Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001901.10ON1851858261e-114
KNAG0C002701.10ON1741682901e-32
TDEL0C069301.10ON1841642868e-32
ZYRO0F18370g1.10ON2201642775e-30
NDAI0A001901.10ON1711672613e-28
SAKL0C00572g1.10ON3381752434e-24
NCAS0B090601.10ON1671642326e-24
KLLA0C00594g1.10ON194732102e-20
TPHA0E039601.10ON1771132041e-19
Kwal_33.130231.10ON193731832e-16
TBLA0A049701.10ON1811641795e-16
KLTH0F00572g1.10ON195891588e-13
Kpol_2002.131.10ON164801341e-09
Ecym_10121.10ON1771061253e-08
YCL056C (PEX34)1.10ON144165840.008
Suva_3.1571.10ON14492710.43
Smik_3.191.10ON144101700.55
Skud_3.81.10ON144113652.6
YDL234C (GYP7)2.30ON74652655.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00190
         (185 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...   322   e-114
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...   116   1e-32
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   114   8e-32
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   111   5e-30
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   105   3e-28
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    98   4e-24
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    94   6e-24
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    86   2e-20
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    83   1e-19
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    75   2e-16
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    74   5e-16
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    65   8e-13
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    56   1e-09
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    53   3e-08
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...    37   0.008
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...    32   0.43 
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    32   0.55 
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...    30   2.6  
YDL234C Chr4 complement(34237..36477) [2241 bp, 746 aa] {ON}  GY...    30   5.7  

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score =  322 bits (826), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 166/185 (89%), Positives = 166/185 (89%)

Query: 1   MSSPLTDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGN 60
           MSSPLTDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGN
Sbjct: 1   MSSPLTDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGN 60

Query: 61  LGSKIWLVSLILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLL 120
           LGSKIWLVSLILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLL
Sbjct: 61  LGSKIWLVSLILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLL 120

Query: 121 QSLQKCNSIIRDXXXXXXXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRII 180
           QSLQKCNSIIRD                   FKVKSLERYVKGIRNLEILSNLITVTRII
Sbjct: 121 QSLQKCNSIIRDLLLEFLQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

Query: 181 TATSP 185
           TATSP
Sbjct: 181 TATSP 185

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score =  116 bits (290), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 105/168 (62%), Gaps = 4/168 (2%)

Query: 16  SITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIR 75
           S++ ED+L+ KLE IC++FDNIY LK+LG+I ++NF+Y+KLNKGN+GSK+W ++LILSIR
Sbjct: 6   SLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIR 65

Query: 76  RCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXX 135
           +  K L  + +TR K V E+  +   R +  ++ LVN ++ +KL  +L+KC+ +I D   
Sbjct: 66  KNLKRLVRLVQTRFKLVFEIEQIL--RQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFL 123

Query: 136 XXXXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRIITAT 183
                           F +    R+ K  + L  +SN++T+ R++ + 
Sbjct: 124 DLAQLLIYLFIVSGDCFNIP--PRFKKFKKYLGPMSNVVTILRMLVSV 169

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  114 bits (286), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 99/164 (60%), Gaps = 8/164 (4%)

Query: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77
           + ED LI  LE +C+ FDN+YF K+LG+I E+NF+Y++LNKG  GSK+W V+L+LS+R+C
Sbjct: 21  SFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKC 80

Query: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXXXX 137
            + +  + R R +  TE+  + K     +  GL+N +LK+K+L  LQK N+++R+     
Sbjct: 81  LRQIFQIVRNRIRLKTEIKGMDK-----NGKGLMNDVLKEKILLMLQKSNAMMRETLLDL 135

Query: 138 XXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRIIT 181
                         FK+ ++ +  + I  LE LSN +T+ R  T
Sbjct: 136 LQNSVYLMIVVIDVFKL-NIPKRARQI--LEPLSNFVTIMRFFT 176

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  111 bits (277), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 90/164 (54%), Gaps = 7/164 (4%)

Query: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77
           T ED LI  LE IC +FDN+Y LK LG+I EDN +Y++LNKG  GSK+W V+L+LS R+ 
Sbjct: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115

Query: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXXXX 137
           F  L  + + + K   E+    K+     +  LV  +L++K   +L+KC+ II+D     
Sbjct: 116 FSRLLKIMKAKSKLKEEM----KELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLEL 171

Query: 138 XXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRIIT 181
                         FK+   ++ +K    LE LS+ I V RI T
Sbjct: 172 LQTLAYLAIVVIEVFKINVSQKVIK---ILEPLSHFIAVIRIFT 212

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  105 bits (261), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/167 (39%), Positives = 96/167 (57%), Gaps = 6/167 (3%)

Query: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77
           T+ED +I  LE IC +FDN+Y LK+LG+I E+N +Y+ LNKGN GSKIW V+LIL+ R+ 
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63

Query: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXXXX 137
              L    + R + V E    + KR   +EN LV+ +L +KL   ++KC+S+I D     
Sbjct: 64  VHQLIRAVKARIRLVKERK--NSKRITRNEN-LVSSVLHEKLDIGIKKCSSMIMDLLLEL 120

Query: 138 XXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRIITATS 184
                         FK+K  ++ V     LE LSNL+ + R+ +A S
Sbjct: 121 FQTLVYLFLVSINIFKLKFSDKMVYV---LEHLSNLLVLIRMFSAKS 164

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 98.2 bits (243), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 92/175 (52%), Gaps = 12/175 (6%)

Query: 8   KDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWL 67
           +D++  ++  + EDILI  LE +  VFD++Y LKN G+I E NF+Y+ LNKG LGSK+WL
Sbjct: 165 EDEKGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWL 224

Query: 68  VSLILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSE--NGLVNGILKDKLLQSLQK 125
            +L+LS+R+    L  + R R        ++ K+R  +    +     I+ DK  Q + +
Sbjct: 225 ATLVLSLRKSLGQLFRLARARH-------MLQKERRSTPHKCSKTFAKIIADKFTQKIGQ 277

Query: 126 CNSIIRDXXXXXXXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRII 180
            +  I+D                   FK+K   R+    R LE +S+L+TV+R  
Sbjct: 278 LDRQIKDVLLDVLQNLAYLLVVAVDVFKLKLPHRWR---RLLEWVSSLVTVSRFF 329

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 94.0 bits (232), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 96/164 (58%), Gaps = 5/164 (3%)

Query: 19  LEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCF 78
           LED +++ LE IC +FDN+YF K++GV+ E N +Y+ LNKG+ GSK+W ++L+LS ++  
Sbjct: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLI 63

Query: 79  KNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXXXXX 138
             LT   + R K   E+    K+ ++  +  LVN +L++KL  SL KC  IIR+      
Sbjct: 64  TRLTKSLKIRAKIKKEIDESPKENDE--DKSLVNSLLREKLELSLAKCMDIIRNNVLELL 121

Query: 139 XXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRIITA 182
                        FKVK  +++ K +  LE LSN+IT+ R+  +
Sbjct: 122 QTMMYLSIAFINVFKVKVPQKW-KHL--LEQLSNIITIIRVFIS 162

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 55/73 (75%)

Query: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77
           +LED+LID L  + + FD++Y L++ G+I + NF+Y+KLNKG++GSK+WLVSL+LSIRR 
Sbjct: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLLSIRRS 91

Query: 78  FKNLTHMYRTRRK 90
              L  + R + K
Sbjct: 92  LTRLYTLIRLKLK 104

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 69/113 (61%), Gaps = 10/113 (8%)

Query: 19  LEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCF 78
            E  L++ LE I  +FD ++FL++ G+IKE+NF Y+ LN+ N+GSKIW V+LILSIR+ +
Sbjct: 17  FESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKLY 76

Query: 79  KNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIR 131
           KN+    +      TEL+ + K           N +  D +LQ +Q  N+I++
Sbjct: 77  KNILKSTKLLSLLKTELTKIEKN----------NDLTSDIILQKIQNNNTILK 119

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 75.1 bits (183), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 52/73 (71%)

Query: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77
            +E+  I  +E +  +FD+I+ LK+ G+I E N++Y+KLNK    SK+WL+SL+LS R+C
Sbjct: 32  AIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKC 91

Query: 78  FKNLTHMYRTRRK 90
            ++L +++ +R +
Sbjct: 92  IRDLNNLWMSRSR 104

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {ON}
           Anc_1.10 YCL056C
          Length = 181

 Score = 73.6 bits (179), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 90/164 (54%), Gaps = 14/164 (8%)

Query: 27  LEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFKNLTHMYR 86
           LE IC+VFDNIYFL+++G+I + N  Y+ LN+  LGSKIWL++L+L+IR+    L  + +
Sbjct: 17  LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRKDTLELLKLLK 76

Query: 87  TRRKYVTELSI------VSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXXXXXXX 140
            + K   EL        + K  N S +   V  I+KDKL  SL+  N+ I+D        
Sbjct: 77  LKTKISDELEFQLTKLKMEKIGNYSKD---VTLIIKDKLQNSLKIINNSIKDRIFDLIQN 133

Query: 141 XXXXXXXXXXX--FKVKSLERYVKGIRNLEILSNLITVTRIITA 182
                           KSL+R+ K I  LEI+SN++ V+R+ + 
Sbjct: 134 LIYLLILLINIGGHYYKSLQRF-KHI--LEIISNMLIVSRVFST 174

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 65.5 bits (158), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%)

Query: 6   TDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKI 65
            DK      +   +E  L+  LE I  +FD++  L++ GVI E+N  Y+KLNK    SK 
Sbjct: 20  PDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKA 79

Query: 66  WLVSLILSIRRCFKNLTHMYRTRRKYVTE 94
           WLVSL LS RR   ++ ++  +R +   E
Sbjct: 80  WLVSLTLSSRRNASDIINLAISRSRLKRE 108

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%)

Query: 16 SITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIR 75
          S+  EDI++D LEGIC++FD+IYF+K LG+I + +F+Y+K+ + N   K+WL +L+L I+
Sbjct: 3  SLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLIIK 62

Query: 76 RCFKNLTHMYRTRRKYVTEL 95
          +    L   Y+  R    EL
Sbjct: 63 KLVVKLFQNYKILRFLKIEL 82

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 2   SSPLTDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNL 61
           +  L+ +D + +    T ED L + L    T +D IY  +++G+IK+DN IYK L  G +
Sbjct: 16  AEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKI 75

Query: 62  GSKIWLVSLILSIRRCFKNLTHMYRT--RRKYVTELSIVSKKRNQS 105
            S   L+ L+L  R+ F  L  + R     K V   + + KK N++
Sbjct: 76  NSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNET 121

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 66/165 (40%), Gaps = 30/165 (18%)

Query: 17  ITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRR 76
           I+ +DI  +   G+ ++ D    L+NLGV+ +      KL    L  K+WL    +S+ +
Sbjct: 10  ISAKDIWENIWSGVSSLLDFFAVLENLGVVND------KLYVSGLLRKVWLCYSCISVIK 63

Query: 77  CFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDXXXX 136
           C   L  + + + K    L            +G  NG++KDKL+   +K N  IR     
Sbjct: 64  CVWKLIKLCKVKFKIDQRL------------DGEGNGLVKDKLINFKKKYNEHIRHITAA 111

Query: 137 XXXXXXXXXXXXXXXFKVKSLERYVKGIRNLEILSNLITVTRIIT 181
                                     G R  + LSN+IT+ RII 
Sbjct: 112 LLQDLSYLMVLIY------------PGTRLFKRLSNIITLCRIIV 144

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 18/92 (19%)

Query: 29  GICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFKNLTHMYRTR 88
           G+ ++ D    L+NLGV+ +      KL    +  K+WL    +S+ RC   L  + R +
Sbjct: 22  GVSSLLDFFAVLENLGVVDD------KLYLSGILRKVWLCYSWISVVRCVWKLIKLCRVK 75

Query: 89  RKYVTELSIVSKKRNQSSENGLVNGILKDKLL 120
            K    L            NG  NG++K+KL+
Sbjct: 76  FKINERL------------NGQGNGLIKEKLI 95

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 31.6 bits (70), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 18/101 (17%)

Query: 20  EDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFK 79
           +++ I+   G+ ++ D    L+NLGV+ +      KL    +  K+WL    +S+ +C  
Sbjct: 13  KNLWINVWNGVSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWLCYSWISVIKCVW 66

Query: 80  NLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLL 120
            L ++ + + K    L            NG  NG++K+KL+
Sbjct: 67  KLINLCKVKFKIDQRL------------NGPGNGLVKEKLM 95

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 18/113 (15%)

Query: 20  EDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFK 79
           +DI  +      ++ D    L+NLGV+ +      KL    +  K+WL    +S+ RC  
Sbjct: 13  KDIWTNIWNSASSLLDFFAVLENLGVVDD------KLYLSGILRKVWLCYSWVSVVRCIW 66

Query: 80  NLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRD 132
            L  + + + K    L            NG  NG++K+KL+   +  N  IR 
Sbjct: 67  KLIKLCKVKFKIDERL------------NGQGNGLIKEKLVNFRKMYNDQIRQ 107

>YDL234C Chr4 complement(34237..36477) [2241 bp, 746 aa] {ON}
           GYP7GTPase-activating protein for yeast Rab family
           members including: Ypt7p (most effective), Ypt1p,
           Ypt31p, and Ypt32p (in vitro); involved in vesicle
           mediated protein trafficking
          Length = 746

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 55  KLNKGNLGSKIWLVSLILSIRRCF--KNLTHMYRTRRKYVTELSIVSKKRNQ 104
           +L K NL  + WLV+  L+  R F  K+L   Y   +K  TEL+    K N+
Sbjct: 182 ELKKSNLEPEFWLVNPSLNDLRNFVSKDLLESYNNSKKDTTELATAGVKLNE 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,281,123
Number of extensions: 672487
Number of successful extensions: 2006
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2028
Number of HSP's successfully gapped: 28
Length of query: 185
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 82
Effective length of database: 41,670,801
Effective search space: 3417005682
Effective search space used: 3417005682
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)