ++GF I   +++CG AG  G 
Sbjct: 198 PLGAWIAIFWVILTTSNLFP-VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 255

Query: 276 IGGKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTEFLAITASEQSNP 326
           +G +YWR+PG +    GP          RF G VS+L+ AAF++  TE + ITA E  NP
Sbjct: 256 VGFRYWRNPGPW----GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNP 311

Query: 327 RKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVR 386
           R+ +P A  KV +R L  Y+ S++ +GLLVP++  +L  S  +   +SP+V+A+   G +
Sbjct: 312 RRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL-KSEDSYISSSPFVIAIENSGTK 370

Query: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446
           V+PH  NAVIL ++ S  +S  Y  SR+L  LA+   APKVF    + G P +  L  A 
Sbjct: 371 VLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAA 430

Query: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506
              +A+   S+   +VF+WLL I+ ++  F W  I L+HIRF + +K +  S +++ +K+
Sbjct: 431 FGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKA 490

Query: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
           +   WG+ Y+   + LI+I Q +    P      +V  FF  Y+++ +F+ +++ ++I  
Sbjct: 491 KFMPWGAYYSAFFISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 567 RDWRLFIRAKDI 578
           R  R  +   D+
Sbjct: 547 RT-RFILTKNDV 557

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  283 bits (723), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 166/516 (32%), Positives = 281/516 (54%), Gaps = 22/516 (4%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
            + LKK +Q RHV M++                 + AGPA + I Y+ +   ++  + A+
Sbjct: 96  TDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAI 155

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK- 214
           GEMA +Y+ +  GF +Y    VDPAL F++ + Y  ++  +CP +L  AS+ IQYW  + 
Sbjct: 156 GEMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213

Query: 215 -VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND 273
            VN  +++ IF ++++ IN+  G + + E EF  +S K+L+M+G  +L  +++ GG  + 
Sbjct: 214 TVNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDH 272

Query: 274 GFIGGKYWRDPGAFR----GSDGP-NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
             +G +YW+ PGAF+      DG   +F   VS  V A F++   E   I A+E  NPRK
Sbjct: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTHGVR 386
           ++P A K  ++R ++ YL +I ++G+ V Y+   LL +  A T A  SP+V+A+   G+R
Sbjct: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIR 392

Query: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446
           V+PH  NA +LI VFS  +S  Y  SR L +LA  G AP +F      G P     V  +
Sbjct: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452

Query: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506
            A++A+   SS   +VFN+ + +  +  + +W  I +++I F RA+KVQG    +  Y +
Sbjct: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512

Query: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
               +G+ ++    + I   + +   V +G  S D + F   Y+ +PVF++ Y GYK  K
Sbjct: 513 PFQPYGTYFSLAWCVFIAFIKNFT--VFLGH-SFDYKNFITGYIGLPVFVIFYFGYKFIK 569

Query: 567 RDWRLFIRAKDIDLISHRHIHDPE-----ILRQERE 597
           +     +++ ++DL + + + D +     IL QE++
Sbjct: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  280 bits (715), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 278/499 (55%), Gaps = 18/499 (3%)

Query: 80  VFDDAKVEISQVDDELNEK-LKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLV 138
           V +    E+  + ++ N+  +K+ ++PRHV M+S                  +AGP G +
Sbjct: 29  VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSL 88

Query: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198
           + Y  +A+  YC+ Q++GEMA  ++ +   F  +    V PAL  +  ++Y + W     
Sbjct: 89  LAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFA 147

Query: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGF 258
           LE+      I YW+  V    ++ IF++L+ AIN+    + Y E EF   S K++ ++ F
Sbjct: 148 LEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVIAILCF 206

Query: 259 FILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQT 313
              G+V++CGG+   G IG +YW+DPG +            +F G VS+L+ AAF+F  T
Sbjct: 207 LFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGT 265

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL--GSSSAAT 371
           E + +TA E  NPR+ +P A   V +R LL Y+ S++++GLLV YD  +L+  GS++ A 
Sbjct: 266 ELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNA- 324

Query: 372 KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431
            ASP+V+A++  G +V+P  +N VI++++ S  +S  Y  SR+L  L R G AP   +  
Sbjct: 325 NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRT 384

Query: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491
              G P +  L  ++   + +   SSK   VF+WLL+I+ +S  FTW LI +SHIRF + 
Sbjct: 385 TSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQC 444

Query: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551
           +K +G S D++ +K++   +G+ YA   +I+I++ Q +    P    + D  A+   Y++
Sbjct: 445 LKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF--SAVDFVAY---YIS 499

Query: 552 MPVFIVLYLGYK-IWKRDW 569
             +F+V++L ++ ++K  W
Sbjct: 500 AFIFVVIWLLFQFLFKGRW 518

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  278 bits (710), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 276/512 (53%), Gaps = 24/512 (4%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           + ++K+ ++ RH+ M++                   AGP G +I Y  M + +Y + Q++
Sbjct: 70  DAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSL 129

Query: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215
           GEMA  ++ +   F  +    + P++  +  ++Y   W     LEL      IQYWT  V
Sbjct: 130 GEMA-TFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
               ++ IF++++ A N+F   + Y E EF     K++ ++GF +  + ++CG AG  G 
Sbjct: 189 PLAAWISIFWVVITAGNMFP-VKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCG-AGVTGP 246

Query: 276 IGGKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTEFLAITASEQSNP 326
           +G +YWR+PG +    GP          RF G VS+L+  AF++  TE + I+A E +NP
Sbjct: 247 VGFRYWRNPGPW----GPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANP 302

Query: 327 RKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVR 386
           RKA+P A KKV++R L  Y+ S+  +GLLVPY+  + L ++ +   +SP+++A+   G  
Sbjct: 303 RKAVPRAIKKVVFRILFFYIGSLFFIGLLVPYND-DALNNTDSYVASSPFIIAIKNSGTP 361

Query: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446
           V+PH  NAVI  ++ S  +S  Y  SR+L  L++   APK+ +   + G P +  LV +V
Sbjct: 362 VLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSV 421

Query: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506
           +  +A+   S+     FNWLL I+ ++  FTW  I LSHIRF +A+K +G S D++ +K+
Sbjct: 422 VGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKA 481

Query: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
            +    + YA  +M +I+I Q +    P   GS     F   Y+++ +FI ++  ++I  
Sbjct: 482 ALMPGLAYYASFLMFVIIIIQGFTAFAPKFSGS----DFAAAYISIFLFIGIWCLFQIIF 537

Query: 567 RDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598
           R  R   + +D+D+ + R   D E +  E  E
Sbjct: 538 RC-RFIHKVEDVDIDTDR--RDIEAVVWEDAE 566

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  275 bits (702), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/457 (33%), Positives = 250/457 (54%), Gaps = 17/457 (3%)

Query: 98  KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGE 157
           ++K+ ++ RH+ M++                  +AGP G +I Y  MA+ ++ + Q++GE
Sbjct: 96  EVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGE 155

Query: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217
           MA  ++ +   F  +    + PA+  +  ++Y   W     LEL      IQ+WT  V  
Sbjct: 156 MA-TFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPL 214

Query: 218 DIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIG 277
             +++I+++++  +N+F   + Y E EF   S K+L +IGF I  + ++CG AG  G +G
Sbjct: 215 SAWIVIWWVILTIMNLFP-VKFYGEFEFWVASIKVLAIIGFLIYCLCMVCG-AGVTGPVG 272

Query: 278 GKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
            +YWR+PG +    GP          RF G VS+L+ AAF++  TE + ITA E +NPRK
Sbjct: 273 FRYWRNPGPW----GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 328

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVV 388
            +P A KKV +R L+ Y+ S+  +GLLVPYD  E L S+ +   ASP+++A+   G +++
Sbjct: 329 TVPRAIKKVTFRILIFYILSLFFIGLLVPYDD-EKLTSTDSYISASPFIIAIENSGTKIL 387

Query: 389 PHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIA 448
           PH  NAVIL ++ S  +S  Y  SR+L  LA+   APK F +  R G P       +   
Sbjct: 388 PHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFG 447

Query: 449 VMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQV 508
            +AF   SS   + FNWLL I  ++  F W LI ++H+RF +A+K +G S D++ +K++ 
Sbjct: 448 ALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARF 507

Query: 509 GVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAF 545
               + Y+   M +I+I Q +    P   GS  V A+
Sbjct: 508 MPHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAY 544

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  273 bits (699), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 159/550 (28%), Positives = 290/550 (52%), Gaps = 29/550 (5%)

Query: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXX 127
           +TD +     + + +   V  ++V  EL +        RH+ M++               
Sbjct: 39  QTDASSTTEDEEMLNSGSVHDAEVKRELKQ--------RHIGMIALGGTIGTGLFIGIST 90

Query: 128 XXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187
               +GP G +I Y  + +  Y + Q++GEMA  ++ +   F  +    + P++  ++ +
Sbjct: 91  PLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMA-TFIPVTSSFTVFASRFLSPSIGAAVGY 149

Query: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247
           +Y   W     LEL      + YWT  V    ++ IF++++ A+N+F   + Y E EF  
Sbjct: 150 MYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFP-VKFYGEIEFWV 208

Query: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----------RGSDGPNRF 296
            + K++ ++GF I  + ++CG AG  G +G +YWR+PG +             +    RF
Sbjct: 209 AAVKVVAIVGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRF 267

Query: 297 KGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356
            G  ++L+ AAF++  TE + ITA E +NPRK +P A KKV++R LL Y+ S+  +GLLV
Sbjct: 268 LGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLV 327

Query: 357 PYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLL 416
           P+D  +L  S  +   +SP+++A+   G +++P   NA+ILI++ S  +S  Y  SR+L 
Sbjct: 328 PFDDPKLS-SDDSYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILF 386

Query: 417 TLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVF 476
           +LA+ G APK+ +   + G P +  L  AV  V+A+   +     VF+WL+ I+ ++  +
Sbjct: 387 SLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFW 446

Query: 477 TWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVG 536
            W  I +SHIRF + +K +G S D++ +K+ +    + YA   M++I+I Q +    P  
Sbjct: 447 AWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP-- 504

Query: 537 EGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQ-E 595
             + DV  FF  Y+++ +F +++  +++W +  R   + +D+D+ S+R   +  I    E
Sbjct: 505 --TFDVSDFFAAYISVILFFLIWGAFQLWFKC-RWIWKLEDVDIDSNRRDVEKIIWEDPE 561

Query: 596 REEYQEKLRN 605
            + + +K  N
Sbjct: 562 PKTFWDKFWN 571

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  274 bits (700), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 176/541 (32%), Positives = 292/541 (53%), Gaps = 31/541 (5%)

Query: 83  DAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYA 142
           D    I+   DE N +LKK ++ RH+ M++                    GP  ++I YA
Sbjct: 65  DDSFAIADGKDE-NTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYA 123

Query: 143 IMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELV 202
            +   ++  +  +GEMA +Y+ L  GF +Y    VDPAL F+I + Y  ++F + P +L 
Sbjct: 124 FVGLLVFFTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181

Query: 203 TASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFI 260
            A++ IQYW ++  VN  +++ IF ++++AINI G  + + E EF  +S K+++M+G  +
Sbjct: 182 AAALVIQYWISRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKVMVMLGLIL 240

Query: 261 LGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQT 313
           L  +I+ GG  +   +G +YWRDPGAF+       GS G  +F   V+  V + FS+   
Sbjct: 241 LLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGI 298

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS--SAAT 371
           E   I  SE  NPRK++P A K  +YR ++ YL ++ ++G+ V Y+   LL +   S + 
Sbjct: 299 ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA 358

Query: 372 KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431
            ASP+V+A+   G++V+PH  NA +L+ VFS  +S  Y SSR L  LA  G APK+F   
Sbjct: 359 AASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 418

Query: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491
            + G P    ++  +   +A+   SS   ++FN+ + +  +  + +W  I + +I F +A
Sbjct: 419 SKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA 478

Query: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551
            + QG    +  Y +    +G+ +A    ILI + + +   V +G    D + F   Y+ 
Sbjct: 479 CRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFT--VFLGH-KFDYKTFITGYIG 535

Query: 552 MPVFIVLYLGYK-IWKRDWRLFIRAKDIDLISHRHIHDPE-----ILRQEREEYQEKLRN 605
           +PV+I+ + GYK I+K      I++ D+DL + + I+D E     I  QEREE  +  RN
Sbjct: 536 LPVYILSWAGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ--RN 590

Query: 606 G 606
           G
Sbjct: 591 G 591

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  273 bits (698), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/554 (30%), Positives = 294/554 (53%), Gaps = 29/554 (5%)

Query: 69  TDMNPILSHQSVFDDAKVEISQVDDELNE--KLKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
            DM+ + +  S  +D++ +   +DD  +E  +L+K ++ RH+ M++              
Sbjct: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTG 113

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
                AGP  + I YA +   ++  + A+GEMA +Y+ L  GF +Y     DPAL F++ 
Sbjct: 114 NSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFAVG 171

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETE 244
           + Y  ++  + P +L  A++ IQYW  +  VN  +++ IF ++++A+N F G + + E E
Sbjct: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN-FIGVKFFGEFE 230

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFK 297
           F  ++ K+++MIG  IL  VI+ GG      +G +++  PGAF+       GS G  +F 
Sbjct: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG--KFV 288

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
             V+ LV A F++   E   I A+E +NPRK+IP A K  +YR ++ YL +I ++G+ V 
Sbjct: 289 AFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVA 348

Query: 358 YDSSELLGSSSAAT--KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRML 415
           YD   L  + ++ T   ASPYV+A+   G++ +PH  NA +L+ VFS  +S  Y +SR L
Sbjct: 349 YDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTL 408

Query: 416 LTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQV 475
             LA    APK+F   +R G P    L+ +   ++A+ + SS   ++FN+ + +  +  +
Sbjct: 409 YGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGL 468

Query: 476 FTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV 535
            +W  I ++++ F RA+K Q        Y++    +GS +     ILI   + +   +  
Sbjct: 469 LSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-- 526

Query: 536 GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD--WRLFIRAKDIDLISHRHIHDPEILR 593
                D + F   Y+ +PVF++ Y GYK  K+   W    + +++DL + +   D E  +
Sbjct: 527 -NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQ 581

Query: 594 QE--REEYQEKLRN 605
            +    E +E+L+N
Sbjct: 582 GKIADAERRERLKN 595

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  273 bits (697), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/476 (32%), Positives = 256/476 (53%), Gaps = 12/476 (2%)

Query: 98  KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGE 157
           ++K+ ++PRH+ M++                  +AGP G +I Y  M + ++ + Q++GE
Sbjct: 101 QVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160

Query: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217
           MA  ++ +   F  +    V      +  ++Y   W     LEL      I++WT KV  
Sbjct: 161 MA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219

Query: 218 DIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIG 277
             ++ IF++L++ +N F   + Y E EF   S K++ +IGF I  + ++CG AG  G +G
Sbjct: 220 AAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVG 277

Query: 278 GKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPS 332
            +YWR PG +            RF G VS+L+ AAF++  TE + ITA E +NPRK++P 
Sbjct: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 333 AAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFI 392
           A KKV  R LL Y+ S+  +GLLVPY+  + L S+ +   ASP+++A+   G +V+PH  
Sbjct: 338 AIKKVSVRILLFYILSLFFIGLLVPYNDPK-LSSTDSYVSASPFIIAIQNSGTKVLPHIF 396

Query: 393 NAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAF 452
           NAVIL ++ S A+S  Y  SR+L  L+    APK F    R G P +  L  A    +A+
Sbjct: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFGALAY 455

Query: 453 CACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWG 512
              S+     FNWLL I+G++  F W  I +SHIRF + +K +G S D++ YK+ +    
Sbjct: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515

Query: 513 SAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIV--LYLGYKIWK 566
           + Y    + LI++ Q +    P  + +A + A+   +L + ++IV   Y   ++W+
Sbjct: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  272 bits (696), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/535 (31%), Positives = 289/535 (54%), Gaps = 22/535 (4%)

Query: 83  DAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYA 142
           D    +    DE N +L+K ++ RH+ M++                    GP  ++I YA
Sbjct: 67  DDSFAVPDGKDE-NTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYA 125

Query: 143 IMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELV 202
            +   ++  +  +GEMA +Y+ L  GF +Y    VDPAL F+I + Y  ++F + P +L 
Sbjct: 126 FVGLLVFYTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183

Query: 203 TASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFI 260
            A++ IQYW ++  VN  +++ IF ++++AIN+ G  + + E EF  +S K+++M+G  +
Sbjct: 184 AAALVIQYWISRDRVNPGVWITIFLVVIVAINVVG-VKFFGEFEFWLSSFKVMVMLGLIL 242

Query: 261 LGIVIICGGAGNDGFIGGKYWRDPGAFRG-----SDGPNRFKGVVSTLVTAAFSFGQTEF 315
           L  +I+ GG  N   +G +YWRDPGAF+      + G  +F   V+  V + FS+   E 
Sbjct: 243 LLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIEL 302

Query: 316 LAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS--SAATKA 373
             I  SE  NPRK++P A K  +YR ++ YL ++ ++G+ V Y+   LL +   S +  A
Sbjct: 303 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 362

Query: 374 SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDR 433
           SP+V+A+   G+ V+PH  NA +L+ VFS  +S  Y SSR L  LA  G APK+F    R
Sbjct: 363 SPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSR 422

Query: 434 TGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMK 493
            G P    ++  +   +A+   SS   ++FN+ + +  +  + +W  I + +I F +A +
Sbjct: 423 WGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 482

Query: 494 VQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMP 553
            QG    +  Y +    +G+ +A    ILI + + +   V +G    D + F   Y+ +P
Sbjct: 483 AQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFT--VFLGH-KFDYKTFITGYIGLP 539

Query: 554 VFIVLYLGYK-IWKRDWRLFIRAKDIDLISHRHIHD--PEILRQEREEYQEKLRN 605
           V+I+ + GYK I+K      I++ D+DL + + I+D   E  R + +E +E+L++
Sbjct: 540 VYIISWAGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  271 bits (692), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 172/570 (30%), Positives = 285/570 (50%), Gaps = 35/570 (6%)

Query: 62  ETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXX 121
           + +  I +  N  +  + +FDD K E          +LKK ++ RHV M++         
Sbjct: 35  QNSISIASSRNSSIGDRDIFDDGKTE--------GFRLKKNLKARHVSMIAIGGSLGTGL 86

Query: 122 XXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPAL 181
                   A AGP  L I Y+ +   ++  +  +GEMA      + GF +Y    VDPAL
Sbjct: 87  LIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAA--FIPLDGFTSYASRYVDPAL 144

Query: 182 NFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARG 239
            F++ + Y  ++  +   +L   +M +QYW  +  +N  +F+ IF IL++ INIFG  + 
Sbjct: 145 GFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTINIFG-VKI 203

Query: 240 YAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR--------GSD 291
           + E EF  +S K+L+M+G  +L  +I+ GG  N   +G +YWRDPG+F+         S 
Sbjct: 204 FGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISG 263

Query: 292 GPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIII 351
              +F    S  V A F +   E   I A+E  NPRK IP A K  +YR ++ Y+ +I++
Sbjct: 264 STGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILL 323

Query: 352 VGLLVPYDSSELLGSSSAATKA--SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFY 409
           + + V Y+   LL ++  +T A  SP+V+A+   G+ ++PH  N  +L  V S A+S  Y
Sbjct: 324 LTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLSAANSDLY 383

Query: 410 SSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAI 469
            +SR L +LA    APK F   ++ G P          + +A+   SS  + VFN+ +  
Sbjct: 384 VASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNA 443

Query: 470 SGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYA-FVMMILIMIGQC 528
             +  V +W  I +++I F +A K QG       Y +    +G+ +A F   +L ++   
Sbjct: 444 VSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNF 503

Query: 529 WVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKI-WKRDWRLFIRAKDIDLISHRHIH 587
            V +     G  D + F   Y+ +PVF + ++GYKI +K       R +++DL++ + + 
Sbjct: 504 TVFL----GGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTH---RPEEVDLVTLKALI 556

Query: 588 DPEIL--RQEREEYQEKLRNGPV-WRRVYD 614
           D E    + E  E +E+L+NG   W   YD
Sbjct: 557 DQEEEDGKIEDAEREERLKNGNKDWAWFYD 586

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  270 bits (689), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 175/574 (30%), Positives = 304/574 (52%), Gaps = 29/574 (5%)

Query: 56  DSFKPPETT-HHIETDMNPILSHQSVFDD--AKVEISQVDDELNE--KLKKTIQPRHVVM 110
           DSF   E   ++I+ + N + S  S F    A+ +   V D  +E  +L+K ++ RH+ M
Sbjct: 33  DSFPVKEQEIYNIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISM 92

Query: 111 MSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFN 170
           ++                    GP  ++I YA +   ++  +  +GEMA +Y+ L  GF 
Sbjct: 93  IAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMA-SYIPL-DGFT 150

Query: 171 AYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYILV 228
           +Y    VDPAL F+I + Y  ++F + P +L  A++ IQYW ++  VN  +++ IF +++
Sbjct: 151 SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVI 210

Query: 229 LAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR 288
           +AIN+ G  + + E EF  +S K+L+M+G  +L  +I+ GG  +   +G +YWRDPGAF+
Sbjct: 211 VAINVIG-VKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFK 269

Query: 289 G-----SDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALL 343
                   G  +F   ++  V + FS+   E   I  SE  NPRK++P A K  +YR ++
Sbjct: 270 EYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIV 329

Query: 344 IYLASIIIVGLLVPYDSSELLGSSSAA--TKASPYVLAVSTHGVRVVPHFINAVILISVF 401
            YL ++ ++G+ V Y+   L+ +   A    ASP+V+A+   G++V+PH  NA +L+ VF
Sbjct: 330 FYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVF 389

Query: 402 SVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETE 461
           S  +S  Y SSR L  LA  G APK+F+  ++ G P    +   +   +A+   S+   +
Sbjct: 390 SACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAK 449

Query: 462 VFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMI 521
           +FN+ + +  +  + +W  I + +I F +A + QG    +  Y +    +G+ +A V  I
Sbjct: 450 IFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCI 509

Query: 522 LIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK-IWKRDWRLFIRAKDIDL 580
            I + + +   V +G    D + F   Y+ +PV++  ++GYK I+K      I++ D+DL
Sbjct: 510 FIALIKNFT--VFLGH-KFDYKTFITGYIGLPVYVFSWVGYKLIYKTK---VIKSTDVDL 563

Query: 581 ISHRHIHDPE-----ILRQEREEYQEKLRNGPVW 609
            + + I+D E     I  QE+EE  +K      W
Sbjct: 564 YTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEW 597

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  267 bits (683), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 161/513 (31%), Positives = 273/513 (53%), Gaps = 34/513 (6%)

Query: 64  THHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXX 123
           +H +  D +     Q V  DA+V             K+ ++ RH+ M++           
Sbjct: 67  SHSVSGDEDEPYVDQGVVQDAEV-------------KRELKQRHIGMIALGGTIGTGLFI 113

Query: 124 XXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNF 183
                  +AGP G +I Y  MA+ ++ + Q++GEMA  ++ +   F  +    + P++  
Sbjct: 114 GISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMA-TFIPVTSSFTVFSSRFISPSIGA 172

Query: 184 SIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAET 243
           +  ++Y   W     LEL      IQ+WT  V    +++I++ ++  +N+F   + Y E 
Sbjct: 173 ANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFP-VKFYGEF 231

Query: 244 EFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN--------- 294
           EF   S K++ ++GF I  + ++CG AG  G +G +YWR+PG +    GP          
Sbjct: 232 EFWVASIKVIAIMGFLIYCLCMVCG-AGVTGPVGFRYWRNPGPW----GPGIISSQVAEG 286

Query: 295 RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGL 354
           RF G VS+L+ AAF++  TE + ITA E +NPRK +P A KKV +R L+ Y+ S+  +GL
Sbjct: 287 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGL 346

Query: 355 LVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRM 414
           LVP+D  +L  S  +   +SP+++A+   G +V+PH  NAVIL ++ S  +S  Y  SR+
Sbjct: 347 LVPFDDPKLS-SDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRV 405

Query: 415 LLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQ 474
           +  LA+   AP+ F    + G P +  L  +    +AF   SS   + FNWLL I G++ 
Sbjct: 406 MFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAG 465

Query: 475 VFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVP 534
            F W LI ++H+RF + ++ +G S D++ +K+ +  W + YA   MI+I+I Q +    P
Sbjct: 466 FFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAP 525

Query: 535 VGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKR 567
              GS  V A    Y+++ +F  L++ ++++ R
Sbjct: 526 TFNGSDFVAA----YISVFLFFFLWVSFQLYFR 554

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  266 bits (681), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 176/595 (29%), Positives = 300/595 (50%), Gaps = 29/595 (4%)

Query: 40  ELPTSSTTHSRFRNFIDSFK-------PPETTHHIETDMNPILSHQSVFDDAKVEISQVD 92
           E+ T  TT  R+  + D  K       P +    +  D+   +S  +  +D     +   
Sbjct: 5   EVLTEETTSDRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDG 64

Query: 93  DELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCII 152
                +LKK ++ R V M++                 A AGP  ++I YA +   ++  +
Sbjct: 65  KTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTM 124

Query: 153 QAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWT 212
            ++GEMA +Y+ L  GF +Y     DPAL F++ + Y  ++F + P +L  A++ IQYW 
Sbjct: 125 ASLGEMA-SYIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWI 182

Query: 213 --TKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270
              KVN  +++ IF ++++AIN  G  + + E EF  +S K+L+M    IL  +++ GG 
Sbjct: 183 PREKVNPGVWITIFLVVIVAINTLG-VQFFGEFEFWLSSFKVLVMFALIILLFILMLGGG 241

Query: 271 GNDGFIGGKYWRDPGAFRG-----SDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN 325
            N   +G ++W+ PGAF       +    +F   VS  V A F++  TE + I   E  N
Sbjct: 242 PNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARN 301

Query: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTH 383
           PRK++P A K  +YR ++ YL SI+++G+ V YD   LL + + +T A  SP+V+A+   
Sbjct: 302 PRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNS 361

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           G++V+PH  NA +L+ VFS  +S  Y +SR L +LA    APK+F   +R G P     +
Sbjct: 362 GIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGL 421

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
             +  ++A+ + SS   ++FN+ + +  +  + +W  I ++++ F RA++ QG       
Sbjct: 422 SVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFS 481

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           Y +    +G+ +A     LI + + +   V +G    D + F   Y+ +PVF + Y GYK
Sbjct: 482 YVAPGQRYGAYFALFFCSLIALIKNFT--VFLGH-QFDYKTFITGYIGIPVFFISYFGYK 538

Query: 564 -IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR---NGPVWRRVYD 614
            I+K      I   ++DL + +   D E    + E+   K R   NG  +   YD
Sbjct: 539 LIYKTK---IIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYD 590

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  266 bits (680), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 174/540 (32%), Positives = 282/540 (52%), Gaps = 24/540 (4%)

Query: 76  SHQSVFDDAK-VEISQVDDELNE--KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHA 132
           S +S+ D A  V  S++ D   E  +LKK ++ RH+ M++                   A
Sbjct: 39  SSKSLCDSASDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVA 98

Query: 133 GPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQ 192
           GP   +I Y  +   ++  +  +GEMA      + GF +Y     DPAL F++ + Y I+
Sbjct: 99  GPVSTLIAYTFVGIMVFFTMACLGEMAT--FIPLDGFTSYASRYCDPALGFAVGYAYLIK 156

Query: 193 WFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSC 250
           +F + P +L  A+M +QYW  +  VN  I+V + + ++  INIFG  R + E EF  +S 
Sbjct: 157 YFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFG-VRFFGEFEFWLSSL 215

Query: 251 KILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG-----SDGPNRFKGVVSTLVT 305
           K+L+MIG  IL  VI+ GGAG+   +G +YW+ PGAF       S    +F   V+ LV 
Sbjct: 216 KVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVL 275

Query: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365
             F++   E   I A+E SNPR+++P A K   YR L+ Y+ SI ++G+ VPY+  +L+ 
Sbjct: 276 GVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVT 335

Query: 366 SSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAP 425
           ++  +  ASP+ +A+   G+ V+P   N  +LI VFS A+S  Y +SR L +LA    AP
Sbjct: 336 TNENSLTASPFSIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAP 395

Query: 426 KVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSH 485
           K+F   +R G P     V  +  ++A+   SS   +VF + + +  ++ + TW  I +++
Sbjct: 396 KIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITY 455

Query: 486 IRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAF 545
           I F RA++ Q        Y +    +G+  +     LI I + +     V  G  D + F
Sbjct: 456 ICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFT----VFLGHFDYKTF 511

Query: 546 FQDYLAMPVFIVLYLGYKI-WKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLR 604
              Y+ +P+F++ Y GYKI  K + R    A+ +DL+S + + D E   Q   E  E+L+
Sbjct: 512 ITGYIGLPIFVLCYFGYKITCKSEIR---SARYVDLVSQKSLVDRE---QVEYELIEQLK 565

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  265 bits (677), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 168/529 (31%), Positives = 281/529 (53%), Gaps = 34/529 (6%)

Query: 98  KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGE 157
           +LKK ++ RH+ M++                   AGPA ++I Y  + + ++  + A+GE
Sbjct: 81  RLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGE 140

Query: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK--V 215
           MA  Y+ L  GF +Y     DPAL F++ + Y  ++F + P +L  A++ IQYW  +  V
Sbjct: 141 MAA-YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTV 198

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           N  +++ IF ++++AIN  G  + + E EF  +S KI++MIG  I   VI+ GG  N   
Sbjct: 199 NPGVWITIFLVVIIAINTIG-VKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDR 257

Query: 276 IGGKYWRDPGAFR----------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN 325
           +G +YW+ PGAF+          GS G  +F   V+  V A F++   E   I A+E  N
Sbjct: 258 LGFRYWKTPGAFKPYSSSVVNIEGSTG--KFVAFVNVFVYALFAYLGIELTGIVAAEAEN 315

Query: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTH 383
           PR+ IP A K  ++R L  Y+A+I ++G+ V YD   LL +++A T A  SP+V+A+   
Sbjct: 316 PRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNS 375

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           GV V+PH  N  +L+ VFS  +S  Y  +R L +LA  G APK+F   +R G P      
Sbjct: 376 GVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGG 435

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
             +  ++A+   SS   E+FN+ + +  +  V +W+ I ++ I F RA++ QG       
Sbjct: 436 CVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFA 495

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           Y +    +GS +A    +L+ + + +   V +G    D + F   Y+ +PV+   ++GYK
Sbjct: 496 YVAPFQPYGSYFALFFCVLLALIKNFS--VFLGN-EFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE------EYQEKLRNG 606
           ++ +     ++  + DL S++   D    R+E E      E +E+L++G
Sbjct: 553 LYYKTKT--VKPHEADLNSYKAAVD----REEEEGKIKEAERKERLKHG 595

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  264 bits (674), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 166/539 (30%), Positives = 285/539 (52%), Gaps = 27/539 (5%)

Query: 83  DAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYA 142
           D    +    DE   +L+K ++ RH+ M++                    GP  ++I Y 
Sbjct: 65  DDSFAVPDGKDE-TTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYG 123

Query: 143 IMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELV 202
            +   ++  +  +GEMA +Y+ L  GF +Y    VDPAL F+I + Y  ++F + P +L 
Sbjct: 124 FVGLLVFFTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181

Query: 203 TASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFI 260
            A++ IQYW ++  VN  +++ IF ++++AINI G  R + E EF  +S K+++M+G  +
Sbjct: 182 AAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVG-VRFFGEFEFWLSSFKVMVMLGLIL 240

Query: 261 LGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQT 313
           L  +I+ GG  +   +G +YWRDPGAF+       GS G  +F    S  V + FS+   
Sbjct: 241 LLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKG--KFVAFASVFVYSLFSYTGI 298

Query: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA 373
           E   I  SE  NPRK++P A K  +YR ++ YL ++ ++G+ V Y+   LL +   A  A
Sbjct: 299 ELTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSA 358

Query: 374 --SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431
             SP+V+A+   G++V+PH  N  +L+ VFS  +S  Y SSR L  LA  G APK+F   
Sbjct: 359 AASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 418

Query: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491
            + G P    +V  +   +A+   S+   ++FN+ + +  +  + +W  I + +I F RA
Sbjct: 419 SKWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRA 478

Query: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551
            + QG    +  Y +    +G+ +A    ILI + + +   V +G  + D + F   Y+ 
Sbjct: 479 CRAQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFT--VFLGH-TFDYKTFITGYIG 535

Query: 552 MPVFIVLYLGYK-IWKRDWRLFIRAKDIDLISHRHIHDPEILR---QEREEYQEKLRNG 606
           +P+++  ++GYK I+K      ++  D DL + + I+D E  +   Q++E+ +   RNG
Sbjct: 536 LPIYVFSWVGYKLIYKTK---VVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNG 591

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  260 bits (664), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 169/563 (30%), Positives = 301/563 (53%), Gaps = 36/563 (6%)

Query: 63  TTHHIETDMNPILSHQSVFDDAKVEISQVDDELNE---KLKKTIQPRHVVMMSXXXXXXX 119
           T+  +E   N  LS+Q   DD   + S ++ +      +LKK ++ RHV M++       
Sbjct: 22  TSKDVE---NLDLSNQ---DDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGT 75

Query: 120 XXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDP 179
                     + AGP  ++I Y+ +   +Y ++  +GEMA  Y+ L  GF +Y     DP
Sbjct: 76  GLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-DGFTSYASRYCDP 133

Query: 180 ALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT--KVNADIFVLIFYILVLAINIFGGA 237
           AL F++ + Y  ++  + P +L  A++ +QYW +  KVN  +++ IF ++++ IN+ G  
Sbjct: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVG-V 192

Query: 238 RGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-------GS 290
           + + E EF  +S K+L+M+   +L  VI+ GG  +   +G ++++DPGAFR       GS
Sbjct: 193 KFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS 252

Query: 291 DGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASII 350
            G  +F   V+  V A F++  TE   I A+E  NPR+ +P A K  +YR ++ YL +I 
Sbjct: 253 KG--KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIF 310

Query: 351 IVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAF 408
           ++G+ V Y+   LL +   +T A  SP+V+A+   G+ V+PH  NA +L+ VFS  +S  
Sbjct: 311 LLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDL 370

Query: 409 YSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLA 468
           Y +SR L  LA    APK+F   ++ G P    ++  +  ++A+   SS   +VFN+ + 
Sbjct: 371 YVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVN 430

Query: 469 ISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQC 528
           +  +  + +W  I +++I F RA++ QG     + Y + +   G+ +A     LI + + 
Sbjct: 431 VVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKN 490

Query: 529 WVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHD 588
           +   V +G    D + F   Y+ +PVFI+ + GYK + R  + F++ ++ DL + + + D
Sbjct: 491 FT--VFLGH-KFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFKELID 545

Query: 589 PEILRQEREEY----QEKLRNGP 607
            E   +E + +    +EK+ + P
Sbjct: 546 LE--EEEGKLWDAAQKEKMESSP 566

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score =  251 bits (641), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 133/326 (40%), Positives = 209/326 (64%), Gaps = 6/326 (1%)

Query: 296 FKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLL 355
           FK + +T V+AAFSFG +E + +T++E  N   AI  AAK   +R  + Y+ +++I+G L
Sbjct: 5   FKNLCNTFVSAAFSFGGSELVLLTSTESKNI-SAISRAAKGTFWRIAIFYITTVVIIGCL 63

Query: 356 VPYDSSELL-GSSSAATKASPYVLAVSTHGVR--VVPHFINAVILISVFSVADSAFYSSS 412
           VPY+ S LL GS+S    ASP+V+A+S  G     V +F+N VIL++V SV +S  Y+SS
Sbjct: 64  VPYNDSRLLNGSTSEDISASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASS 123

Query: 413 RMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGL 472
           R++  L   G  P + +++DR GRP +G  +  V  ++ F   S+KE EVF WL A+  +
Sbjct: 124 RLIQALGASGQLPSICSYMDRKGRPLVGIAISGVFGLLGFLVASNKEDEVFTWLFALCSI 183

Query: 473 SQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGI 532
           S  FTW  IC+S IRFR A+K QGRS DEI YKS +GV+G     V+  L++ G+ +V  
Sbjct: 184 SSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSA 243

Query: 533 VPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR-LFIRAKDIDLISHRHIHDPEI 591
            PVG  S+  +AFF+  L++P+ IV+Y+ ++I+++DWR  +I+  DIDL +   I + ++
Sbjct: 244 APVGSPSS-AKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLDL 302

Query: 592 LRQEREEYQEKLRNGPVWRRVYDFWC 617
            + ++E  +E + + P + ++Y FWC
Sbjct: 303 FKAQKEAEKELIASKPFYYKIYRFWC 328

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  259 bits (661), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/541 (30%), Positives = 280/541 (51%), Gaps = 33/541 (6%)

Query: 82  DDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGY 141
           +D   +IS    E   +LKK ++ RH+ M++                    GPA ++I Y
Sbjct: 34  EDDSNKISD-GKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAY 92

Query: 142 AIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLEL 201
           + +   ++ ++  +GEMA  Y+ L  GF +Y     DPAL F++ + Y  ++F + P +L
Sbjct: 93  SFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQL 150

Query: 202 VTASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFF 259
              ++ IQYW  +  VN  +++ IF ++++ IN  G  R + E EF  +S KI++M G  
Sbjct: 151 TAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG-VRYFGEFEFWLSSFKIMVMFGVI 209

Query: 260 ILGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQ 312
           +   +I+ GG  N   +G +YW++PGAF+       GS G  +F   V+  V A F++  
Sbjct: 210 LFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFVYALFAYLG 267

Query: 313 TEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATK 372
            E   I A+E  NPR+ IP A K  +YR +L Y+ +I ++G+ V Y+   LL ++ A+T 
Sbjct: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTS 327

Query: 373 AS--PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTF 430
           A+  P+V+A+   GVR +PH  N  +LI VFS  +S  Y  +R L +LA  G APK+F  
Sbjct: 328 AAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387

Query: 431 VDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRR 490
            +R G P        +  ++A+   SS   ++FN+ + +  +  + +W  I +++I F R
Sbjct: 388 TNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447

Query: 491 AMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYL 550
           A   Q    +   Y++    +G+       +LI     ++    V  G  D ++F   Y+
Sbjct: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI----AFIKNFTVFIGEFDYKSFITGYI 503

Query: 551 AMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQERE------EYQEKLR 604
            +P++++ Y GYKI  +     ++A++ DL S +   D    R+E E      E +E+L+
Sbjct: 504 GLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID----REEAEGKIKEAEAKERLK 557

Query: 605 N 605
           N
Sbjct: 558 N 558

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  255 bits (652), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 162/515 (31%), Positives = 279/515 (54%), Gaps = 16/515 (3%)

Query: 76  SHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPA 135
           ++++   + + + S V  +    LKK +  RH+ +++                    GPA
Sbjct: 28  TYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPA 87

Query: 136 GLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFC 195
            L + + I+++ +YCI+  + EM V YL   G         VDP+L F+  W Y   +  
Sbjct: 88  PLFLSFIIISTMVYCIMCTLAEM-VCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAM 146

Query: 196 VCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMM 255
           +   EL  A+  ++YWT +V   +++ IF I+V+ +N F   R Y E+EF   S KI+ +
Sbjct: 147 LVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLN-FSAVRFYGESEFWFASLKIICI 205

Query: 256 IGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGS-DGPN--RFKGVVSTLVTAAFSFGQ 312
           +   ++ IVI  GGA N   +G +YWR+PGAF     G N  RF  + + ++ +AF+F  
Sbjct: 206 LALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGNLGRFLDLWTAIIKSAFAFIL 265

Query: 313 T-EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL---GSSS 368
           + E + +   E  + R+ I  A+++ IYR +  YL+S +++G++V  +   LL     + 
Sbjct: 266 SPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENR 325

Query: 369 AATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVF 428
               +SP+V  ++  G+ V+ H IN  IL S +S  +S FY+SSR +L L++QG APK+F
Sbjct: 326 PGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIF 385

Query: 429 TFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRF 488
           + ++R G P     + +++A +A+   SS  ++VF WL  I  +S    W LI +++IRF
Sbjct: 386 SKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRF 445

Query: 489 RRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQD 548
           R+A+ +  R +D I Y+S +  + SAY F +++ I+      G V   +G  D + F   
Sbjct: 446 RKAI-LFNRLLDRIPYRSPLQPF-SAYFFTIVVAIITLTN--GYVVFIKGRWDYKDFLTS 501

Query: 549 YLAMPVFIVLYLGYK-IWKRDWRLFIRAKDIDLIS 582
           Y+++P+F+  YLG+K I+K   R  I    ID+I+
Sbjct: 502 YISLPIFLAFYLGHKTIYKT--RFCIPVDQIDVIT 534

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 164/523 (31%), Positives = 276/523 (52%), Gaps = 23/523 (4%)

Query: 98  KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGE 157
           +LKK ++ RHV M++                 A AGPA ++I Y+ +   +Y ++  +GE
Sbjct: 50  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGE 109

Query: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215
           MA      + GF +Y    VDPAL F++ + Y  ++F V P +L   +M +QYW +  KV
Sbjct: 110 MAA--FIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           N  +++ IF +L++ IN  G  R + E EF  +S K+L+M+G  +L  +I+ GG  N   
Sbjct: 168 NPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDR 226

Query: 276 IGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
            G +YWRDPGAF+       GS G  +F    S    A F++  TE   I A+E  NPR+
Sbjct: 227 TGFRYWRDPGAFKPYSEAISGSKG--KFVSFASVFALALFAYTGTELCGIVAAEAKNPRR 284

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTHGVR 386
           ++P A K  +YR +L Y+ SI+++G+ V Y+   L+ +   +T A  SP+V+A+   G+ 
Sbjct: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIP 344

Query: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446
           V+PH  NA +L+ VFS  +S  Y +SR L  LA    APK+F   +  G P     V  +
Sbjct: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404

Query: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506
             ++A+   SS   ++FN+ + +  +  + +W  I ++++RF +A+  Q        Y +
Sbjct: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464

Query: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566
               W +  +     LI + + +   V +G  + D + F   Y+ +PV+ + Y+GYK+  
Sbjct: 465 PFQPWSTWVSLFFCCLIGLIKNYT--VFLGH-TFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 567 RDWRLFIRAKDIDLISHRHIHDPEILRQEREEY--QEKLRNGP 607
           R     I+ +D+DL + +   D E    +  E   +E+L++ P
Sbjct: 522 RS--KLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSP 562

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  253 bits (645), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 180/601 (29%), Positives = 300/601 (49%), Gaps = 44/601 (7%)

Query: 40  ELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQV-----DDE 94
           ++P++ST+  ++  + +     E          PI   + + DD +  IS       +D 
Sbjct: 5   QIPSNSTS-DQYEEYFEQLPKKEFKL-------PIQEEELINDDLERNISSASSQDENDS 56

Query: 95  LN-------EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASC 147
            N        +LKK ++ RHV M++                 A AGP   +I YA +   
Sbjct: 57  YNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLL 116

Query: 148 IYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMT 207
           ++  +  +GEMA  Y+ L  GF +Y     DPAL F++ + Y  ++F + P +L  A++ 
Sbjct: 117 VFFTMACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALV 174

Query: 208 IQYWT--TKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVI 265
           IQYW    KVN  ++V IF +++++IN+FG  R + E EF  +S K+L+M+G  +L  ++
Sbjct: 175 IQYWVDKEKVNPGVWVTIFLVVIVSINVFG-VRFFGEFEFWLSSFKVLVMLGLMLLLFIL 233

Query: 266 ICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318
           + GG  +   +G +YWR PG+F+       G  G  RF   VS  V A +++   E   I
Sbjct: 234 MLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGI 291

Query: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGS--SSAATKASPY 376
            A+E  NPRK+IP A K  +YR ++ YL SI ++G+ V YD   L+ +  SS +  ASP+
Sbjct: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPF 351

Query: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436
           V+A+   G+  +PH INA +L+ VFS  +S  Y SSR L +LA    APK+F   +R G 
Sbjct: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411

Query: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496
           P     V  +  ++A+   SS   ++FN+ + +  +  + +W  I +++I F RA++ QG
Sbjct: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471

Query: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFI 556
                  Y +    +G+ ++     LI + + +   +       D + F   Y+ +PVF 
Sbjct: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFF 528

Query: 557 VLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEIL--RQEREEYQEKLR-NGPVWRRVY 613
             Y GYK   +     I    +DL + +   D E    +    E  E+++ NG  +   Y
Sbjct: 529 FCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFY 586

Query: 614 D 614
           D
Sbjct: 587 D 587

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  252 bits (643), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 279/533 (52%), Gaps = 26/533 (4%)

Query: 72  NPILSHQSVFDDAKVEISQVDDELNEK-----LKKTIQPRHVVMMSXXXXXXXXXXXXXX 126
           N  L    V  +++ ++  V + ++ K     LKK ++ RHV M++              
Sbjct: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTG 77

Query: 127 XXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186
              A AGP  ++I Y+ +   +Y ++  +GEMA      + GF +Y    VDPA+ F++ 
Sbjct: 78  SSLASAGPVSILISYSFVGLLVYTVMSCLGEMAA--FIPLDGFTSYASRYVDPAVGFAVG 135

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETE 244
           + Y  ++F V P +L   +M +Q+W ++  VN  +++ IF  L++ IN  G  R + E E
Sbjct: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG-VRFFGEFE 194

Query: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFK 297
           F  +S K+L+M+G  +L  +I+ GG  N    G ++WRDPGAF+       GS G  +F 
Sbjct: 195 FWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKG--KFV 252

Query: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357
              S    A F++  TE   I A+E  NPR+++P A K  +YR ++ Y+ +I+++G+ V 
Sbjct: 253 SFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312

Query: 358 YDSSELLGSSSAATKA--SPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRML 415
           Y+   LL +   AT A  SP+V+A+    + V+PH  N  +L+ VFS  +S  Y +SR L
Sbjct: 313 YNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSL 372

Query: 416 LTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQV 475
             LA  G AP++F   ++ G P     +  +  ++A+   SS   +VFN+ + +  +  +
Sbjct: 373 YGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 432

Query: 476 FTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV 535
            +W  I +++IRF +A++VQ      + Y +    W +  A     LI + + +   V +
Sbjct: 433 LSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYT--VFL 490

Query: 536 GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHD 588
           G    D + F   Y+ +PV+++ Y+GYK+  R     I+ +D+DL + +   D
Sbjct: 491 GH-KFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAID 540

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  252 bits (643), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 164/536 (30%), Positives = 282/536 (52%), Gaps = 30/536 (5%)

Query: 98  KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGE 157
           +LKK +Q RHV M++                 + AGP  ++I Y+IM   ++ ++  +GE
Sbjct: 57  RLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGE 116

Query: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215
           MA  Y+ L  GF +Y     DPAL F++ + Y  ++  + P +L  A++ +QYW    KV
Sbjct: 117 MAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174

Query: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275
           N  +++ +F  ++L INI G  + + E EF  +S K+L+M+    L +V++ GG  +   
Sbjct: 175 NPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNR 233

Query: 276 IGGKYWRDPGAFRG-------SDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328
           +G +YW+DPG F+          G  +F    S  V A F++  TE   I A+E  NPR+
Sbjct: 234 LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRR 293

Query: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTHGVR 386
            +P A K  +YR ++ YL ++ ++GL V Y+   LL +  A T A  SPYV+A+   G+ 
Sbjct: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIP 353

Query: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446
           V+PH  NA +L  VFS  +S  Y  SR L  LA    APK+F   +  G P     +  +
Sbjct: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413

Query: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506
              +A+   SS    +F++ + ++ +  + +W  I +++I F RA +VQG   + + Y++
Sbjct: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473

Query: 507 ---QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
               V  W  A  F +M+ ++        V +G+ + D + F   Y+ +PV+I+ ++ YK
Sbjct: 474 PFQPVTAW-IALGFCLMVALVKNF----TVFLGD-TFDYKTFITGYIGIPVYILCFVCYK 527

Query: 564 I-WKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY---QEKLRNGPVWRRVYDF 615
           I  K  W   I++ ++DL +++   D E    + E     +E+ ++G  W++ YD+
Sbjct: 528 IVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  252 bits (643), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 175/579 (30%), Positives = 288/579 (49%), Gaps = 41/579 (7%)

Query: 59  KPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNE-KLKKTIQPRHVVMMSXXXXX 117
           K  +T   ++ +     S  ++ +         D   NE  L++ ++ RH+ M++     
Sbjct: 36  KYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAI 95

Query: 118 XXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGF-- 175
                       A  GPAGL I Y I++S +Y I+   GEM V YL   G  N   G   
Sbjct: 96  GTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEM-VCYLP--GNGNDASGSAA 152

Query: 176 -----LVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLA 230
                 VD +L F+ AW Y   +  +   E   AS  ++YWT  V   +++LIF  +V+ 
Sbjct: 153 HLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVI 212

Query: 231 INIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG- 289
           +N FG  + Y E EF   S KIL ++G  IL  ++  GG  N   +G +YW+ PGAF   
Sbjct: 213 LN-FGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEH 271

Query: 290 --SDGPNRFKGVVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYL 346
               G  RF  + S ++   F+F    E + +T++E  + R+ I  AA++ I+R +  Y+
Sbjct: 272 IMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYV 331

Query: 347 ASIIIVGLLVPYDSSEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSV 403
              + + ++V Y+   L   L S      +SP+V+ +   G+RV+PH INA IL S +S 
Sbjct: 332 LGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSA 391

Query: 404 ADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVF 463
            ++  ++S+R LLT+AR G AP+VF  ++R G P +   +   ++ +AF   SS   +VF
Sbjct: 392 GNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVF 451

Query: 464 NWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYA----FVM 519
           NW   IS +S    W   C+++IRFR+A+   G   D + +K+    WG  YA      +
Sbjct: 452 NWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKT----WGQPYAVYYSLFV 506

Query: 520 MILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDW--RLFIRAKD 577
           + LI +   +   +P     +D   F   Y+ +P+F+VL++G+K+W R +  R + R   
Sbjct: 507 ISLITLTNGYATFIPKNWKGSD---FVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQ 563

Query: 578 IDLISHRHIHDPEILRQEREEYQEKLRNGPV--WRRVYD 614
           ID+ +   + D E    ER +  ++ R  P   W++  D
Sbjct: 564 IDVTT--GLVDIE----ERTKILDETRVEPSTRWQKFMD 596

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  249 bits (637), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 267/510 (52%), Gaps = 28/510 (5%)

Query: 80  VFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVI 139
           ++ +  +E S   +  +  LK  +Q RH+ +++                 A+ GPA LVI
Sbjct: 38  IYSEVDIE-SGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVI 96

Query: 140 GYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGF-------LVDPALNFSIAWIYCIQ 192
            Y ++++ +Y I+   GEM V YL      +   G+        VD +L F+ +W Y   
Sbjct: 97  SYIVISTIVYPIMNMFGEM-VCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYC 155

Query: 193 WFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKI 252
           +  +   E   AS  ++YWT+K+   + + +F  ++  +N F   + Y E EF     KI
Sbjct: 156 FIVLVATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLN-FLPVKFYGEAEFWFAIIKI 214

Query: 253 LMMIGFFILGIVIICGGAGND---GFIGGKYWRDPGAFR-----GSDGPNRFKGVVSTLV 304
             + G  I+  VI CGGA N+    F+G  YW++P +FR     GS G   F  V + L+
Sbjct: 215 FCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVTNGSLG--NFLDVYNALI 272

Query: 305 TAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL 363
             AF+F    E +++T+SE  + R+ I  A+++ +YR +  Y+   + + ++VPY+   L
Sbjct: 273 KGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTL 332

Query: 364 LGS---SSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLAR 420
           L +   +     +SP+V+ +   G+ ++PH IN  IL S  S  ++  ++S+R LLT+ +
Sbjct: 333 LNALALNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGK 392

Query: 421 QGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWAL 480
            G AP++F+ ++R G P +   +  +IA +AF  CS+   +VF W   IS +S    W  
Sbjct: 393 NGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFT 452

Query: 481 ICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA 540
            C++++RFRR +   G   D + +K++  V+ + Y+FV + ++++   ++ I+P      
Sbjct: 453 GCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIP---KFW 508

Query: 541 DVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570
           + Q F   Y+ +PVF+VLY G+ I+   WR
Sbjct: 509 NYQDFIAAYITLPVFLVLYFGHIIYSGRWR 538

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  249 bits (636), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/589 (28%), Positives = 292/589 (49%), Gaps = 44/589 (7%)

Query: 40  ELPTSST--THSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFD-DAKVEISQVDDELN 96
           E P+S +   H       D+ +  + + +     N  +    + D D +   S   D   
Sbjct: 44  ESPSSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEP 103

Query: 97  EKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVG 156
            KLK+ +Q RHV +++                    GPAGL I Y I+++ IY I+ A+G
Sbjct: 104 HKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALG 163

Query: 157 EMAVNYLTLVGGFNAYPGF-----LVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYW 211
           EM V +L   G  +A          VDP+L F+  W Y   +  +   E   AS  ++YW
Sbjct: 164 EM-VCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYW 222

Query: 212 TTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAG 271
           TT V   +++ IF  +V+ +N F   + Y E+EF   S KIL ++G  IL  ++  GG  
Sbjct: 223 TTAVPKGVWITIFLCVVVILN-FSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGP 281

Query: 272 NDGFIGGKYWRDPGAFR-----GSDGPNRFKGVVSTLVTAAFSF-GQTEFLAITASEQSN 325
           N   +G +YW+ PGAF      GS G   F  + + ++  AF+F    E + +T++E ++
Sbjct: 282 NHDRLGFRYWQHPGAFAHHLTGGSLG--NFTDIYTGIIKGAFAFILGPELVCMTSAECAD 339

Query: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL---LGSSSAATKASPYVLAVST 382
            R+ I  A+++ ++R +  Y+   + + ++VPY+   L   L        +SP+V+ +  
Sbjct: 340 QRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQN 399

Query: 383 HGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFL 442
            G++V+PH IN  IL S +S A++  ++S+R LLT+A+ G APK    +++ G P +   
Sbjct: 400 AGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVG 459

Query: 443 VGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEI 502
           V  + + +A+   SS   +VFNW   IS +S    W   C++++RFR+A+   G   D +
Sbjct: 460 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRL 518

Query: 503 GYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA-------DVQAFFQDYLAMPVF 555
            +K+    WG  Y     +++      +GI+ +  G A        V  F   Y+ +P+F
Sbjct: 519 PFKT----WGQPYTVWFSLIV------IGIITITNGYAIFIPKYWRVADFIAAYITLPIF 568

Query: 556 IVLYLGYKIWKRDWR-LFIRAKDIDLISHRHIHDPEILRQEREEYQEKL 603
           +VL+ G+K++ R WR  ++   +ID+ +       EI  + RE  + +L
Sbjct: 569 LVLWFGHKLYTRTWRQWWLPVSEIDVTTGL----VEIEEKSREIEEMRL 613

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  247 bits (630), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 176/640 (27%), Positives = 310/640 (48%), Gaps = 66/640 (10%)

Query: 1   MIDTPGSSKESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP 60
           M +  G    +YE  DI  S  +  ++   D+++ + N +     +   RF         
Sbjct: 1   MANNRGQVTYNYELEDIPSSKNELKELG--DMEAQQMNLD----DSLDDRF--------- 45

Query: 61  PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXX 120
               +  ++ +N +L+  S         + ++++    LK+ ++ RHV +++        
Sbjct: 46  ----NKKDSGLNKVLTVSS-----DTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTG 96

Query: 121 XXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYL-----TLVGGFNAYPGF 175
                       GPAGL I Y I++S IY I+ AVGEM V YL        G        
Sbjct: 97  LFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM-VCYLPGDGHDSAGSVTHLVKR 155

Query: 176 LVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFG 235
            VD +L F+  W Y   +  +   E   A+  ++YWT  V    ++ IF  ++  +N+  
Sbjct: 156 YVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNM-S 214

Query: 236 GARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRG--SDGP 293
             + + ETEF   S KIL ++G  IL  ++  GG  +   +G +YW++PGAF    +DG 
Sbjct: 215 SVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGS 274

Query: 294 -NRFKGVVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIII 351
              F  + S ++  AF+F    E +A+T+SE S+ R+ I  A+K+ IYR +  Y+   + 
Sbjct: 275 LGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLA 334

Query: 352 VGLLVPYDSSEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAF 408
           +G++V ++   L   L +++    +SP+V+ +   G+ V+PH INA IL S +S  ++  
Sbjct: 335 IGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFM 394

Query: 409 YSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLA 468
           ++SSR L T+A+ G APK+F  +++ G P +  ++  +I+ +A+   SS    VF WL  
Sbjct: 395 FASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSN 454

Query: 469 ISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQC 528
           IS +S    W   C++++RFR+A+       D + +K+    WG  Y      LI+    
Sbjct: 455 ISTISGFLGWICACIAYLRFRKAI-FYNNLYDRMPFKT----WGQPY------LILWSLT 503

Query: 529 WVGIVPVGEGSA-------DVQAFFQDYLAMPVFIVLYLGYKIW---KRDW---RLFIRA 575
            V I+ +  G         +V  F   Y+ +P+F+ LY+G+K++   K D+   +L    
Sbjct: 504 VVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSV 563

Query: 576 KDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDF 615
           +DID+I+       EI  +  E  + ++     W R  D+
Sbjct: 564 EDIDVITGLD----EIETKTCELDENRILPTNRWERFIDW 599

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  245 bits (626), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 156/538 (28%), Positives = 281/538 (52%), Gaps = 31/538 (5%)

Query: 67  IETDMNPILSHQSVFDDAKVE-------ISQVDDELN------EKLKKTIQPRHVVMMSX 113
           + +D+   L   + F D K +       ++Q++ +L         L+K +  RH+ +++ 
Sbjct: 1   MTSDLKANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIAL 60

Query: 114 XXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYP 173
                            + GP  L + + I++  +Y ++  + EM + YL   G      
Sbjct: 61  GGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEM-ICYLPQQGTVPELT 119

Query: 174 GFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINI 233
              VDP+L F+  W Y   +  +   EL  A+  +QYWT KV+  +++ IF ++V+ +N 
Sbjct: 120 SRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLN- 178

Query: 234 FGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR----- 288
           F   + Y E+EF   S KI+ ++G  I+ IVI  GGA +   +G +YW +PG F      
Sbjct: 179 FAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITG 238

Query: 289 GSDGPNRFKGVVSTLVTAAFSFGQT-EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLA 347
           G+ G  RF  + + ++ + F+F  + E + +   E  + R+ I  A+++ I+R +  Y+ 
Sbjct: 239 GNTG--RFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYIT 296

Query: 348 SIIIVGLLVPYDSSEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVA 404
           S + +G ++  D  +L   L S +    +SP+V  +S  G+ V+ H INAVIL S +S A
Sbjct: 297 STLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSA 356

Query: 405 DSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFN 464
           +S  Y+SSR +L LA+QG APKVFT ++R G P     +   ++ + +   SS   +VF 
Sbjct: 357 NSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFT 416

Query: 465 WLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIM 524
           WL  I  +S    WALI ++++RFR+A+       + + +KS +  + + +  V ++L+ 
Sbjct: 417 WLSNICTISGFIGWALIGITYLRFRKAI-FYNNLYERVPFKSALQPYFTYFFVVFVVLLC 475

Query: 525 IGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLIS 582
           +   +   +P    ++D   F   Y+ +P+F +LYLG+KIW +  R +I  ++ID+I+
Sbjct: 476 LTNGYATFIPKYWNASD---FVAAYITLPIFFLLYLGHKIWFKT-RWYIPFREIDVIT 529

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  246 bits (628), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 164/546 (30%), Positives = 276/546 (50%), Gaps = 43/546 (7%)

Query: 93  DELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCII 152
           D    +LK+ ++ RHV +++                    GPAGL I Y I++S IY I+
Sbjct: 69  DMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIM 128

Query: 153 QAVGEMAVNYLTLVG----GFNAY-PGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMT 207
           Q +GEM V YL   G    GF AY  G  VD +L F+ AW Y   +  +   E   AS  
Sbjct: 129 QGIGEM-VCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGV 187

Query: 208 IQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIIC 267
           ++YWTT V    ++ IF   V+ +N F   + Y E+EF   S KIL ++G  IL  ++  
Sbjct: 188 VEYWTTSVPKAAWITIFLAAVVILN-FTAVKFYGESEFWFASIKILCIVGLIILSFILFW 246

Query: 268 GGAGNDGFIGGKYWRDPGAFR-----GSDGPNRFKGVVSTLVTAAFSF-GQTEFLAITAS 321
           GG  N   +G +YW++PG F      GS G   F  + + ++   F+F    E +A+T+S
Sbjct: 247 GGGPNHDRLGFRYWQNPGGFAHHIRGGSFG--SFLDIYTGIIKGGFAFILGPEMIAMTSS 304

Query: 322 EQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL---LGSSSAATKASPYVL 378
           E  + R+ I  AA++ ++R +  Y+   + + ++V Y+   L   L  +     +SP+V+
Sbjct: 305 EVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVI 364

Query: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438
            +   G++V+PH INA IL S +S  ++  ++SSR LLT+A+ G AP++F  V+R G P 
Sbjct: 365 GIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPY 424

Query: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498
               + + I+ +A+  CSS   +VFNW   IS +S    W  +C+++IRF +A+   G  
Sbjct: 425 YAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGMQ 484

Query: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSA-------DVQAFFQDYLA 551
              + Y ++    G  Y     +L+      + I+ +  G         D + F   Y+ 
Sbjct: 485 -SRLPYTAR----GMPYLIYWPLLV------ISIITLTNGYEVFIPRFWDAKNFVAAYIT 533

Query: 552 MPVFIVLYLGYKIWKRD---WRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPV 608
           +PVF VL++G+++++R     + +   ++ID+++       EI  + RE    ++     
Sbjct: 534 LPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVE----EIEEKTRECDASRVLPTKW 589

Query: 609 WRRVYD 614
           W +  D
Sbjct: 590 WEKALD 595

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  244 bits (624), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 169/583 (28%), Positives = 295/583 (50%), Gaps = 33/583 (5%)

Query: 47  THSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQVDDEL-NEKLKKTIQP 105
           + S   + ID+ K P      + D+    +     DD      Q D +  +++LKK ++ 
Sbjct: 17  SFSNHSDNIDNKKEP-----FQIDIEKESTESVALDDTN---EQFDGKCSDQRLKKDLKA 68

Query: 106 RHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTL 165
           RHV M++                 A AGP  ++I Y+ +   ++ ++  +GEMA  Y+ L
Sbjct: 69  RHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAA-YIPL 127

Query: 166 VGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWT--TKVNADIFVLI 223
             GF +Y     DPAL F++ + Y +++F + P +L  A++ IQYW    KVN  +++ I
Sbjct: 128 -DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITI 186

Query: 224 FYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRD 283
             ++++ IN FG  + + E EF  +S K+++M+G  IL  +I+ GG      +G +YW+ 
Sbjct: 187 VLVVIVVINTFG-VKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKH 245

Query: 284 PGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKK 336
           PGAF+       G  G  RF   VS  V   F +   E   I A+E  NPRK IP A K 
Sbjct: 246 PGAFKEYSKSIHGDIG--RFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKL 303

Query: 337 VIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKA--SPYVLAVSTHGVRVVPHFINA 394
            ++R ++ Y+ +I ++G+ V  +   LL + + +T A  SP+V+A+   G+  +PH  NA
Sbjct: 304 TMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNA 363

Query: 395 VILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCA 454
            +L+ VFS  +S  Y +SR L +LA    APK+F   +R G P     V  +  ++A+ +
Sbjct: 364 CVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMS 423

Query: 455 CSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSA 514
            SS   ++FN+ + +  ++ V TW  I +++I F RA++ QG       Y + +  +G+ 
Sbjct: 424 VSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAY 483

Query: 515 YAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIR 574
           ++     L+ + + +   +       D + F   Y+ +P+F + Y GYK  K+      +
Sbjct: 484 FSLFFCCLLALIKNFTVFL---NHKFDYRNFITGYIGLPLFFICYFGYKFVKK--TKIRK 538

Query: 575 AKDIDLISHRHIHDPEIL--RQEREEYQEKL-RNGPVWRRVYD 614
            +++DL S +   D E    R +     E++ +NG  W   Y+
Sbjct: 539 PEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYE 581

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  244 bits (623), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 169/584 (28%), Positives = 286/584 (48%), Gaps = 58/584 (9%)

Query: 64  THHIETD------MNPILSHQSVFDDAKVEISQVD---------DELNEKLKKTIQPRHV 108
           THH E +      M  I  +QS   +  V   ++D         D    +LK+ +Q RHV
Sbjct: 113 THHYEAEKDDAIRMEKISKNQSASSNGTVR-EELDLEKSPSADGDAGPHRLKQGLQSRHV 171

Query: 109 VMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGG 168
            +++                    GPAGL I Y I+++ IY I+ A+GEM V +L   G 
Sbjct: 172 QLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEM-VCFLPGDGS 230

Query: 169 FNAYPGF-----LVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLI 223
            +A          VD +L F+  W Y   +  +   E   AS  ++YWTT V   +++ I
Sbjct: 231 DSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWITI 290

Query: 224 FYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRD 283
           F  +V+ +N F   + Y E+EF   S KIL ++G  IL  ++  GG      +G +YW+ 
Sbjct: 291 FLCVVVLLN-FSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQH 349

Query: 284 PGAFR-----GSDGPNRFKGVVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKV 337
           PG+F      GS G   F  + + ++  AF+F    E + +T++E ++ R+ I  A+++ 
Sbjct: 350 PGSFAHHLAGGSLG--NFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRF 407

Query: 338 IYRALLIYLASIIIVGLLVPYDSSEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINA 394
           ++R +  Y+   + + ++VPY+   L   L        +SPYV+ +   G++V+PH IN 
Sbjct: 408 VWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIING 467

Query: 395 VILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCA 454
            IL S +S A++  ++S+R LLT+A+ G APK    ++R G P +   V  + + +A+  
Sbjct: 468 CILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLN 527

Query: 455 CSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSA 514
            SS   +VFNW   IS +S    W   C++++RFR+A+   G   D + +K+    WG  
Sbjct: 528 VSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKT----WGQP 582

Query: 515 YAFVMMILIMIGQCWVGIVPVGEGSA-------DVQAFFQDYLAMPVFIVLYLGYKIWKR 567
           Y     + +      V I+ +  G A       +V  F   Y+ +P+F+VL+LG+K++ R
Sbjct: 583 YTVWFSLTV------VSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTR 636

Query: 568 DWRLFIRA-KDIDLIS-----HRHIHDPEILRQEREEYQEKLRN 605
            W  +  +  +ID+ +          D E LR     ++EK  +
Sbjct: 637 TWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMD 680

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  243 bits (619), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 163/571 (28%), Positives = 285/571 (49%), Gaps = 42/571 (7%)

Query: 56  DSFKPPETTHHIETDMNPILSHQSVFD-DAKVEISQVDDELNEKLKKTIQPRHVVMMSXX 114
           D+ +  + + +     N  +    + D D +   S   D    KLK+ +Q RHV +++  
Sbjct: 66  DAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPSVEGDNEPHKLKQGLQSRHVQLIALG 125

Query: 115 XXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPG 174
                             GPAGL I Y I+++ IY I+ A+GEM V +L   G  +A   
Sbjct: 126 GAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEM-VCFLPGDGSDSAGST 184

Query: 175 F-----LVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVL 229
                  VD +L F+  W Y   +  +   E   AS  ++YWTT V   +++ IF  +V+
Sbjct: 185 ANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVV 244

Query: 230 AINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR- 288
            +N+    + Y E+EF   S KIL ++G  IL  ++  GG  N   +G +YW+ PGAF  
Sbjct: 245 LLNL-SAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAH 303

Query: 289 ----GSDGPNRFKGVVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALL 343
               GS G   F  + + ++  AF+F    E + +T++E ++ R+ I  A+++ ++R + 
Sbjct: 304 HLTGGSLG--NFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIF 361

Query: 344 IYLASIIIVGLLVPYDSSEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISV 400
            Y+   + + ++VPY+   L   L        +SP+V+ +   G++V+PH IN  IL S 
Sbjct: 362 FYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSA 421

Query: 401 FSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKET 460
           +S A++  ++S+R LLT+A+ G APK    ++R G P +   V  + + +A+   SS   
Sbjct: 422 WSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTA 481

Query: 461 EVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMM 520
           +VFNW   IS +S    W   C++++RFR+A+   G   D + +K+    WG  Y     
Sbjct: 482 DVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKT----WGQPYTVWAS 536

Query: 521 ILIMIGQCWVGIVPVGEGSA-------DVQAFFQDYLAMPVFIVLYLGYKIWKRDW-RLF 572
           +++      VGI+ +  G A        +  F   Y+ +P+F+VL+ G+K++ R W + +
Sbjct: 537 LIV------VGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWW 590

Query: 573 IRAKDIDLISHRHIHDPEILRQEREEYQEKL 603
           +   +ID+ +       EI  + RE  + +L
Sbjct: 591 LPVSEIDVTTGL----IEIEEKSREIEEMRL 617

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  241 bits (616), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 166/574 (28%), Positives = 295/574 (51%), Gaps = 37/574 (6%)

Query: 10  ESYEKNDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIET 69
           E+YE N+        N +D++D+D    + E   S+  + +    I + K   +   ++T
Sbjct: 21  ENYEVNN--------NGIDLVDVDI---DIEATASNDNNKKNPQIIYNEKS-YSQDELQT 68

Query: 70  DMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXX 129
               I+   S+ D+A+ E  +     N +LK+ ++ RH+ +++                 
Sbjct: 69  TSPTII--DSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSAL 126

Query: 130 AHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGF-----LVDPALNFS 184
           A+ GPAGL I Y I+++ +Y I+ A+GEM V +L   G  +A          VDP+L F+
Sbjct: 127 ANCGPAGLFISYLIISTFVYPIMNALGEM-VCFLPGNGSDSAGSAAHLVHKYVDPSLGFA 185

Query: 185 IAWIYCIQWFCVCPLELVTASMTIQYWT--TKVNADIFVLIFYILVLAINIFGGARGYAE 242
            +W Y   +  +   E+  AS  I+YW     V    ++ IF  L++ +N F     Y E
Sbjct: 186 ASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILN-FLPVNVYGE 244

Query: 243 TEFICNSCKILMMIGFFILGIVIICGGA-GNDGFIGGKYWRDPGAF----RGSDGPNRFK 297
           +EF   S KIL + G  IL  ++  GG   +DG +G +YW++PG+F     G  G N F 
Sbjct: 245 SEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGGGGGN-FL 303

Query: 298 GVVSTLVTAAFS-FGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356
            + + ++   FS     E + +T+SE ++ R+ I  A+K+ ++R +  Y+   + +G++V
Sbjct: 304 DIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIV 363

Query: 357 PYDSSEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSR 413
            Y+   L   L  S A   +SP+V+ +   G+R VPH +N  IL S +S  ++  ++SSR
Sbjct: 364 AYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSR 423

Query: 414 MLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLS 473
            LLT+AR G APK+F  +++ G P        +++ +A+   SS   +VFNW   IS +S
Sbjct: 424 SLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTIS 483

Query: 474 QVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIV 533
               W   C+++IRFR+A+    +    I ++++   +   Y+   + LI +   +   +
Sbjct: 484 GFIGWICACVAYIRFRKAITYN-KLTHRIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFI 542

Query: 534 PVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKR 567
           P    + +V+ F   Y+ +P+FIVL++G+K++ R
Sbjct: 543 PR---NWNVKDFIAAYITLPIFIVLWIGHKVFTR 573

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 165/556 (29%), Positives = 279/556 (50%), Gaps = 40/556 (7%)

Query: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXX 127
           E D+  +   +    D+    S+V+ E N KLK+ +  RHV  ++               
Sbjct: 30  ELDLESLTREKITRSDSS---SEVEAEGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSV 86

Query: 128 XXAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNA-----YPGFLVDPALN 182
                GP GLVI Y I+++ IY I+ A+GEM V YL   G  +A       G  VD +L 
Sbjct: 87  TLKTVGPGGLVISYIIISTVIYPIMNALGEM-VCYLPGNGEDSAGSVAHLVGRYVDKSLA 145

Query: 183 FSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAE 242
           F+  W Y   +  +   E   AS  + YWTT V   +++ IF  +V  +N F   + + E
Sbjct: 146 FATGWNYYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFLGIVTLLN-FSAVKYFGE 204

Query: 243 TEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-----GSDGPNRFK 297
           TEF   S KIL ++G  ++  ++  GG  +   +G  YW+DPG F      GS G   F 
Sbjct: 205 TEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHITGGSWG--SFL 262

Query: 298 GVVSTLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLV 356
            + + ++  AF+F    E +A+T+SE ++ R+ I  A+K+ I+R +  Y+   + + ++V
Sbjct: 263 DIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIV 322

Query: 357 PYDSSELLGS---SSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSR 413
            Y+   LL +         +SP+V+ +   G++V+PH INA IL S +S  +S  ++SSR
Sbjct: 323 AYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSR 382

Query: 414 MLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLS 473
            L+T+A  G APK+F  V+R G P     + A+++ +AF   SS   +VF+W   IS +S
Sbjct: 383 SLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTIS 442

Query: 474 QVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIV 533
               W    ++++RFR+A+       D + +K+    +   Y+ +++ +I +   +   +
Sbjct: 443 GFLGWICAIIAYLRFRKAI-FYNNMYDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFI 501

Query: 534 PVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD------WRLFIRAKDIDLISHRHIH 587
           P     +D   F   Y+ +P+F++L++G+K W R        +L+    +ID+I+     
Sbjct: 502 PRFWSGSD---FVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYYPVDEIDVITG---- 554

Query: 588 DPEILRQEREEYQEKL 603
                  E EE  EKL
Sbjct: 555 -----LAEAEEVAEKL 565

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  238 bits (608), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 174/608 (28%), Positives = 304/608 (50%), Gaps = 40/608 (6%)

Query: 15  NDITKSSA-KFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNP 73
           +D+  SSA    D +V+ +  +  +     S   H R+ N  D     E     ++  + 
Sbjct: 22  DDVGGSSAGDKKDDNVVQVTESASS----GSRNNHQRYDNEKDDDIRMEKISKDQSASSN 77

Query: 74  ILSHQSVFDDAKVEISQVDDELNE--KLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAH 131
              H+ +  D  +E S   D  NE  KLK+ +Q RHV +++                   
Sbjct: 78  GTIHEELVMDVDLEKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHT 137

Query: 132 AGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGF-----LVDPALNFSIA 186
            GP GL I Y I+++ IY I+ A+GEM V +L   G  +A          VD +L F+  
Sbjct: 138 CGPGGLFISYIIISAVIYPIMCALGEM-VCFLPGDGSDSAGSTANLVTRYVDASLGFATG 196

Query: 187 WIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFI 246
           W Y   +  +   E   AS  ++YWTT V   +++ +F ++V+ +N F   + Y E+EF 
Sbjct: 197 WNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLLN-FSAVKVYGESEFW 255

Query: 247 CNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-----GSDGPNRFKGVVS 301
             S KIL ++G  IL  ++  GG      +G +YW+ PGAF      GS G   F  + +
Sbjct: 256 FASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSLG--NFTDIYT 313

Query: 302 TLVTAAFSF-GQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDS 360
            ++  AF+F    E + +T++E ++ R+ I  A+++ ++R +  Y+   + + ++VPY+ 
Sbjct: 314 GIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYND 373

Query: 361 SEL---LGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLT 417
             L   L        +SP+V+ +   G++V+PH IN  IL S +S A++  ++S+R LLT
Sbjct: 374 PVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLT 433

Query: 418 LARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFT 477
           +A+ G APK    ++R G P +      + + +A+   SS   +VFNW   IS +S    
Sbjct: 434 MAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLG 493

Query: 478 WALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAY----AFVMMILIMIGQCWVGIV 533
           W   C++++RFR+A+   G   D + +K+    WG  Y    + +++ +I I   +   +
Sbjct: 494 WICGCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPYTVWFSLIVVSIITITNGYAIFI 548

Query: 534 PVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDW-RLFIRAKDIDLISHRHIHDPEIL 592
           P     AD   F   Y+ +P+F+VL+LG+K++ R W + ++   +ID+   R + + E  
Sbjct: 549 PKYWKVAD---FIAAYVTLPIFLVLWLGHKLYTRTWHQWWLPVSEIDVT--RGLVEIEEK 603

Query: 593 RQEREEYQ 600
            +E EE +
Sbjct: 604 SREIEELR 611

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  236 bits (602), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/520 (28%), Positives = 270/520 (51%), Gaps = 24/520 (4%)

Query: 96  NEKLKKTIQPRHVVMMSXXXXXXXXXXXXXXXXXAHAGPAGLVIGYAIMASCIYCIIQAV 155
           +  LKK ++ RH+ +++                    GPAGL   Y I++  IY ++ A+
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 156 GEMAVNYLTLVGGFNAYPGF-----LVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQY 210
           GEM V YL   G  +           VDP+L F+  W Y   +  +   E   AS  +QY
Sbjct: 108 GEM-VCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQY 166

Query: 211 WTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270
           WTT V    ++ IF  +V+ +N F   + Y E+EF   S KIL ++G   +  ++  GG 
Sbjct: 167 WTTAVPKGAWITIFLGVVVLLN-FCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGG 225

Query: 271 GNDGFIGGKYWRDPGAFR---GSDGPNRFKGVVSTLVTAAFSF-GQTEFLAITASEQSNP 326
            +   +G +YW+ PGAF     S    RF  + + ++   F+F    E +A+T++E  + 
Sbjct: 226 PHHDRLGFRYWQKPGAFAYHITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 327 RKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSEL---LGSSSAATKASPYVLAVSTH 383
           R+ I  A+++ +YR +  Y++S + +G +V Y+   L   L        +SP+V+ +   
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443
           G++V+PH IN  IL S +S  +S  +++SR LL+++++G+APK+   V+R G P     +
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503
            ++++ +A+   SS   +VF W   IS +S    W  I ++++RFR+A+  Q    + + 
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563
           +K+    +G+ +  + + +I +   +   +P    + +V  F   Y+ +P+F+VL++G+K
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIP---ANWNVSDFIAAYVTLPIFLVLWIGHK 521

Query: 564 IWKRDWRLF-IRAKDIDLISHRHIHDPEILRQEREEYQEK 602
           +W R W+ + I   +ID+ +       + + +E +E  EK
Sbjct: 522 LWTRTWKTWAIPVPEIDVTTGL-----KEIEEESKECDEK 556

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,845,588
Number of extensions: 2373486
Number of successful extensions: 11159
Number of sequences better than 10.0: 413
Number of HSP's gapped: 9703
Number of HSP's successfully gapped: 433
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)