Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001801.9ON72372338110.0
Kpol_2002.121.9ON73972426820.0
NCAS0B090701.9ON73072626770.0
ZYRO0F18392g1.9ON72572726400.0
KNAG0C002601.9ON74473926030.0
TBLA0A075601.9ON74168225770.0
SAKL0C00550g1.9ON73272325710.0
TPHA0E039701.9ON74772525060.0
NDAI0A001801.9ON74070124590.0
KLLA0C00572g1.9ON71270924420.0
CAGL0B00418g1.9ON74373623860.0
YCL057W (PRD1)1.9ON71270323790.0
Skud_3.71.9ON71270523740.0
Smik_3.181.9ON71270323410.0
Suva_3.1561.9ON71270423220.0
Ecym_1011na 1ON71672421360.0
AGR406C1.9ON68368617680.0
AGR405Cna 1ON71768617100.0
ABR185WsingletonON4574169861e-126
NDAI0E020102.432ON7785675282e-56
CAGL0D02112g2.432ON7615104549e-47
KNAG0A062002.432ON7895274488e-46
Ecym_60992.432ON7735084442e-45
KAFR0D029502.432ON7774774345e-44
SAKL0E03938g2.432ON7675144335e-44
Kpol_297.82.432ON7876784328e-44
NCAS0A042802.432ON7735174302e-43
Suva_11.912.432ON7755194222e-42
ZYRO0G20130g2.432ON7865034222e-42
Kwal_26.76162.432ON7705184203e-42
Skud_11.932.432ON7724984203e-42
TPHA0G023902.432ON7954734203e-42
TBLA0I007102.432ON7734794161e-41
Smik_11.1022.432ON7724984142e-41
KLTH0D04730g2.432ON7725254071e-40
YKL134C (OCT1)2.432ON7724984034e-40
TDEL0A020802.432ON7874664018e-40
AFR198W2.432ON7766564001e-39
KLLA0B12397g2.432ON7795143492e-33
KNAG0B067304.355ON596123752.3
TPHA0E010805.358ON384118742.5
TDEL0H025607.191ON48555742.7
ADR179C5.546ON33260733.0
KAFR0B049502.363ON62056725.2
CAGL0L00649g7.15ON704114707.9
SAKL0H12848g8.430ON47558708.6
YIL017C (VID28)7.184ON92183709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00180
         (723 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...  1472   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....  1037   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...  1035   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...  1021   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...  1007   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   997   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   994   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   969   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        951   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   945   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   923   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   920   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    919   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   906   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   899   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   827   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   685   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   663   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   384   e-126
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   207   2e-56
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   179   9e-47
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   177   8e-46
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   175   2e-45
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   171   5e-44
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   171   5e-44
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   171   8e-44
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   170   2e-43
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   167   2e-42
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   167   2e-42
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   166   3e-42
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   166   3e-42
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   166   3e-42
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   164   1e-41
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   164   2e-41
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   161   1e-40
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   159   4e-40
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   159   8e-40
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   158   1e-39
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   139   2e-33
KNAG0B06730 Chr2 (1330382..1332172) [1791 bp, 596 aa] {ON} Anc_4...    33   2.3  
TPHA0E01080 Chr5 (221722..222876) [1155 bp, 384 aa] {ON} Anc_5.3...    33   2.5  
TDEL0H02560 Chr8 (428642..430099) [1458 bp, 485 aa] {ON} Anc_7.1...    33   2.7  
ADR179C Chr4 complement(1017980..1018978) [999 bp, 332 aa] {ON} ...    33   3.0  
KAFR0B04950 Chr2 complement(1027783..1029645) [1863 bp, 620 aa] ...    32   5.2  
CAGL0L00649g Chr12 complement(80936..83050) [2115 bp, 704 aa] {O...    32   7.9  
SAKL0H12848g Chr8 (1101137..1102564) [1428 bp, 475 aa] {ON} weak...    32   8.6  
YIL017C Chr9 complement(318200..320965) [2766 bp, 921 aa] {ON}  ...    32   9.0  

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score = 1472 bits (3811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/723 (98%), Positives = 713/723 (98%)

Query: 1   MLNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNMTISAFIAPQAAPSWNWNPSRLLF 60
           MLNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNMTISAFIAPQAAPSWNWNPSRLLF
Sbjct: 1   MLNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNMTISAFIAPQAAPSWNWNPSRLLF 60

Query: 61  DAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREA 120
           DAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREA
Sbjct: 61  DAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREA 120

Query: 121 SLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVR 180
           SLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVR
Sbjct: 121 SLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVR 180

Query: 181 SGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFI 240
           SGLNLPEDKR          GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFI
Sbjct: 181 SGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFI 240

Query: 241 DEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELA 300
           DEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELA
Sbjct: 241 DEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELA 300

Query: 301 TTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNRE 360
           TTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNRE
Sbjct: 301 TTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNRE 360

Query: 361 YDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKN 420
           YDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKN
Sbjct: 361 YDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKN 420

Query: 421 KSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRS 480
           KSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRS
Sbjct: 421 KSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRS 480

Query: 481 YPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFV 540
           YPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFV
Sbjct: 481 YPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFV 540

Query: 541 EAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFD 600
           EAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFD
Sbjct: 541 EAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFD 600

Query: 601 MTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAE 660
           MTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAE
Sbjct: 601 MTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAE 660

Query: 661 VFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
           VFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL
Sbjct: 661 VFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720

Query: 721 DAA 723
           DAA
Sbjct: 721 DAA 723

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/724 (68%), Positives = 598/724 (82%), Gaps = 11/724 (1%)

Query: 5   LSRLVIPSRKS-FLSLVCIPATSYLVYNRLYSNMTISAF-IAPQAAPSWNWNPSRLLFDA 62
           +S   + +RK+  +S   +PA ++ +    YS MT S+  IAPQ AP+WNW P  ++ DA
Sbjct: 20  ISGKTLKNRKTRIVSFFAVPAIAFTILK--YSTMTNSSLLIAPQPAPTWNWTPEGIVKDA 77

Query: 63  ECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASL 122
           E +I +SNR++D L+++  PTVEN + PYM HENK+SPLIN+L FLQHVS D  IR++S+
Sbjct: 78  ESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSM 137

Query: 123 KATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYD---FETWKFIEKVHKDYV 179
           KATEL+Q FEIEASLR DLF+QFDKIW ++ +  + F ++ D   +E+++FIEK HKD++
Sbjct: 138 KATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSE-FNEKSDSKNYESYRFIEKCHKDFI 196

Query: 180 RSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF 239
           RSGLNL ++KR           +NSL +SKNLGEQKE IAFT+EELDGVSDAV EQFEKF
Sbjct: 197 RSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKF 256

Query: 240 IDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNEL 299
            DE+TGEEKFKVTFKYPDI PVLK+AKNP TR+ AF ADQNKVP+NE LFV+TLKLRN+L
Sbjct: 257 KDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDL 316

Query: 300 ATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNR 359
           +T L+YS YANYNLE KMAK +ETV +FL+DLK +L+PL +KEI ILK +K+K+ KELN 
Sbjct: 317 STVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNL 376

Query: 360 EYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET- 418
            YD+HYYI+DHRYYDNKYLKDNFNVDLE ISEYYP+E +I+GMLKIYE + KLKF EET 
Sbjct: 377 PYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETD 436

Query: 419 -KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETG 477
              ++VWHEDVKQL+VWKMDNP+ PEF+GWIYFDLHPRDGKYGHAANFGISSSYVD E  
Sbjct: 437 PAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVD-END 495

Query: 478 KRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPW 537
           KRSYPVTALVCNFSK T+ +PSLLKHNE+TTFFHELGHGIHDLVG N+ SR NGPG+ PW
Sbjct: 496 KRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPW 555

Query: 538 DFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFG 597
           DFVEAPSQMLEFWTWN NEL SLS HY++ EKIP+ L+ SL+ TKHVNGALFALRQLHF 
Sbjct: 556 DFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFS 615

Query: 598 LFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYM 657
            FDM VHT  +V  LNLL+LWN LRE+ICLVE G E+SKGYDSFGHIMS +YSAGYYGYM
Sbjct: 616 TFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYM 675

Query: 658 WAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKE 717
           WAEVFA DMY+TKF+ +PL+S+ GV+YRDI+L+ GG+YE+ DNL +FLGREP+ +AFLKE
Sbjct: 676 WAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKE 735

Query: 718 LGLD 721
           +GL+
Sbjct: 736 MGLN 739

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/726 (69%), Positives = 600/726 (82%), Gaps = 11/726 (1%)

Query: 2   LNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNMTISA----FIAPQA-APSWNWNPS 56
           L+R S   I ++K  +S + +PAT++++  + +  MT+       +AP   AP+W W+P 
Sbjct: 7   LSRYSSTRIANKKLLISAIVLPATAFILTRKSFY-MTLPTNNKLLVAPTGTAPTWKWSPE 65

Query: 57  RLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPK 116
            +L   + VIDN+  LYD L+++++P+VE+LV+PYM +EN    ++N+L FLQHVS D  
Sbjct: 66  SILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKL 125

Query: 117 IREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHK 176
           IR+AS++ATELLQ F IEAS+R DLF QFDKIW ++ +  D  +K  DFET+KFIEKVHK
Sbjct: 126 IRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDD--LKSKDFETYKFIEKVHK 183

Query: 177 DYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQF 236
           DYVR+GLNLPE+KR           +NSL YSKNLGEQKE ++FT+E+L GVS++V EQF
Sbjct: 184 DYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQF 243

Query: 237 EKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296
           EKF+D +T EEK+KVTFKYPDIFPVLKTA+ P+TR+ A+++DQNKVPQNE LFVETLKLR
Sbjct: 244 EKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLR 303

Query: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356
           N+LA  L YSTYANYNL+ KMAK QETV DF+N+LK +LKPL  KEI  LK +K+K+C+E
Sbjct: 304 NQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEE 363

Query: 357 LNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE 416
           L   YD HYYI+DHRYYDNK+LKDN+NVDLE ISEYYPLE TI GML IYE L KLKF +
Sbjct: 364 LGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVD 423

Query: 417 ET--KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDI 474
           ET  K K VWHEDVKQLAVWKMD+ + PEF+GWIYFDLHPRDGKY HAANFGISSSY+  
Sbjct: 424 ETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYI-T 482

Query: 475 ETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGA 534
           + G RS+PVTALVCNFSKST  +PSLLKHNEITTFFHELGHGIHDLVGKNK +RFNGPGA
Sbjct: 483 QDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGA 542

Query: 535 TPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQL 594
           TPWDFVEAPSQMLEFWTWN NEL SLS HY++ EKI +DLL SLI TKHVNGALFALRQL
Sbjct: 543 TPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQL 602

Query: 595 HFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYY 654
           HFGLFDMTVHTT NVE LNLLKLWNELRE+ICLVE G+EL+KGYDSFGHIMSDSYSAGYY
Sbjct: 603 HFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYY 662

Query: 655 GYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAF 714
           GYMWAEVFAADMY+TKF+ +PL+S+ GVQYRDIVLANGGLYEIAD L++FLGREP+ +AF
Sbjct: 663 GYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAF 722

Query: 715 LKELGL 720
           LKELGL
Sbjct: 723 LKELGL 728

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/727 (68%), Positives = 580/727 (79%), Gaps = 9/727 (1%)

Query: 1   MLNRLSRLVIPSRKSFLSLVCIPATS---YLVYNRLYSNMTI-SAFIAPQAAPSWNWNPS 56
           +L   SR+   +RKS  S+V +PA +   Y V    YS M+  + FIAPQ+APSW + P 
Sbjct: 2   LLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQ 61

Query: 57  RLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPK 116
            LL +   +I++S + YD L+ L  PTVENLV+PYM HEN +  + ++L F Q VS D +
Sbjct: 62  SLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKE 121

Query: 117 IREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHK 176
           IR+AS++ATE LQ F IE SLRHDLFLQFDKIW E+ +K  +   + ++E +K++EK+H+
Sbjct: 122 IRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQ-EYEIYKYVEKIHR 180

Query: 177 DYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQF 236
           DY R GL LPEDKR            NSL++SKNLGEQKE +AFT+EELDGVS++V +QF
Sbjct: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQF 240

Query: 237 EKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296
           E+F DE  G  K+KVTFKYPDIFPVLKTAKNP+TR+ AF  DQ+KVPQNE LFVETL+LR
Sbjct: 241 EQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLR 299

Query: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356
           NELA  L YSTYANYNLE KMAK Q+ V  FLN+LK +LKPL +KE   LK IKQKEC+ 
Sbjct: 300 NELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECES 359

Query: 357 LNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE 416
           L   YD HYY++DHRYYDNKYLKDN+NVDLE ISEYYP+E TI+GML IYE L KLKF E
Sbjct: 360 LGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVE 419

Query: 417 ET--KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDI 474
           ET  + +SVWHEDVKQLAVWKMDNP KPEFVGWIYFDLHPRDGKYGHAANFGIS+SYV  
Sbjct: 420 ETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVK- 478

Query: 475 ETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGA 534
           E G RSYPVTALVCNFSK +A +PSLLKHNEI+TFFHELGHGIHDLVG+N+L+ FNGPGA
Sbjct: 479 EDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGA 538

Query: 535 TPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQL 594
            PWDFVEAPSQMLEFWTWN  EL  LS HYES EKIP DLL SLI TKHV+GALFALRQL
Sbjct: 539 VPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQL 598

Query: 595 HFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYY 654
           HFGLFDM VHT+ NV  L+LLKLWNELREE+ LVE G   +KGYDSFGHIMSDSYSAGYY
Sbjct: 599 HFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYY 658

Query: 655 GYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAF 714
           GYMWAEVFAADMYHT+F+ +PLDS+ GVQYRDIVL  GGLYE  DNLR+FLGREPS+ AF
Sbjct: 659 GYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAF 718

Query: 715 LKELGLD 721
           LKELGL+
Sbjct: 719 LKELGLN 725

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/739 (67%), Positives = 589/739 (79%), Gaps = 19/739 (2%)

Query: 2   LNRLSRLVIPSRKSFLSL---VCIP----ATS--YLVYNRLYSNMTISAFIAPQ------ 46
           L +++R ++   +S L+L   V +P    ATS  Y       S  +  + ++PQ      
Sbjct: 7   LCKVTRFLVKVSRSKLTLLPFVVLPTALFATSHFYQSSRSYSSTSSGLSRMSPQLVPPAG 66

Query: 47  AAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLC 106
           A P W +  +++  +A  +I+++N+ YDEL  +  P+++NLV+PYM HEN I  ++N+LC
Sbjct: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126

Query: 107 FLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFV-KEYDF 165
           FLQHVS D +IREAS KATELLQ FEIE SLRHDLFLQFDKIW+E+  +K++F   E  F
Sbjct: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186

Query: 166 ETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREEL 225
           E +KF+EK HKD+VR+GLNL E+ R           +NSL++SKNLGEQKE + F++E+L
Sbjct: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246

Query: 226 DGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQN 285
           DGVSD V EQFE+  DE T E  +KVTFKYPDIFPVLK AKN ETR+ AF  DQNKVPQN
Sbjct: 247 DGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQN 306

Query: 286 EDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISI 345
           E+LFV TLKLR+ELAT L Y TYANYNLE KMAK+Q TV  FLNDLK +LKPL  KEI I
Sbjct: 307 EELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGI 366

Query: 346 LKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKI 405
           LK IK+ ECKEL   +D  YYI+DHRYYD KYLKDNFNVD EAI+EYYP++ TI GMLKI
Sbjct: 367 LKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKI 426

Query: 406 YEELFKLKFNEE--TKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAA 463
           YE +FKLKF EE  T  K+VW+EDVKQ+AVWKMDN + P FVGWIYFDLHPRDGKYGHAA
Sbjct: 427 YETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAA 486

Query: 464 NFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGK 523
           NFGI+SSY+  E G RSYPVTALVCNFSKS+AT+PSLLKHNEITTFFHELGHGIHDLVGK
Sbjct: 487 NFGIASSYIR-EDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545

Query: 524 NKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKH 583
           N+ +RFNGPGATPWDFVEAPSQMLEF+TW+ N L+SLS HY++ E+IP+ LL SLI TKH
Sbjct: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605

Query: 584 VNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGH 643
           VNGALFALRQLHFGLFDMTVHT+ +V SL+LLKLW +LR+EI LVE G + +KGYDSFGH
Sbjct: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665

Query: 644 IMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRD 703
           IMSDSYSAGYYGYMWAEVFA DMY TKF+PNPLDS VG++YRDIVLANGGLYEI DNL++
Sbjct: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725

Query: 704 FLGREPSKNAFLKELGLDA 722
           FLGREPSK+AFLKELGL A
Sbjct: 726 FLGREPSKDAFLKELGLQA 744

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/682 (71%), Positives = 559/682 (81%), Gaps = 5/682 (0%)

Query: 44  APQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLIN 103
           APQAAP+WNW PS+L+ DAE +ID SN  YD L++LK P   N + PYM +ENK+  LIN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 104 KLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKE- 162
           +L FLQHVS +  IR+AS KAT+LLQ FEIE SLR+ LFLQFDKIW +I + KD + K+ 
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 163 YDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTR 222
            D E ++F+ KVH+D+VR+GLNL E KR           NNSL+++ NLGEQ E +AFT+
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 223 EELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKV 282
           EELDGVSD+V EQFEKF DE+TG+E +KVTFKYPDIFPVLKTA+NPETR+KAF  DQNKV
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300

Query: 283 PQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKE 342
            +N  LF  TLKLRN+LA  L YSTYANYNLE KMAK Q++V  FL DL  RLKPL  KE
Sbjct: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSKE 360

Query: 343 ISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGM 402
           I ILK IK+KE KELN  +D+HYY++DHRYYDNKYLKDN+NVDLE ISEYYPL+ TI GM
Sbjct: 361 IEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEGM 420

Query: 403 LKIYEELFKLKFNEE---TKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKY 459
           L IYE L  LKF EE   +KNK+VWH++VKQLAVWKMDNPE PEFVGWIYFDLHPRDGKY
Sbjct: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480

Query: 460 GHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHD 519
           GHAANFGISSSY+     +RSYPVTALVCNFSK TA +P+LLKHNEITTFFHELGHGIHD
Sbjct: 481 GHAANFGISSSYIK-PNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539

Query: 520 LVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLI 579
           LVGKN  SRFNGPGA PWDFVEAPSQMLEFWTWN NEL SLS HY++ EKIP +LL SL+
Sbjct: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599

Query: 580 KTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYD 639
            TKHVNGALFALRQLHFGLFDM VHT+ ++E+L+ LKLWNELREE+ LVE G   +KGYD
Sbjct: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659

Query: 640 SFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIAD 699
           SFGHIMSDSYSAGYYGYMWAEVFA DMY+TKF+ NPL+++VGV+YRD VLA GGLYEI D
Sbjct: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719

Query: 700 NLRDFLGREPSKNAFLKELGLD 721
           NL  FLGR+PS  AFLKELGL+
Sbjct: 720 NLIQFLGRKPSNEAFLKELGLN 741

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/723 (67%), Positives = 581/723 (80%), Gaps = 27/723 (3%)

Query: 18  SLVCIPATSYLVYNRLYS---------------NMTISA-FIAPQAAPSWNWNPSRLLFD 61
           SL+ IPA ++  Y+ L+S               + T+SA  + PQAAPSW ++P  +L  
Sbjct: 16  SLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPEDILQL 75

Query: 62  AECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREAS 121
               I +++ L+D L+ ++ PTVE+LV+P++ HEN   PLIN+L FLQHVS D ++R+AS
Sbjct: 76  TNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDAS 135

Query: 122 LKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDD--FVKEYDFETWKFIEKVHKDYV 179
            KATELLQ FEIEASLRHDLF+QFDK+WQ     KDD  F KE+ FE +KF+EK HKDYV
Sbjct: 136 TKATELLQDFEIEASLRHDLFVQFDKVWQAC---KDDAKFKKEH-FELYKFVEKCHKDYV 191

Query: 180 RSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF 239
           R+GLNLPE+KR           NNSLQ+SKNLGEQKE +AFT EELDGVS +V +QFEKF
Sbjct: 192 RAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEKF 251

Query: 240 IDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNEL 299
            D + G EK KV+FKYPDI PVLKTAKNPETR++AF  DQNKVPQNE LF+ETL+LR+EL
Sbjct: 252 TDTD-GVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDEL 310

Query: 300 ATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNR 359
           A  L YSTYANYNL+ KMAK+QETVL FL DLK +LKPL +KEI  LK +K+K+CKEL  
Sbjct: 311 AGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCKELAI 370

Query: 360 EYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET- 418
            +D+HYYI+D+RYYDNKYLK+N+NVD E ISEY+PLE TI GMLKIYE + KLKF EET 
Sbjct: 371 PFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEETD 430

Query: 419 -KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETG 477
            + K VWHEDVKQLAVWK+D  E PEFVGWIYFDLHPRDGKYGHAANFGI+SSYV    G
Sbjct: 431 AEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV--RDG 488

Query: 478 KRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPW 537
            RS+PVTALVCNFSK +A +P+LLKH+EITTFFHELGHGIHDLVG N + RFNGPGATPW
Sbjct: 489 ARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPW 548

Query: 538 DFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFG 597
           DFVEAPSQMLEFWTWN NEL +LS HYE+ EKIP+ LL SLI TKHVNGALFALRQL FG
Sbjct: 549 DFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFG 608

Query: 598 LFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYM 657
           LFDMTVHT  ++ESL++  LWN+LR+E+ LVE G +++KG++SFGHIMS +YSAGYYGYM
Sbjct: 609 LFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGYYGYM 668

Query: 658 WAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKE 717
           WAEVFAADMYHTKF+ +PL+ +VGV+YRDIVL+ GGLYEI DNLR+FLGREP+  AFLKE
Sbjct: 669 WAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKE 728

Query: 718 LGL 720
           LGL
Sbjct: 729 LGL 731

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/725 (65%), Positives = 575/725 (79%), Gaps = 21/725 (2%)

Query: 16  FLSLVCIPATSYLVYN------RLYS----NMTISAFIAPQAAPSWNWNPSRLLFDAECV 65
            LSLV IPA +  +Y+      R Y+     M  +AFIAPQ +P W+++P R+L DA+ +
Sbjct: 23  LLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERILSDAKKI 82

Query: 66  IDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKAT 125
           ID SN  Y+ + +++ P++EN V P +  EN+ S  IN+L FLQHVS+D  IR+ASL+AT
Sbjct: 83  IDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEAT 142

Query: 126 ELLQKFEIEASLRHDLFLQFDKIWQEISEKK--DDF--VKEYDFETWKFIEKVHKDYVRS 181
           EL+  F+IE SLR+D+F QFDKI+ ++ + K  +D       D+E +K++EK HKDYVRS
Sbjct: 143 ELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRS 202

Query: 182 GLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFID 241
           GLNL E+KR            NSLQ+SKNLGEQ E +AFT+EEL+GVSD V +QFE + D
Sbjct: 203 GLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTD 262

Query: 242 EETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELAT 301
           E+TGE+KFKVTFKYPDIFPVLKTAKNP TR+ AF ADQNKVP+NE LF++TLKLR +L  
Sbjct: 263 EQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGK 322

Query: 302 TLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREY 361
            L Y TYANYNL+ KMAK QETV++FL DLK +LKPLA KEI +LK IK+ E +ELN  Y
Sbjct: 323 ILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAY 382

Query: 362 DSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKN- 420
           D HYYI+DHRYYDNKYLKD FNVDLE ISEYYP+E TI GMLKIYE +  LKF EET   
Sbjct: 383 DDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKD 442

Query: 421 -KSVW-HEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGK 478
            KS W  +DVKQLAVWKMD+P KPEFVGWIYFDLHPR+GKYGHAANFG++ SY+D ++ K
Sbjct: 443 LKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDS-K 501

Query: 479 RSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWD 538
           R YPVTALVCNFS +TA +P+LLKHNEITTFFHELGHGIHDLVG N + RFNGPGA PWD
Sbjct: 502 RIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWD 561

Query: 539 FVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGL 598
           FVEAPSQMLEFWTWN NEL SLS HY++ EKIP+ LL SLI TKHVNGALFALRQLHFGL
Sbjct: 562 FVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGL 621

Query: 599 FDMTVHTT---NNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYG 655
           FDM VHTT   N +++++L++LWN LREEI LVE G E++KGYDSFGHIMSDSYSAGYYG
Sbjct: 622 FDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYG 681

Query: 656 YMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFL 715
           YMWAEVFA DMY++KF+ +PL+++ G++YRDI+LA GG+ E  DNL++FLGREPSK AFL
Sbjct: 682 YMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFL 741

Query: 716 KELGL 720
           KELGL
Sbjct: 742 KELGL 746

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/701 (67%), Positives = 563/701 (80%), Gaps = 10/701 (1%)

Query: 26  SYLVYNRLYSNMTIS---AFIAP-QAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKK 81
           +Y   N + +N T++    FIAP    P W W P ++L + +  I+ +N+ Y+ +S ++ 
Sbjct: 44  TYSPNNIIMTNNTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIES 103

Query: 82  PTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDL 141
           P++ENL+ PYM +ENK+  LIN+L FLQHVS D KIR+ASL+AT LL+  +I  SLR ++
Sbjct: 104 PSIENLIIPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEI 163

Query: 142 FLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXXG 201
           + QF+K+W+ + +  DDF+K + FET+KFIEK+HKD +R+GL    ++            
Sbjct: 164 WEQFEKVWETV-QNDDDFLKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKIS 220

Query: 202 NNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPV 261
            ++L +S NLGEQ E ++FT+EELDGVS+ V +QFEKFID +T E+K+KVTFKYPDIFPV
Sbjct: 221 ADALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPV 280

Query: 262 LKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQ 321
           LKTAKNP+TR+ AFL DQNKVP+NE L    LKLR ELA TL YSTYANYNL+ KMAK Q
Sbjct: 281 LKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQ 340

Query: 322 ETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDN 381
           ETVL FLNDLK +LKPLA KEI ILKD+K+KEC+EL   YD HYYI+DHRYYDNKYLKDN
Sbjct: 341 ETVLKFLNDLKEKLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDN 400

Query: 382 FNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETK--NKSVWHEDVKQLAVWKMDNP 439
           FNVD+E ISEYYPLE TI+GMLKIYE +  LKF EET    K+VWH DVKQL+VW MD+ 
Sbjct: 401 FNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDR 460

Query: 440 EKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPS 499
             P FVGWIYFDL+PRDGKYGHAANFGI+SSY+  E  KRSYPVTALVCNFSK T  +P+
Sbjct: 461 ANPAFVGWIYFDLYPRDGKYGHAANFGIASSYI-TEENKRSYPVTALVCNFSKPTKNKPA 519

Query: 500 LLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKS 559
           LLKH+EITTFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLEFWTWN NEL S
Sbjct: 520 LLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLS 579

Query: 560 LSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWN 619
           LS HY++ EKIP+DLL SLI TKHVNGALFALRQLHFGLFDMTVHTT ++E+L+LLKLWN
Sbjct: 580 LSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWN 639

Query: 620 ELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSE 679
           E REEICLVE G   +KGY+SFGHI+SDSYSAGYYGYMWAEVFAADMYHTKF+PNPLD  
Sbjct: 640 ESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVS 699

Query: 680 VGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
           VG++YRD++LA GGLYEI DNL +FLGREPS   FLKELGL
Sbjct: 700 VGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/709 (64%), Positives = 558/709 (78%), Gaps = 9/709 (1%)

Query: 14  KSFLSLVCIPATSY--LVYNRLYSNMTISAFIAPQAAPSWNWNPSRLLFDAECVIDNSNR 71
           KS  SLV IP  ++    +N + S MT + F+ PQAAPSWN+    LL      ID+SN 
Sbjct: 11  KSATSLVVIPTLAFASFQFNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQTHEAIDSSNE 70

Query: 72  LYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKF 131
           L D L S+  P+VEN V PY+ HEN ISPL N+L FLQHVS D ++R+ S K TEL++ F
Sbjct: 71  LLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENF 130

Query: 132 EIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRX 191
            IE+SLR  LF QFD +W ++  K D   K+  FE +KF+EK HKD++RSGLNLPE++R 
Sbjct: 131 GIESSLRFKLFRQFDIVWNQL--KDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRD 188

Query: 192 XXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEKFKV 251
                     NNSLQ+SKNLGEQ E I FT+EEL GVS+ V +QFE  +DE+ G  K+KV
Sbjct: 189 KVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFET-VDED-GITKYKV 246

Query: 252 TFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANY 311
           TFKYPDIFPVLK+AKN ETR++AF+ DQNKVPQNE LF+ETL+LRN+LA  LNY +YA+Y
Sbjct: 247 TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADY 306

Query: 312 NLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHR 371
           NL+ KMAK++E VL FLNDLK +LKPL  KE++ LK++K++ECKELN  YD  YYI+D+R
Sbjct: 307 NLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRYYIWDNR 366

Query: 372 YYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKNKSVWHEDVKQL 431
           YYDN+YLK NF +D E I+EY+PLE TI GML+IYE + KLKF EE  N   WH DVK+L
Sbjct: 367 YYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEE-DNGDTWHPDVKKL 425

Query: 432 AVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFS 491
           +VWKMD+   P FVGWIYFDLHPR+GKYGHAANFGISSS++  + G RSYPVTALVCNFS
Sbjct: 426 SVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSD-GSRSYPVTALVCNFS 483

Query: 492 KSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWT 551
           K T  +P+LLKH+E+TTFFHELGHGIHDLVG N + RFNGP ATPWDFVEAPSQMLEFWT
Sbjct: 484 KPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWT 543

Query: 552 WNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVES 611
           WN  ELKSLS HY++ EKIPD LL SL++TKH+NGALFALRQLHFGLFDM VHTT ++  
Sbjct: 544 WNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISK 603

Query: 612 LNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKF 671
           LN+ +LWN LREEICL++ G   +KG++SFGHIMSDSYSAGYYGYMWA+VFA+DMY+TKF
Sbjct: 604 LNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKF 663

Query: 672 SPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
             +PL+S+VGVQYRDI+LA GGLYEI DNL +FLGR+P+  AFLKELGL
Sbjct: 664 LEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/736 (62%), Positives = 555/736 (75%), Gaps = 24/736 (3%)

Query: 4   RLSRLVIPSRKSFLSLVCIPA----------TSYLVYNRLYSNMTISAFI------APQA 47
           R+   +  S+K+  +L+ +P            +Y    R YS +  + F        PQ 
Sbjct: 12  RVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSLTPPQY 71

Query: 48  APSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCF 107
            PSW + P  +L   +  I N+   YD+L ++  PT+ENL+ PY+ HEN+   LIN+L F
Sbjct: 72  PPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQLTF 131

Query: 108 LQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFET 167
           LQHVSED  IR+AS++AT LLQ FEIE+  R DLF QFD IW +I +KKD+F    DFE 
Sbjct: 132 LQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFE---DFEI 188

Query: 168 WKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDG 227
           W+F+EK HKDYVR+GLNLP DK            +N L++SKNLGEQKE I FT EEL G
Sbjct: 189 WRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTAEELKG 248

Query: 228 VSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNED 287
           V ++V EQFEK +++E G +K KVT+KYPDIFPVLK A+NPETR KAF+ DQNKVP+NE 
Sbjct: 249 VPESVIEQFEK-VNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEH 307

Query: 288 LFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILK 347
           LF +TLKLRNELA  L Y TYANYNL+ KMAK  +TVL F+NDL  +L+  A KE+ ILK
Sbjct: 308 LFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILK 367

Query: 348 DIKQKECK-ELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIY 406
           ++K++E + E N  YD  YYI+DHRYYDNKYLK+NFNVD E I+EYYPLE TI+GMLKIY
Sbjct: 368 NLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIY 427

Query: 407 EELFKLKFNEETKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFG 466
           E L KLKF E  +NK  WH+DVKQLAVWK+D PE PEFVGWI+FDLHPRDGKYGHAANFG
Sbjct: 428 ETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFG 487

Query: 467 ISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKL 526
           +SSSY+    G RSYP+TALVCNFSKST  +PSLLKH+EITTFFHELGHGIHDLVG N++
Sbjct: 488 LSSSYIS-ANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRI 546

Query: 527 SRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNG 586
            RFNGPGA PWDFVEAPSQMLEFWTWN  EL SLS +Y+ N KI   LL SLIKTKHVNG
Sbjct: 547 GRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNG 606

Query: 587 ALFALRQLHFGLFDMTVH--TTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHI 644
           ALFALRQLHFGLFDM VH  +   ++ L++ KLWN+LRE+ICL+  G + + GY+SFGHI
Sbjct: 607 ALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHI 666

Query: 645 MSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDF 704
           MS SYSAGYYGYMWAEVFA DMY+TKF  +PL+ EVGV+YRDIVLA GGLYEI DNL +F
Sbjct: 667 MSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEF 726

Query: 705 LGREPSKNAFLKELGL 720
           LGR+P+K+AFL+ELGL
Sbjct: 727 LGRKPAKDAFLEELGL 742

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/703 (62%), Positives = 555/703 (78%), Gaps = 10/703 (1%)

Query: 23  PATSYLVYNR-LYSNMTISAF-IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80
           P  S L+Y R LYS    ++F IAPQA P+W++ PS +      +I+NSN  YD +S ++
Sbjct: 13  PVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVE 72

Query: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140
            P+V N V P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 73  SPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHD 132

Query: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXX 200
           +FLQF ++WQ++  K D   +E    T+K++EK +KDY+ SGL L E  R          
Sbjct: 133 IFLQFARVWQDVQSKADSVERE----TFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKI 188

Query: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF-IDEETGEEKFKVTFKYPDIF 259
             NS+ +SKNLGEQKE I FT+E+L+GV D++  QFE    D+++ E  +KVTFKYPDIF
Sbjct: 189 SVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIF 248

Query: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319
           PV+K A + +TR++AFLADQNKVP+NE + ++TLKLR+ELA+ L Y TYANYNL +KMA+
Sbjct: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAE 308

Query: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379
              TV++FLNDLK +L PL  KE+ +L+D+K ++ K+LN+  D +YYI+DHRYYDNKYL 
Sbjct: 309 DSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLL 368

Query: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE--ETKNKSVWHEDVKQLAVWKMD 437
           +NFNVDLE ISEY+PLE TI GML+IYE LF LKF E  +++NKSVWH+DVKQ+AVW MD
Sbjct: 369 ENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMD 428

Query: 438 NPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATR 497
           +P+ P FVGWIYFDLHPRDGKYGHAANFG+SSS++ I+   RSYPVTALVCNFSKST  +
Sbjct: 429 DPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFM-IDDTTRSYPVTALVCNFSKSTKDK 487

Query: 498 PSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANEL 557
           PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NEL
Sbjct: 488 PSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 547

Query: 558 KSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKL 617
            +LS HY++ EKIP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VHT  ++++L++   
Sbjct: 548 INLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDT 607

Query: 618 WNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677
           WN+LR++I L+  G  LSKGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL+
Sbjct: 608 WNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLN 667

Query: 678 SEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
           ++ G+QYRDIVLA GGLY+I DNL++FLGREPSK+AFLKELGL
Sbjct: 668 AKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/705 (62%), Positives = 552/705 (78%), Gaps = 10/705 (1%)

Query: 23  PATSYLVYNRLYSNMTISAF--IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80
           P  S L+Y R  S MT +A   IAPQA P+W++ P+ +      +ID SN+ Y+ +S ++
Sbjct: 13  PVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVE 72

Query: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140
            P+V N + P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 73  SPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHD 132

Query: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXX 200
           +FLQF ++WQ+   K D   KE    T+K+IEK +KD++ SGL L E  R          
Sbjct: 133 IFLQFARVWQDAQPKADSLKKE----TFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKI 188

Query: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEK-FKVTFKYPDIF 259
             NS+ +SKNLGEQKE I FT+E+L+GV D++  QFE    E+ GE+  +KVTFKYPDIF
Sbjct: 189 SMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIF 248

Query: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319
           PV+K A + +TR++AFLADQNKVP+NE + ++TLKLR+ELA+ L Y+TYA+YNL +KMAK
Sbjct: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAK 308

Query: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379
              TV+DFLNDLK +L PL  KE+ +L+D+K K+ +   ++ D +YYI+DHRYYDNK+L 
Sbjct: 309 DSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLL 368

Query: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE--ETKNKSVWHEDVKQLAVWKMD 437
           +NFNVDLE ISEY+PLE TI GML+IYE LF LKF E  E +NKSVWHEDVKQLAVW MD
Sbjct: 369 ENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMD 428

Query: 438 NPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATR 497
           +P+ P F+GWIYFDLHPRDGKYGHAANFG+SSS++ I   KRSYPVTALVCNFSKST  +
Sbjct: 429 DPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM-INDSKRSYPVTALVCNFSKSTKDK 487

Query: 498 PSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANEL 557
           PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NEL
Sbjct: 488 PSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 547

Query: 558 KSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKL 617
            SLS HY++ E+IP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VHT  ++E+L++   
Sbjct: 548 VSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHT 607

Query: 618 WNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677
           WN+LR+EI L+  G  LSKGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL+
Sbjct: 608 WNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLN 667

Query: 678 SEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGLDA 722
           ++ GVQYRDIVLA GGLY+I DNL++FLGREPSK+AFLKELGL +
Sbjct: 668 TKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/703 (62%), Positives = 552/703 (78%), Gaps = 10/703 (1%)

Query: 23  PATSYLVYNR-LYSNMTISAF-IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80
           P  S L+Y R LYS    ++F IAPQA P+W + P+ +    + +ID SN  Y+ +S+++
Sbjct: 13  PIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVE 72

Query: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140
            PTV N V P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 73  TPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHD 132

Query: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXX 200
           ++LQF ++WQ+   K D   +E    T+K+IEK +KDY+ SGL L E  R          
Sbjct: 133 IYLQFARVWQDAQSKSDSIERE----TFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKI 188

Query: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF-IDEETGEEKFKVTFKYPDIF 259
             NS+ +SKNLGEQKE I FT+E+L+GV D+V  QFE    D++  E  +KVTFKYPDIF
Sbjct: 189 SVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIF 248

Query: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319
           PV+K A + +TR++AFLADQNKVP+NE + ++TL+LR++LA+ L Y TYANYNL +KMAK
Sbjct: 249 PVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAK 308

Query: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379
              TV+DFLNDLK +L PL  KE+ +L+++K K+ K+LN++ D +YYI+DHRYYDNKYL 
Sbjct: 309 DSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLL 368

Query: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE--ETKNKSVWHEDVKQLAVWKMD 437
           +NFNVDLE ISEY+PLE TI GML+IYE LF LKF E  + ++KSVWH+DVKQLAVW MD
Sbjct: 369 ENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMD 428

Query: 438 NPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATR 497
           +P+ P+FVGWIYFDLHPRDGKYGHAANFG+SSS++  ++  RSYPVTALVCNFSKST  +
Sbjct: 429 DPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDS-VRSYPVTALVCNFSKSTKDK 487

Query: 498 PSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANEL 557
           PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NEL
Sbjct: 488 PSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 547

Query: 558 KSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKL 617
             LS HYE+ EKIP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VHT  ++++L++ + 
Sbjct: 548 IDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICET 607

Query: 618 WNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677
           WN+LR++I L+  G  LSKGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL+
Sbjct: 608 WNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLN 667

Query: 678 SEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
           ++ G+QYRDIVLA GGL +I D+L+ FLGREPSK+AFLKELGL
Sbjct: 668 TKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/704 (61%), Positives = 545/704 (77%), Gaps = 12/704 (1%)

Query: 23  PATSYLVYNRLYSNMTISAFI--APQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80
           P  + L+Y R  S+MT +A    APQ  PSW++ P+ +    + +I+ SN+ YD +S ++
Sbjct: 13  PVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVE 72

Query: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140
            P V N V P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 73  SPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHD 132

Query: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXX 200
           +FLQF ++WQ+   + D   +E    T+++IEK +KDY+ SGL L E  R          
Sbjct: 133 VFLQFARVWQDAQSQADSIERE----TFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKI 188

Query: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF-IDEETGEEKFKVTFKYPDIF 259
             NS+ +SKNLGEQKE I FT+E+L+GV D++  QFE     +++ E  +KVTFKYPDIF
Sbjct: 189 SVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIF 248

Query: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319
           PV+K A + +TR++AFLADQNKV +NE + ++TLKLR+E+A+ L Y TYANYNL +KMAK
Sbjct: 249 PVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAK 308

Query: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379
              TV+DFLNDLK +L PL  KE+ IL+D+K K+ K+ N++ D +YYI+DHRYYDNKYL 
Sbjct: 309 DSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLL 368

Query: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKN---KSVWHEDVKQLAVWKM 436
           +NFNVDLE ISE++PLE TI GML+IYE LF LKF  ETKN   KSVWHEDVKQLAVW M
Sbjct: 369 ENFNVDLEKISEFFPLETTITGMLQIYETLFNLKF-IETKNPQEKSVWHEDVKQLAVWNM 427

Query: 437 DNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTAT 496
           D+P+ P F+GWIYFDLHPRDGKYGHAANFG+SSS++ +    RSYPVTALVCNFSKST  
Sbjct: 428 DDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM-VNDTTRSYPVTALVCNFSKSTKD 486

Query: 497 RPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANE 556
           +PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NE
Sbjct: 487 KPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNE 546

Query: 557 LKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLK 616
           L  LS HY++ EKIP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VH+  ++++L++  
Sbjct: 547 LMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICD 606

Query: 617 LWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPL 676
            WN+LR++I L+  G  LSKGY SFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL
Sbjct: 607 TWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666

Query: 677 DSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
           +++ G+QYRDIVLA GGL +I D+L++FLGREPSK+AFLKELGL
Sbjct: 667 NTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/724 (56%), Positives = 532/724 (73%), Gaps = 12/724 (1%)

Query: 1   MLNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNM--TISAFIAPQAAPSWNWNPSRL 58
           ML  L R  I    + +S + +PA + +  NR   N    +S+ ++P+ APSW++    +
Sbjct: 1   MLQFLKRFNILKNSATVSFLLLPALA-IAGNRSVHNQERNMSSLLSPKLAPSWDFAADEI 59

Query: 59  LFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIR 118
           +  A+  ID   + YD ++SL+ P +EN V   + HE++    +++L FLQHVS D ++R
Sbjct: 60  VSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVR 119

Query: 119 EASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDY 178
           +AS++AT+L+Q++ IE S R+DL+ QF K+W++   K D+ +K+ D E + ++E V+KDY
Sbjct: 120 DASIEATKLIQEWGIETSSRYDLYSQFSKVWEQY--KDDENLKKNDPELYWYMENVNKDY 177

Query: 179 VRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEK 238
           + +G+ LPE+ R           NNSL +S NLGEQ + IAFT++EL GVS+    QFEK
Sbjct: 178 IHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEK 237

Query: 239 FIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNE 298
            I  E G EK+K+TFKYPDI PVL TAKNPETR++A++ DQNKVPQNE + +ETLKLRNE
Sbjct: 238 VI--EDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNE 295

Query: 299 LATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELN 358
           LA    + TYA+Y LE KMAK+QETV +FL DLK +L P   K++  LK +K++E KEL 
Sbjct: 296 LAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELG 355

Query: 359 REYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET 418
             Y+  +  +D+RYYD+KYLK+NF+VD E +++Y+PL+HTI+GML IY++LF LKF EET
Sbjct: 356 LPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEET 415

Query: 419 K--NKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIET 476
           +   K+VWHEDVKQ AVW +D    PEFVGWIYFDLHPR+GKYGHAANFG+ S YV  E 
Sbjct: 416 RECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKYGHAANFGLYSPYV-TEE 473

Query: 477 GKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATP 536
           G R YPVT LVCNFSK ++TRP+LLKH E+ TFFHELGHGIH LVGK+++   NGP + P
Sbjct: 474 GTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIP 533

Query: 537 WDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHF 596
           WDFVEAPSQMLEFW WN +++  LS HYE+ E+IPD+L+ SLIKTKHVN  L  LRQLHF
Sbjct: 534 WDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHF 593

Query: 597 GLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGY 656
            LFDMTVHT   ++ L++  LWN LREE+ L+  G  L+KGYDSF HIMS  YSAGYYGY
Sbjct: 594 SLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMS-GYSAGYYGY 652

Query: 657 MWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLK 716
           MW+EVFAADMYHT F+PNPLD+ VG +YRDI+LA GGL +I D+L +FLGREP+  AFLK
Sbjct: 653 MWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLK 712

Query: 717 ELGL 720
           ELGL
Sbjct: 713 ELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/686 (51%), Positives = 466/686 (67%), Gaps = 9/686 (1%)

Query: 39  ISAFIAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKI 98
           +++ + PQAAPSWN++   ++  +  +I+ +  +Y  +   K PT++N + P + HE + 
Sbjct: 4   LASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEET 63

Query: 99  SPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDD 158
             L N+L FL++VS DP+IREAS  AT +L  + I  + ++DL+  FD++W +   K D+
Sbjct: 64  DLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQY--KDDE 121

Query: 159 FVKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELI 218
             K+ +FE ++++EK    Y RSG+ +P + R              L++S NLGE+ E I
Sbjct: 122 KFKKENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYI 181

Query: 219 AFTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLAD 278
           AFT+EEL+GV D V  QFEK I  E G EKFKVTFKYPDI PVL+ A NPETRR+A +AD
Sbjct: 182 AFTKEELEGVPDTVLNQFEKII--EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMAD 239

Query: 279 QNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPL 338
           +N+V  NE L  ETL+LR ELA  L +  +A YNL++KMAK +ETVL FLNDL  +L P+
Sbjct: 240 ENRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPV 299

Query: 339 AMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHT 398
              ++ ILK  K ++ K  N  +D  +Y +D  YY NK L++ +NV+ + +++Y+P+E  
Sbjct: 300 GKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESA 359

Query: 399 INGMLKIYEELFKLKFNEETK--NKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRD 456
           I GML IY  LF+LKF E T    KSVWHEDVKQ AVW +D+ + P+F GW+YFDLHPRD
Sbjct: 360 IEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRD 419

Query: 457 GKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHG 516
           GKYGHAANFG+ S+Y     G +SYPVT LV NFSK T TRP+LLK  E+TTFFHELGHG
Sbjct: 420 GKYGHAANFGMVSAYRK-RDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHG 478

Query: 517 IHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLT 576
           IHDLVG N L   NGPG+ PWDFVEAPSQMLE+WT   + L  LS HYE+ EKIP  LL 
Sbjct: 479 IHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLD 538

Query: 577 SLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSK 636
           +      +N  L  L QL  GLFDM VH T + +   + KLWN+L  EI L+   +  S 
Sbjct: 539 AWFSVGGLNSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLMNLKNYTST 597

Query: 637 GYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYE 696
           GYDSFGHIM+   +  YYGY+W++VFAADMY TKF PNP ++ VGV+YRD +LA GGLY+
Sbjct: 598 GYDSFGHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656

Query: 697 IADNLRDFLGREPSKNAFLKELGLDA 722
           + DNLR FLGR+P+  AFL+ LGL A
Sbjct: 657 MTDNLRKFLGRDPNNKAFLRGLGLKA 682

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/686 (49%), Positives = 454/686 (66%), Gaps = 9/686 (1%)

Query: 41  AFIAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKP-TVENLVRPYMIHENKIS 99
           + + PQ  P WN+  + ++  A  +   S+ +Y+ + S K   T++N + P + ++ +  
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 100 PLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDF 159
            L N+L FL++VS DPK+REASL   ++L ++    S ++DL+  F+ IW +   K D+ 
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQY--KDDEE 128

Query: 160 VKEYDFETWKFIEKVHKDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKELIA 219
            K  ++E +K++EK    Y R+  NL   +             ++LQ+S NLGE+ E I 
Sbjct: 129 FKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYIT 188

Query: 220 FTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQ 279
           FT EEL+GVS  V +QFE+ I  E G +K KVTFKYPDI PVL+TA NPETRRKA++ADQ
Sbjct: 189 FTEEELEGVSPLVLDQFERII--EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQ 246

Query: 280 NKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLA 339
           N+V  NE L  ETL LR  +A    Y  YA YNL +KMAK +ETV+ FL DL  RL P+ 
Sbjct: 247 NRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVG 306

Query: 340 MKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTI 399
            K+  ILK  K ++ K  N  +D   Y +D+ YY+NK L++ + +D E +++Y+P+E  I
Sbjct: 307 EKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVI 366

Query: 400 NGMLKIYEELFKLKFNEET--KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDG 457
            GML  Y+ LF+LKF E T    K+VWHEDVKQ AVW +D+ + PEF GWIYFDL+PRDG
Sbjct: 367 EGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDG 426

Query: 458 KYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGI 517
           KY HAANFG++S++   + G +SYPVT LVCN +K T TR ++L+  EITT FHELGHGI
Sbjct: 427 KYSHAANFGMASAFRK-KDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGI 485

Query: 518 HDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTS 577
           H LV  NKL+  N  G+ PWDFVEAPSQMLE+WT   + L  LS HYE+ EKIP  LL +
Sbjct: 486 HHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDA 545

Query: 578 LIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKG 637
              +  +   L+ L QL  GLFDM VH T     L + KLWN++R EI L+ + +  S G
Sbjct: 546 WFNSSGLGSGLYYLGQLRLGLFDMYVH-TREYHGLEVRKLWNDMRREISLINSQNYTSTG 604

Query: 638 YDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEI 697
           Y++FGHIM+ SYSAGYYGY+W++VFAADMY TKF  NP +S VG QYRD +LA GGLY++
Sbjct: 605 YNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDM 664

Query: 698 ADNLRDFLGREPSKNAFLKELGLDAA 723
            DNLR FLGREP+  AFL+ LG +A 
Sbjct: 665 NDNLRKFLGREPNNRAFLRGLGFNAT 690

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  384 bits (986), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 202/416 (48%), Positives = 272/416 (65%), Gaps = 12/416 (2%)

Query: 309 ANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIY 368
           A Y LE K AK  + V  FLNDL+ +LKP +      LK +K++ECKEL   YD   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 369 DHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETK--NKSVWHE 426
           D  YY+ K L+DNF+VD E  ++Y+PLEHTI  ML  Y  LF+  F EET+   ++VWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 427 DVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDI-ETGKRSYPVTA 485
           D KQ +VWKMD+ + P+F GW+YFDLHPRDGK+GH A F   + Y D+ E G R YPVT+
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACF--DNVYTDMSEEGSRVYPVTS 226

Query: 486 LVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQ 545
           LVCNFS  +  +P+LLKH E+  FFHELGHG H L+   +L         P DF+EAPSQ
Sbjct: 227 LVCNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQ 284

Query: 546 MLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHT 605
           MLE+W W  + +  LS H E+ E+IP+ L+  ++K+K  N A+  L Q+   L DM VH 
Sbjct: 285 MLEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHK 342

Query: 606 -TNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAA 664
              + E+L+L  LWN L E++ L++   E ++ Y SF HI+ + Y+AGYYGY W++VFAA
Sbjct: 343 HVGSYETLDLNALWNNLCEDVILIKNP-EPTRAYCSFSHIV-EGYAAGYYGYQWSKVFAA 400

Query: 665 DMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720
           DMY ++F    LD  +G  Y D ++A GGLYE+ DNL +FL REP+  A+L++ GL
Sbjct: 401 DMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 39  ISAFIAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKI 98
           +S    PQ APSW+ +P+++    +  ++++ R++ EL+++K PTVE     Y++     
Sbjct: 1   MSTVKIPQPAPSWDLSPAQINDKVQTALESAARMFAELANVKLPTVETAA--YVLEVKTA 58

Query: 99  SPLINKLCFLQHVSEDPKIREASLKATELLQKFE 132
             + N   FL  + E  K++ AS      L+K +
Sbjct: 59  KNVDNVNSFLNDLRE--KLKPASADNWRPLKKLK 90

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  207 bits (528), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 160/567 (28%), Positives = 266/567 (46%), Gaps = 56/567 (9%)

Query: 176 KDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGE-QKELIAFTREELD--GVSDAV 232
           +D+++SG+ +   K+               +Y  N+ +  +  I   R ELD  G+   V
Sbjct: 209 QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDV 268

Query: 233 FEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVET 292
             Q  K I   TG+  +K+       F +LK   +PE R+K ++A  +   Q  +     
Sbjct: 269 ACQLGKDI---TGK-YYKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIERLTNL 324

Query: 293 LKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQK 352
           +K+R  LA T+    YA Y ++ KMAK  + V +FL  L   LKP A KE+  + D+   
Sbjct: 325 VKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHN 384

Query: 353 ECKE-----------LNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTING 401
           E  E             R +D  YY   HR      L D++ +D+     YYPL + I G
Sbjct: 385 EKGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDV-----YYPLGNVIQG 439

Query: 402 MLKIYEELFKLKFNEETKNKS-VWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYG 460
           +  I+E ++ ++F      K   W  DV++L V      EK   +G IY DL  R GK  
Sbjct: 440 LSDIFESIYGIRFEPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFRRQGKTN 495

Query: 461 HAANFGISSSY---------------VDIETGKRSYPVTALVCNFSK---STATRPSLLK 502
           +AA+F I  S                 +++  K   P+ +L+CNF+    ++     LL 
Sbjct: 496 NAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLA 555

Query: 503 HNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSC 562
            NEI T FHE+GH IH ++G+ +L   +G   +  DFVE PS ++E +  +   LK +  
Sbjct: 556 LNEIETLFHEMGHAIHSMLGRTRLQNVSGTRCST-DFVELPSVLMEHFARDTRVLKRIGH 614

Query: 563 HYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTN---NVESLNLLKLWN 619
           HY++ +++P  LL   ++            Q    + D  ++  N   N++S++++K+++
Sbjct: 615 HYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYH 674

Query: 620 ELREEI-CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDS 678
           EL +E+  LV+   + S     FGH+    Y A YY Y++    A+ ++   F  +P   
Sbjct: 675 ELEKELEVLVD---DESNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEKDPYSR 729

Query: 679 EVGVQYRDIVLANGGLYEIADNLRDFL 705
             G ++++ VL  GGL E  + + D L
Sbjct: 730 SGGEKFKNDVLKWGGLREPWNCVADVL 756

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  179 bits (454), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 243/510 (47%), Gaps = 44/510 (8%)

Query: 215 KELIAFTREELD--GVSDAVFEQFEKFIDEETGEEKFKVTFKYPDI-FPVLKTAKNPETR 271
           KE I   R+E+D  G+S  +  +  + +   TG  K+     Y  I   +LK+  + + R
Sbjct: 233 KEFIKVKRDEMDKSGISPLLTARLNRDL---TG--KYYKIPTYGQIPLQILKSCPDEDIR 287

Query: 272 RKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDL 331
           ++ + A  N          + ++LR  L+  L   +Y++Y L+ KMA   E V  F+  L
Sbjct: 288 KEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTL 347

Query: 332 KYRLKPLAMKEIS-ILKD-IKQKECKEL-NREYDSHYYIYDHRYYDNKYLKDN--FNVDL 386
               KPLA +E+  I +D +   + + + + E  S    +D  Y+ +KY  DN    +  
Sbjct: 348 MNVTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRD 407

Query: 387 EAISEYYPLEHTINGMLKIYEELFKLKFN-EETKNKSVWHEDVKQLAVWKMDNPEKPEFV 445
           E +  Y+ L + ING+ ++++ ++ +      T+N   W  DV++L V      E+   V
Sbjct: 408 EQLRYYFSLGNVINGLSELFKRIYGITLQPSRTENGETWSPDVRRLDVIS----EEEGLV 463

Query: 446 GWIYFDLHPRDGKYGHAANFGISSS---------YVDIETGKRS------YPVTALVCNF 490
           G IY DL  R GK  + A+F +  S         +  I+TG+ S       PV +LVCNF
Sbjct: 464 GVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNF 523

Query: 491 SKST---ATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQML 547
           S        R   L  NEI T FHE+GH +H ++G+ +L   +G      DFVE PS ++
Sbjct: 524 STVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILM 582

Query: 548 EFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTT- 606
           E +  +   L+++  HYE++E  P+ LL   +             Q    + D  +H + 
Sbjct: 583 EHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSF 642

Query: 607 --NNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAA 664
             +++E ++  K++ +L   + ++    + S     FGH+    Y A YY Y++    A+
Sbjct: 643 SLSDIERIDSAKIYQKLETRLQVL--ADDESNWCGRFGHLF--GYGATYYSYLFDRAIAS 698

Query: 665 DMYHTKFSPNPLDSEVGVQYRDIVLANGGL 694
            ++ + F  +P +   G ++++ VL  GGL
Sbjct: 699 KVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 140/527 (26%), Positives = 250/527 (47%), Gaps = 54/527 (10%)

Query: 214 QKELIAFTREELD--GVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETR 271
           + E I    EELD  GVS  +  Q    +        +KV       + +L++ KN   R
Sbjct: 260 RSEFIEIASEELDNSGVSPILLRQLTTTVRGT----HYKVPAYGTAPYIILRSCKNENAR 315

Query: 272 RKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDL 331
           +  + A  +   +  +     +K+R+ L+  +    +A Y L+ KMAK  E VL+F+  L
Sbjct: 316 KAVWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRL 375

Query: 332 KYRLKPLAMKEISILKDIK-----------QKECKELNREYDSHYYIYDHRYYDNKYLKD 380
               KP+A +E+ +L ++K           +KE  E  R +D  YY+   +    +  K+
Sbjct: 376 MEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILETVRPWDRDYYVA--KSQQTRKAKN 433

Query: 381 NFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE-ETKNKSVWHEDVKQLAVWKMDNP 439
               + E I+ Y+ L   + G+  +++ ++ +      +     W  +V+++ V   +N 
Sbjct: 434 QL-TNHEPINAYFTLGSVLEGLSNLFKSIYGISLEVVASIPGETWSSEVRRVNVKTENN- 491

Query: 440 EKPEFVGWIYFDLHPRDGKYGHAANFGISSS---YVD------IETGKRS------YPVT 484
                +G +Y DL  R  K    A+F +  S   Y +      +++G  S       P+ 
Sbjct: 492 ---NIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPII 548

Query: 485 ALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPS 544
           +LVCNF++++     LL+ +EI T FHE+GH +H ++G+ KL   +G   T  DFVE PS
Sbjct: 549 SLVCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPS 607

Query: 545 QMLEFWTWNANELKSLSCHYESNEKIPDDLLT-SLIKTKHV-NGALFALRQLHFGLFDMT 602
            ++E +  +   LK +  HY + EK+P+DLL   L  T+++ N   FA  Q    + D  
Sbjct: 608 IIMEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQR 665

Query: 603 VHTTN---NVESLNLLKLWNELREEI-CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMW 658
           ++  N   +V  L++++L+++L   +  LV+   + +     FGH+    Y A YY Y+ 
Sbjct: 666 LYDNNIIFHVRDLDVVELYHDLERNLEVLVD---DQTNWCGKFGHLF--GYGATYYSYLL 720

Query: 659 AEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFL 705
               AA ++   F  +P     G  +++ VL  GGL +  + + D L
Sbjct: 721 DRAIAAKIWDCLFVNDPFSRTGGENFKNAVLKWGGLRDPWECIADVL 767

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 140/508 (27%), Positives = 245/508 (48%), Gaps = 48/508 (9%)

Query: 224 ELDGVSDAVFEQFEKFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFLADQNKV 282
           E  GVS  V +Q  K    +   + +K+ T+ Y   + +++T  +   R+K + A  +  
Sbjct: 262 EASGVSQMVLQQLSK----DLSGKFYKIPTYGYLP-YSIIRTCPSEYIRKKVWTAMYSCP 316

Query: 283 PQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKE 342
            +      + ++LR +LA  +    YA Y LE KMAK  + V +F+N L    KPLAM+E
Sbjct: 317 EKQIKRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEE 376

Query: 343 ISILKDIKQ-KECKELNREYDSHYYIYDHRYYDNKYL----KDNFNVDLEAISEYYPLEH 397
           +  L D+K    CK+ + E  S    +D  Y+ +  L    +    +  ++++ Y+ L  
Sbjct: 377 LKPLADMKHDNHCKDAS-EILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGV 435

Query: 398 TINGMLKIYEELFKLKFNEET-KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRD 456
            I G+  +++ ++ ++      K    W  +V+++ V    N      +G IY DL  R 
Sbjct: 436 VIQGLSDLFQSIYGIRLEPVVAKTGETWDPEVRKIQVISEANG----VIGVIYCDLFERQ 491

Query: 457 GKYGHAANFGISSS---------YVDIETG------KRSYPVTALVCNFSKSTATRPS-- 499
           GK  + A+F +  S         Y  I+ G      K   PV +LVCNFS + A   S  
Sbjct: 492 GKTPNPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSIC 551

Query: 500 LLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKS 559
           LL+ +E+ T FHE+GH +H ++G+ +L   +G      DFVE PS ++E +  +   L  
Sbjct: 552 LLQLSEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSR 610

Query: 560 LSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHT-TNNVESLNLLKLW 618
           +S HY + E++P ++L +  +            Q+   + D  +H+ T+N E  +++ ++
Sbjct: 611 ISSHYATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTDNSE--DIVTVY 668

Query: 619 NELREEI-CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677
           + L +E+  LV+   + S     FGH+    Y A YY Y+     AA +++  F  +P  
Sbjct: 669 HGLEKELQVLVD---DRSNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFS 723

Query: 678 SEVGVQYRDIVLANGGLYE----IADNL 701
              G ++++ VL  GG  +    IAD L
Sbjct: 724 RAGGEKFKNSVLKWGGSRDPWRCIADAL 751

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  171 bits (434), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 131/477 (27%), Positives = 227/477 (47%), Gaps = 40/477 (8%)

Query: 247 EKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYS 306
           E +K+    P  + VLK  KN E R   + A  +   +        +KLR  LA  +   
Sbjct: 277 ENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHLVKLRAMLANLMGAE 336

Query: 307 TYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELN-REYD--- 362
           +++ Y L+ K+AK  + V +F+  L   ++P   KE+  + D+K+++  ++N  E D   
Sbjct: 337 SFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKREDQGKINCGEMDGVL 396

Query: 363 SHYYIYDHRYYDNKYLKDNFNVD---LEAISEYYPLEHTINGMLKIYEELFKLKFNEETK 419
           S    +D  YY + Y K     +    E +S Y+ L     G+  +  +++ +K      
Sbjct: 397 STVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEGLSDLLTQIYGIKLEPAIP 456

Query: 420 -NKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSS---YVD-- 473
            +   W  DV+++ V      E+   +G IYFDL  R GK  + A+F +  S   Y +  
Sbjct: 457 VSGETWFNDVRKINVIS----EEEGIIGIIYFDLFERYGKTSNPAHFTVCCSREMYPEEN 512

Query: 474 ----IETGKR------SYPVTALVCNFSKSTATRP---SLLKHNEITTFFHELGHGIHDL 520
               I+ G +        P+ +LVCNFS+ T        LL  +EI T FHE+GH IH +
Sbjct: 513 ADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSEIETLFHEMGHAIHSM 572

Query: 521 VGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIK 580
           +G+  L   +G      DFVE PS ++E +  +   LK +SCHYE+ EKI +  L   +K
Sbjct: 573 LGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYETGEKIAEKKLQFHLK 631

Query: 581 TKHVNGALFALRQLHFGLFDMTVHT---TNNVESLNLLKLWNELREEI-CLVETGHELSK 636
                 +     Q    + D  +H+    +N+++LN+++++  L   +  LV+   + S 
Sbjct: 632 EGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLERRLQVLVD---DRSN 688

Query: 637 GYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGG 693
               FGH+    Y A YY Y++    A  +++  F+ +P +   G ++++ +L  GG
Sbjct: 689 WCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGEKFKESLLKWGG 743

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  171 bits (433), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 141/514 (27%), Positives = 241/514 (46%), Gaps = 49/514 (9%)

Query: 223 EELD--GVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQN 280
           EEL+  G++  V  Q  K I    G      TF Y   + +L++  +   R K + A  +
Sbjct: 246 EELNKSGINKIVLNQLSKDIK---GRHYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHS 301

Query: 281 KVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAM 340
              +      + +KLR+ LA  +   ++A+Y LE KMAK  E V  F+  L    KP A 
Sbjct: 302 CSEKQIARLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAA 361

Query: 341 KEISILKDIKQKECKELNREYDSHYYI------YDHRYYDNKY-LKDNFNVDLEAISEYY 393
           +E+  + D+K K     N+  +S + I      +D  +Y + + L+     + E IS Y+
Sbjct: 362 EELKFIADLKAKHVPG-NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYF 420

Query: 394 PLEHTINGMLKIYEELFKLKFNEET-KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDL 452
            L   I G+  ++++++ +       K    W  +V+++ V      EK   +G +Y DL
Sbjct: 421 SLGVVIQGLSNLFKQIYGIYLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDL 476

Query: 453 HPRDGKYGHAANFGISSS---------YVDIETGKRS------YPVTALVCNFSKSTATR 497
             R GK  + A+F +  S            I+ G+ S       PV +LVCNFS +T ++
Sbjct: 477 FERQGKTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQ 536

Query: 498 P---SLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNA 554
                LL+ +EI T FHE+GH +H ++G+ KL   +G      DFVE PS ++E +  + 
Sbjct: 537 EQSICLLQLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDH 595

Query: 555 NELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNNVES 611
             L+ ++ HY + E IP+ LL S            A  Q    + D  +H       ++ 
Sbjct: 596 RVLQRMASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQY 655

Query: 612 LNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKF 671
           L+++KL++ L  ++ ++    + S     FGH+    Y A YY Y++    A+ ++   F
Sbjct: 656 LDIVKLYHNLERQLEVLSD--DKSNWCGRFGHLF--GYGATYYSYLFDRAIASKIWQHLF 711

Query: 672 SPNPLDSEVGVQYRDIVLANGGLYE----IADNL 701
           + +P     G ++++ VL  GG  +    IAD L
Sbjct: 712 ANDPFCRRSGEKFKNSVLKWGGSRDPWECIADAL 745

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  171 bits (432), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 166/678 (24%), Positives = 306/678 (45%), Gaps = 61/678 (8%)

Query: 54  NPSRLLFDAECVIDNSNRLYDELSSLKKPTVENL-VRPYMIHENKISPLINKLCFLQHVS 112
           +P  L   ++  ++ S ++ D+L S + P    L V+   +  + +  +I+   F++   
Sbjct: 99  SPEGLKLFSQVSLEKSQKIVDKLRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSH 158

Query: 113 EDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIE 172
            D K  EA+    E  + FE    L  D+ L F    + + E K+    +   E  +   
Sbjct: 159 PDYKFVEAAQDCYE--EMFEFMNMLNTDVNLCF--TLKHVLENKE-IASKLSEEELRVGR 213

Query: 173 KVHKDYVRSGLNLPEDKRXXXXXXXXXXGNNSLQYSKNLGEQKEL-IAFTREELD--GVS 229
            + +D+ +SG+ +  + R               ++  N    K+  +  +  +LD  G+ 
Sbjct: 214 ILLEDFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGID 273

Query: 230 DAVFEQFEKFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDL 288
             +  Q EK I      + +K+ T+ Y   F +LK+  + E R K ++A  N   +    
Sbjct: 274 PELLSQIEKDI----AGKNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKR 328

Query: 289 FVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKD 348
             + +KLR  L+  L   +YA Y LE KMAK  + V++F+  L    KP+A KE+  + +
Sbjct: 329 LTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAE 388

Query: 349 IK---------QKECKELN--REYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEH 397
            K            C  L   R +D  YY    R  +    K+ +    E + +Y+ L +
Sbjct: 389 KKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIER--EQTSAKNLYGS--EEVLKYFTLGN 444

Query: 398 TINGMLKIYEELFKLKFNEET-KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRD 456
            + G+  ++++++ +K   +  K    W  +V+++ V   D       +G IY DL  R 
Sbjct: 445 VMQGLSNLFQKIYGIKLELDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERS 500

Query: 457 GKYGHAANFGISSS---------------YVDIETGKRSYPVTALVCNFSKSTATRP--- 498
           GK  +AA+F I  S                +D +  +   P+ +LVCNFSK+  +     
Sbjct: 501 GKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSV 560

Query: 499 SLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELK 558
             L   E+ T FHE+GH +H ++G+ KL   +G      DFVE PS ++E++  +   L+
Sbjct: 561 CFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLE 619

Query: 559 SLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNNVESLNLL 615
           ++  HY + E +  ++L   ++            Q    + D T+H    +++++ L+++
Sbjct: 620 TIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVV 679

Query: 616 KLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNP 675
           KL+ +L  ++ ++    + S     FGH+    YSA YY Y++    A+ ++   F  NP
Sbjct: 680 KLYQDLERQLGVLV--DDKSNWCGKFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNP 735

Query: 676 LDSEVGVQYRDIVLANGG 693
                G +YR+ VL  GG
Sbjct: 736 FSRASGDKYRNSVLQWGG 753

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 140/517 (27%), Positives = 243/517 (47%), Gaps = 65/517 (12%)

Query: 227 GVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNE 286
           GV+  + +Q  K I   TG+     T  Y  I  ++++  +   R K + A  +  P ++
Sbjct: 258 GVNSLLLKQLPKDI---TGKYYKIPTSGYIPI-SLIRSCPDATIRAKVW-ASLHSCPNDQ 312

Query: 287 -DLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISI 345
                  +KLR  LA  LN  ++A Y LE KMAK  + V DF+  L   ++P A +E+  
Sbjct: 313 IRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKF 372

Query: 346 LKDIKQKECKELN--------------REYDSHYYIYDHRYYDNKYLKDNFNVDLEAISE 391
           + D+K   CKELN                +D  YY   H    +  L +N  +++     
Sbjct: 373 MADLK---CKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM----- 424

Query: 392 YYPLEHTINGMLKIYEELFKLKFNEETKNKS-VWHEDVKQLAVWKMDNPEKPEFVGWIYF 450
           Y+ + + + G+  I++ ++ ++       +   W  +V++L V      E    +G +Y 
Sbjct: 425 YFTMGNIMKGLSHIFQRIYGIRLEAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYC 480

Query: 451 DLHPRDGKYGHAANFGISSS---YVD------IETGKR------SYPVTALVCNFSKSTA 495
           DL  R GK  + A+F +  S   Y D      I+ G          PV +LVCNFS +  
Sbjct: 481 DLFERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLT 540

Query: 496 TRP---SLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTW 552
           +      LL+ NEI T FHE+GH +H ++G+++L   +G      DFVE PS ++E +  
Sbjct: 541 SNDKMICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFAR 599

Query: 553 NANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESL 612
           +   L  +  HYE+NE++ + ++ + +K            Q    + D  +++ N ++ L
Sbjct: 600 DKRVLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDL 659

Query: 613 ---NLLKLWNELREEI-CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYH 668
              +++K++  L E++  LV+     S     FGH+    Y A YY Y++    A+ ++ 
Sbjct: 660 DHVDVVKIYQTLEEDLKVLVDNK---SNWCGKFGHLF--GYGASYYSYLFDRAIASKVWD 714

Query: 669 TKFSPNPLDSEVGVQYRDIVLANGGLYE----IADNL 701
             F+ +P   E G ++++ VL  GGL +    IAD L
Sbjct: 715 QLFAKDPFSREGGEKFKNCVLKWGGLRDPWHCIADVL 751

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 139/519 (26%), Positives = 250/519 (48%), Gaps = 47/519 (9%)

Query: 218 IAFTREELDGVSDAVFEQFEKFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFL 276
           +  +  ELD  + + F    K ++++   + +KV TF Y   + +LK+ +  + R+K + 
Sbjct: 249 VKISCRELDNSNVSAF--LLKQLNKDVKGQNYKVPTFGYA-AYALLKSCEKEQVRKKIWT 305

Query: 277 ADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLK 336
           A  +   +        +KLR  LA  ++  +YA Y LE KMAK  + V DF+  L     
Sbjct: 306 ALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTI 365

Query: 337 PLAMKEISILKDIKQKECKE-LNREYDSHYYI---YDHRYYDNKYLKDNFNVDLEA--IS 390
                E+  + ++K K+ K+ L  + D    +   +D  YY  KYL+ N +    A  IS
Sbjct: 366 DKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKEIS 425

Query: 391 EYYPLEHTINGMLKIYEELFKLKFNEETKNKS-VWHEDVKQLAVWKMDNPEKPEFVGWIY 449
            Y+ L + I G+  +++ ++ +K      ++   W  DV++L V      E+   +G IY
Sbjct: 426 SYFTLGNVIQGLSDLFQHIYGIKLEPAIADEGETWSPDVRRLNVIS----EEEGIIGIIY 481

Query: 450 FDLHPRDGKYGHAANFGISSS---------YVDIETGKRS------YPVTALVCNFSK-S 493
            DL  R GK  + A+F +  S         +  I+ G+ +       PV +LVCNF+   
Sbjct: 482 CDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIP 541

Query: 494 TATRPSL--LKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWT 551
            A++ SL  L+ +E+ T FHE+GH +H ++G+  +   +G      DFVE PS ++E + 
Sbjct: 542 IASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFA 600

Query: 552 WNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNN 608
            +   L  +  HYE+ E +  D+L S ++T +         Q    + D + H     +N
Sbjct: 601 KDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISN 660

Query: 609 VESLNLLKLWNELREEI-CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMY 667
           +++ +++K +  L   +  LV+   + S     FGH+    Y A YY Y++    A+ ++
Sbjct: 661 IDNYDVVKNYQALERRLKVLVD---DQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIW 715

Query: 668 HTKFSPNPLDSEVGVQYRDIVLANGGLYE----IADNLR 702
           +  F  +P   + G +++  +L  GGL +    IAD L+
Sbjct: 716 YALFEDDPYSRKNGDKFKKHLLKWGGLKDPWKCIADVLQ 754

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 126/503 (25%), Positives = 234/503 (46%), Gaps = 55/503 (10%)

Query: 227 GVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNE 286
           G++  +  Q  K I  +     +K+       + VL+   +   R+K + A  +  P  +
Sbjct: 269 GINQLILSQLSKDIKGK----HYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQ 323

Query: 287 DLFVETL-KLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISI 345
            + ++ L +LR  LA  +   +YA Y LE KMAK  E V DF++ L    +P A +E+  
Sbjct: 324 IVRLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGF 383

Query: 346 LKDIKQK------------ECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYY 393
           + D+K+K            +  ++ R +D  +Y   H  Y  +  + +  +D + IS Y+
Sbjct: 384 ISDLKRKHMDLPPSETSNLDTLDIVRPWDRDFY---HTIYSIQQRRQS-PIDDQQISMYF 439

Query: 394 PLEHTINGMLKIYEELFKLKFNEETKNKS-VWHEDVKQLAVWKMDNPEKPEFVGWIYFDL 452
            L + + G+  ++ +++ ++       K   W  +V++L V      ++   +G +Y DL
Sbjct: 440 TLGNVMQGLSDLFHQIYGIRLEPVIAQKGETWSPEVRRLNVVS----DEEGVIGVVYCDL 495

Query: 453 HPRDGKYGHAANFGISS-----------SYVDIETGKRS----YPVTALVCNFSKSTAT- 496
             RDGK  + ++F +             S + I T K       P+ +LVCNF+ S  + 
Sbjct: 496 FERDGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSF 555

Query: 497 --RPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNA 554
                LL  +EI T FHE+GH +H ++G+ +L   +G      DFVE PS ++E +  + 
Sbjct: 556 GQSLCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGTRCAT-DFVELPSILMEHFARDT 614

Query: 555 NELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNNVES 611
             L+ +  H  + E +P+ LLT+ ++            Q    + D  +H       +++
Sbjct: 615 RVLRQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDT 674

Query: 612 LNLLKLWNELREEI-CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTK 670
           L+++ L+  L  E+  LV+   + S     FGH+    Y A YY Y++    A+ ++ + 
Sbjct: 675 LDVVALYQNLERELRVLVD---DQSTWCGRFGHLF--GYGATYYSYLFDRAIASKVWESL 729

Query: 671 FSPNPLDSEVGVQYRDIVLANGG 693
           F  +P     G ++++ VL  GG
Sbjct: 730 FQEDPFSRAGGQRFKEYVLKWGG 752

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 130/518 (25%), Positives = 244/518 (47%), Gaps = 49/518 (9%)

Query: 223 EELD--GVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQN 280
           +ELD  GVS  +  Q  +    +   + +KV       F +L++  N   R K + A  +
Sbjct: 251 KELDSSGVSTLLLNQLSR----DLKNQNYKVPAYGYAAFSILRSCPNENVRMKIWTAMHS 306

Query: 281 KVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAM 340
              +      + + LR  LA+ +   +YA Y L  KMAK    V  F+  L    KPLA 
Sbjct: 307 CPEKQISRLKQLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAA 366

Query: 341 KEISILKDIKQKECKELNREYDSHYYIY----DHRYYD--NKYLKDNFNVDLEAISEYYP 394
           +E+ +L  +K         + D+    +    D  +Y   N   +    ++ E IS Y+ 
Sbjct: 367 EELRVLAKLKSGHLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFS 426

Query: 395 LEHTINGMLKIYEELFKLKFNEET-KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLH 453
           L   + G+ +++E+++ ++      K    W  +V+++ V      EK   +G +Y DL 
Sbjct: 427 LGTVMQGLSRLFEDIYGIRLEPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLF 482

Query: 454 PRDGKYGHAANFGISSSYV---------DIETG------KRSYPVTALVCNFSKSTATRP 498
            R GK  + A+F +  S            I+ G      K   PV +LVC+F++++A+R 
Sbjct: 483 ERQGKTSNPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQ 542

Query: 499 S--LLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANE 556
              LL+ +++ T FHE+GH +H ++G+  L   +G      DFVE PS ++E +  ++  
Sbjct: 543 GVCLLQLSDVDTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFARDSRV 601

Query: 557 LKSLSCHYESNEKIPDDLL----TSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVE-- 610
           L  +  HY +++ IP +LL    T +   +H         Q    + D  +H++  +   
Sbjct: 602 LSRIGRHYATDQPIPTELLKLNQTEMNYLQHTE----TFSQAKMAMLDQELHSSKALTDG 657

Query: 611 SLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTK 670
            L+++KL++ + +++ ++    + S     FGH++   Y A YY Y++    A+ ++   
Sbjct: 658 KLDVVKLYHGVEKDMEVL--ADDQSNWCGRFGHLL--GYGASYYSYLFDRAIASKIWQHL 713

Query: 671 FSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGRE 708
           F+ +P + E G ++++ VL  GG  +  + + D L R+
Sbjct: 714 FAEDPFNRENGEKFKESVLKWGGSKDPWECVADALDRK 751

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 136/498 (27%), Positives = 245/498 (49%), Gaps = 45/498 (9%)

Query: 238 KFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296
           K ++++   + +K+ TF Y   + +LK+ +  E R+K + A  +   +        +KLR
Sbjct: 264 KQLNKDVKGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKLR 322

Query: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356
             LA  +N  +YA Y LE KMAK  + V DF+  L          E+  + ++K K+ K+
Sbjct: 323 AILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDLKK 382

Query: 357 -LNREYDSHYYI---YDHRYYDNKYLKDNFN--VDLEAISEYYPLEHTINGMLKIYEELF 410
            L  + D    +   +D  YY  KYL+ N +   + + IS Y+ L + I G+  +++ ++
Sbjct: 383 PLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLFQHIY 442

Query: 411 KLKFNEETKNKS-VWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISS 469
            ++   E  ++   W  DV++L V      E+   +G IY DL  R+GK  + A+F +  
Sbjct: 443 GIRLEPEIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSNPAHFTVCC 498

Query: 470 S---------YVDIETGKR---SY---PVTALVCNFSK-STATRPSL--LKHNEITTFFH 511
           S         +  I+ G+    SY   PV +LVCNF+    A++ +L  L+ +E+ T FH
Sbjct: 499 SRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQLSEVETLFH 558

Query: 512 ELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIP 571
           E+GH +H ++G+  +   +G      DFVE PS ++E +  +   L  +S HYE+ E I 
Sbjct: 559 EMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKHYETGETIQ 617

Query: 572 DDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNNVESLNLLKLWNELREEI-CL 627
             +L S ++T +         Q    + D + H     +++++ +++K +  L   +  L
Sbjct: 618 AGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQALERRLKVL 677

Query: 628 VETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDI 687
           V+   + S     FGH+    Y A YY Y++    A+ +++  F  +P   + G +++  
Sbjct: 678 VD---DQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKH 732

Query: 688 VLANGGLYE----IADNL 701
           +L  GGL +    IAD L
Sbjct: 733 LLKWGGLKDPWKCIADVL 750

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 130/473 (27%), Positives = 225/473 (47%), Gaps = 38/473 (8%)

Query: 249 FKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTY 308
           +K+    P  + +L    N   R+K +    +   +  +   + + LR +LA  L   ++
Sbjct: 296 YKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLKKKSF 355

Query: 309 ANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYI- 367
           A Y L+ KMAK  E V  F++ L    KPLA+KE++ L ++K  +   L  + DS++ + 
Sbjct: 356 AEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTSLAEVKAADLG-LAFKNDSNFIVN 414

Query: 368 ----YDHRYYD--NKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET-KN 420
               +D  YY   N+Y       DL  +  Y+ L + I G+  ++  ++ ++F     K 
Sbjct: 415 LIRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGNVIAGLSNLFHNIYGIRFELAVPKL 474

Query: 421 KSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSS--------YV 472
           +  W  +V++L V      E    +G +Y DL  R  K  +AA+F I  S          
Sbjct: 475 EETWLPEVRKLNVIS----ESEGLIGIVYCDLFERPSKKTNAAHFTICCSREIGKGEDIS 530

Query: 473 DIETGKRS------YPVTALVCNFSKS---TATRPSLLKHNEITTFFHELGHGIHDLVGK 523
            ++ G  S       P+ +L+CNFSKS       P  L+ +EI T FHE+GH +H ++G+
Sbjct: 531 TMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLHEIETLFHEMGHAMHSVLGR 590

Query: 524 NKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKH 583
            +L   +G      DFVE PS ++E +  +   ++S+S HY S E    +LL + + +  
Sbjct: 591 TRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVMESISSHYISQEPASPELLQTWLHSTD 649

Query: 584 VNGALFALRQLHFGLFDMTVHTTNNVE---SLNLLKLWNELREEICLVETGHELSKGYDS 640
               L    Q    + D  +H+    E    +N++K +N+L +++ L     + S     
Sbjct: 650 NLQNLELYTQAKMSMLDQILHSNEIFEDQKDINVVKSYNDLEKKLELF--SDDQSNWCGK 707

Query: 641 FGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGG 693
           FGH+    Y A YY Y++    A+ ++ + F  NP     G++++D VL  GG
Sbjct: 708 FGHLF--GYGASYYSYLFDRAIASKVWESLFKQNPFSRTSGLKFKDSVLRWGG 758

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  164 bits (416), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 131/479 (27%), Positives = 230/479 (48%), Gaps = 41/479 (8%)

Query: 259 FPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMA 318
           +  L   K+ E R+K ++A  +   +  +   + +K R ELA  L+ S+Y+ Y LE KMA
Sbjct: 289 YTALLKCKDEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKLLSKSSYSEYTLEGKMA 348

Query: 319 KRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKEC--KELNREYDSHYYIYDHRYYDNK 376
           K  + V +FLN L   + P   KE   L+ I  K+C  +  + E      + + + +D  
Sbjct: 349 KGPKEVNNFLNALLKSILPEVTKE---LEPISNKKCLSEGFSLETSEQSILNNIKPWDRD 405

Query: 377 YLKDNFNVDLEA----ISEYYPLEHTINGMLKIYEELFKLKFNE-ETKNKSVWHEDVKQL 431
           Y          A    I EY+ L + I+G+  ++  ++ ++F   + ++   W +DV++L
Sbjct: 406 YYNPIQATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRFEPGKIEDGETWSKDVRKL 465

Query: 432 AVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSY---------------VDIET 476
            V   D       +G IY DL  R+GK    +++ I  S                V+ +T
Sbjct: 466 NVISEDEG----LIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKT 521

Query: 477 GKR-SYPVTALVCNFSKSTAT---RPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGP 532
           GK    P+ +LVCNF  + A    R   L+H+EI T FHE+GH +H ++G+ +    +G 
Sbjct: 522 GKNFQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGT 581

Query: 533 GATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALR 592
                DFVE PS ++EF+  N   L  +S HY+S E I  ++L   ++      A     
Sbjct: 582 RCVS-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYS 640

Query: 593 QLHFGLFDMTVHT--TNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYS 650
           Q    L D  +H    N++++++++++++ L +E+ ++      S     FGH+    Y 
Sbjct: 641 QGKMALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPDTE--SNWCGRFGHLY--GYG 696

Query: 651 AGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREP 709
           A YY Y++    A  ++ + F  +P   + G  +++ +L  GG  +    + D LG EP
Sbjct: 697 ALYYCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSKDPWKCVADVLG-EP 754

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 139/498 (27%), Positives = 240/498 (48%), Gaps = 45/498 (9%)

Query: 238 KFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296
           K ++++   + +KV TF Y   F +LK+ +    R+K + A  +   +        +KLR
Sbjct: 264 KQLNKDVKGQNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKLR 322

Query: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356
             LA  ++  +YA Y LE KMAK  + V DF+  L          E+  + D+K K+ K+
Sbjct: 323 AVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDLKK 382

Query: 357 -LNREYDSHYYI---YDHRYYDNKYLKDN-FNV-DLEAISEYYPLEHTINGMLKIYEELF 410
            L    D    +   +D  YY  KY++ N  NV   + IS Y+ L + I G+  ++++++
Sbjct: 383 PLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQIY 442

Query: 411 KLKFNEETKNKS-VWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISS 469
            ++      ++   W  DV++L V      E+   +G IY DL  R+GK  + A+F +  
Sbjct: 443 GIRLEPAIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSNPAHFTVCC 498

Query: 470 S---------YVDIETGKR---SY---PVTALVCNFSK-STATRPSL--LKHNEITTFFH 511
           S         +  I+ G+    SY   PV +LVCNFS    A++ SL  L+ +E+ T FH
Sbjct: 499 SRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLFH 558

Query: 512 ELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIP 571
           E+GH +H ++G+  +   +G      DFVE PS ++E +  +   L  +  HYE+ E I 
Sbjct: 559 EMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKHYETGETIQ 617

Query: 572 DDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNNVESLNLLKLWNELREEI-CL 627
             +L   +KT +         Q    + D + H     +++++ N++  +  L   +  L
Sbjct: 618 KGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKVL 677

Query: 628 VETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDI 687
           V+   + S     FGH+    Y A YY Y++    A+ +++T F  +P     G +++  
Sbjct: 678 VD---DQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKKH 732

Query: 688 VLANGGLYE----IADNL 701
           +L  GGL +    IAD L
Sbjct: 733 LLKWGGLKDPWKCIADVL 750

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 126/525 (24%), Positives = 245/525 (46%), Gaps = 66/525 (12%)

Query: 224 ELDGVSDAVFEQFEKFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFLADQNKV 282
           E  G+S  +     +    +T  + +KV T+ Y   F +L++  +   R K + A  +  
Sbjct: 255 ETSGISPLLLNHLSR----DTKGQNYKVPTYGYI-AFSILRSCPSENIRMKVWTAVHSCP 309

Query: 283 PQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKE 342
            +        +KLR  LA  +  ++Y++Y LE KMAK    V  F+  L   +KPLAM+E
Sbjct: 310 EKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRE 369

Query: 343 ISILKDIKQ-----------KECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISE 391
           +  L ++K            +E  +  R +D  +Y         +   +N     E I+ 
Sbjct: 370 LRALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLEN-----EQINS 424

Query: 392 YYPLEHTINGMLKIYEELFKLKFNEET-KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYF 450
           Y+ L   + G+  + E+++ ++      K    W  +V+++ V      ++   +G +Y 
Sbjct: 425 YFSLGTVMQGLSSLLEDIYGIRLEPAVAKVGETWSPEVRRINVVS----DQEGVIGVVYC 480

Query: 451 DLHPRDGKYGHAANFGISSS---------YVDIETGKR-------SYPVTALVCNFSKST 494
           DL  R GK  + A+F +  S            I+ G++         PV +LVC+FS+++
Sbjct: 481 DLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNS 540

Query: 495 ATRP--SLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTW 552
            ++    LL+ +E+ T FHE+GH IH ++G+  L   +G      DFVE PS ++E +  
Sbjct: 541 GSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFAH 599

Query: 553 NANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALF-------ALRQLHFGLFDMTVHT 605
           ++  L  +  HY +NE +PD+LL       H+N              Q    + D  +H+
Sbjct: 600 DSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTETFSQAKMAMLDQEMHS 652

Query: 606 TNNVES--LNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFA 663
              +    ++++++++E+ +++ ++    + S     FGH++   Y A YY Y++    A
Sbjct: 653 PRMLTDGPVDVVEIYHEVEKQMGVLTD--DKSNWCGRFGHLL--GYGASYYSYLFDRAIA 708

Query: 664 ADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGRE 708
           + ++   F+ +P   + G ++++ VL  GG  +  + + D L ++
Sbjct: 709 SKVWQHLFANDPFSRKSGEKFKNSVLRWGGSRDPWNCIADALDKQ 753

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  159 bits (403), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 133/498 (26%), Positives = 238/498 (47%), Gaps = 45/498 (9%)

Query: 238 KFIDEETGEEKFKV-TFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296
           K ++++   + +KV TF Y   + +LK+ +N   R+K + A  +   +        +KLR
Sbjct: 264 KQLNKDVKGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKLR 322

Query: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356
             LA  ++ ++YA Y LE KMAK  + V DF+  L          E+  + ++K K+ K+
Sbjct: 323 AILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDLKK 382

Query: 357 -LNREYDSHYYI---YDHRYYDNKYLKDNFNVDLEA--ISEYYPLEHTINGMLKIYEELF 410
            L    D    +   +D  YY  KY + N +    A  IS Y+ L + I G+  ++++++
Sbjct: 383 PLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQIY 442

Query: 411 KLKFNEE-TKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISS 469
            ++     T     W  DV++L V      E+   +G IY DL  R+GK  + A+F +  
Sbjct: 443 GIRLEPAITDEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSNPAHFTVCC 498

Query: 470 S---------YVDIETGKR------SYPVTALVCNFSKS-TATRPSL--LKHNEITTFFH 511
           S         +  I+ G+         PV +LVCNFS    A++ SL  L+ +E+ T FH
Sbjct: 499 SRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLFH 558

Query: 512 ELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIP 571
           E+GH +H ++G+  +   +G      DFVE PS ++E +  +   L  +  HY + E I 
Sbjct: 559 EMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGETIQ 617

Query: 572 DDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH---TTNNVESLNLLKLWNELREEI-CL 627
            D+L   +K+ +         Q    + D + H     +++++ ++++ +  L   +  L
Sbjct: 618 ADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKVL 677

Query: 628 VETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDI 687
           V+   + S     FGH+    Y A YY Y++    A+ +++  F  +P   + G +++  
Sbjct: 678 VD---DQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKH 732

Query: 688 VLANGGLYE----IADNL 701
           +L  GGL +    IAD L
Sbjct: 733 LLKWGGLKDPWKCIADVL 750

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  159 bits (401), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 121/466 (25%), Positives = 221/466 (47%), Gaps = 41/466 (8%)

Query: 259 FPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMA 318
           + +L++  + E R   + A      +  +   + L+LR  LA  +   ++A Y LE KMA
Sbjct: 298 YSILRSCPDEEIRMNLWTAMHRCSDKQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMA 357

Query: 319 KRQETVLDFLNDLKYRLKPLAMKEISILKDIKQK-ECKELN-----REYDSHYYIYDHRY 372
           +  + V DF+  L   ++P  ++E+  + ++K K E +E+      ++  S    +D  Y
Sbjct: 358 QTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSKQEKREIQPSPSEQDIASMVRPWDREY 417

Query: 373 YDNKY-LKDNFN-VDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET-KNKSVWHEDVK 429
           Y + Y L+   + +D E IS Y+ L + I G+  ++E ++ ++      K    +  +V+
Sbjct: 418 YTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLSDLFESIYGIRLEPVVPKTGETFSPEVR 477

Query: 430 QLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSS---------YVDIETGKRS 480
           +L V      E+   +G +Y DL  R GK  + ++F +  S         +  I+TG  S
Sbjct: 478 RLNVV----CEQEGVIGVVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNS 533

Query: 481 ------YPVTALVCNFSKSTATRP---SLLKHNEITTFFHELGHGIHDLVGKNKLSRFNG 531
                  PV ALVCNFS ST +      LL+ NE+ T FHE+GH +H ++G+ +L   +G
Sbjct: 534 EGLMFQLPVIALVCNFSSSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISG 593

Query: 532 PGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFAL 591
                 DFVE PS ++E +  +   L+ +  H+ +   I + LL + ++           
Sbjct: 594 TRCAT-DFVELPSILMEHFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETF 652

Query: 592 RQLHFGLFDMTVH---TTNNVESLNLLKLWNEL-REEICLVETGHELSKGYDSFGHIMSD 647
            Q    + D  +H      + +  ++   + +L R+   LV+   + S     FGH+   
Sbjct: 653 SQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQQLERDMKVLVD---DKSNWCGKFGHLF-- 707

Query: 648 SYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGG 693
            Y A YY Y++    A+ ++ + FS +P     G ++++ VL  GG
Sbjct: 708 GYGATYYSYLFDRAIASKVWDSLFSSDPYSRVNGEKFKECVLKWGG 753

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 160/656 (24%), Positives = 289/656 (44%), Gaps = 65/656 (9%)

Query: 85  ENLVRPYMIHENKISPLINK---LC-FLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140
           E LVR Y+I  +++S ++ +   LC FL+    D +   A+ +  E  Q FEI   L  D
Sbjct: 125 EGLVR-YIIRLDQLSDILCRVIDLCEFLRAAHPDEQFVAAAQECHE--QMFEIMNILNTD 181

Query: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGL-NLPEDKRX--XXXXXX 197
           + L   ++ Q +S+  ++   +   E  +    + +D+ ++G    PE ++         
Sbjct: 182 VVL-CKRLKQVLSD--ENISSKLSSEEIRVGHILLEDFEKAGAYASPEVRKQFIQLSQNI 238

Query: 198 XXXGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPD 257
              G + +  +++L      I     E  G S  V  Q  K    +T    +K+      
Sbjct: 239 SIIGQDFINNTESLSSSYIKIPCKDLESSGTSHLVLRQLTK----DTMGNNYKIPTSGYA 294

Query: 258 IFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKM 317
            + +L    +   RR+ + A  +   +        L+LR +LA  +  + Y +Y LE KM
Sbjct: 295 PYTLLNACPSEAIRRQVWTAMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKM 354

Query: 318 AKRQETVLDFLNDLKYRLKPLAMKEISILKDIK-------QKECKELNREYDSHYYIYDH 370
           AK  E V +FLN L    KPLA  E+  L  +K       +    +L R +D  YY    
Sbjct: 355 AKSPENVKNFLNTLVDHTKPLAAGELEELAKLKRNVENLSETNTLKLMRPWDRDYY---- 410

Query: 371 RYYDNKYLKDNFNVD-LEAISEYYPLEHTINGMLKIYEELFKLKFNEETKNKS-VWHEDV 428
                 + + N  VD   +I+ Y+ L   + G+  ++ +++ +            W  DV
Sbjct: 411 SSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGISDLFRDIYGISLKPVVAQAGETWAPDV 470

Query: 429 KQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSS---------YVDIETGKR 479
           ++L V      E    +G IY DL  R GK    ++F +  S         +  I+ G+ 
Sbjct: 471 RKLQVIS----ETEGIIGLIYCDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGEN 526

Query: 480 ------SYPVTALVCNFSKSTATRP---SLLKHNEITTFFHELGHGIHDLVGKNKLSRFN 530
                   PV +L+CNF  +   +     LL+ +++ T FHE+GH +H ++G+ +L   +
Sbjct: 527 PDGSRFQMPVISLICNFRATRHGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLS 586

Query: 531 GPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFA 590
           G      DFVE PS ++E +  +   L  +S +Y + E IP++LL++  +  +       
Sbjct: 587 GTRCVT-DFVELPSILMEHFAKDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTET 645

Query: 591 LRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEI-CLVETGHELSKGYDSFGHIMSDSY 649
             Q+   + D  +H+  + +  +++ +++ L  E+  LV+   + +     FGH+    Y
Sbjct: 646 FSQIKMSMLDQRLHSITDQD--DIIAVYHGLEREMEVLVD---DQTNWCGRFGHLF--GY 698

Query: 650 SAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYE----IADNL 701
            A YY Y+     AA ++   F  +P     G ++++ VL  GG  +    IAD L
Sbjct: 699 GASYYSYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEGVLKWGGSRDAWQCIADAL 754

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  139 bits (349), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 130/514 (25%), Positives = 225/514 (43%), Gaps = 55/514 (10%)

Query: 218 IAFTREELDG-VSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFL 276
           I  + E +D  V+  V  Q +K I   TGE     T+ Y     +L+T  +   R K + 
Sbjct: 248 IKISCELMDAHVNKMVCSQMKKDI---TGEYYKVPTYGYIP-HTLLRTCSDEVIRMKIWT 303

Query: 277 ADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLK 336
              +      +   + + LR ELA  L    +A Y L  KMAK  E V  FL  L +  +
Sbjct: 304 EMHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTR 363

Query: 337 PLAMKEISILKDIKQK-----------ECKELNREYDSHYYIYDHRYYDNKYLK-DNFNV 384
             A  E+  L  +K +           E  EL + +D  YY         +    DN   
Sbjct: 364 IKAASELKPLAVLKSELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNG-- 421

Query: 385 DLEAISEYYPLEHTINGMLKIYEELFKLKFNEET-KNKSVWHEDVKQLAVWKMDNPEKPE 443
             E+IS  + L   + G+  ++E+++ +K    T K    W  DV+++ V      E   
Sbjct: 422 --ESISSSFSLGVVMQGLSDLFEKIYGIKLVPATPKTGETWSPDVRRIDVVD----EHDG 475

Query: 444 FVGWIYFDLHPRDGKYGHAANFGISSS---YVD------IETGKRS------YPVTALVC 488
            +G +Y DL  R+GK  + A+F +  S   Y++      I+ G  S       PV +LVC
Sbjct: 476 LIGVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVC 535

Query: 489 NF-------SKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVE 541
           +F             +  LL+ NEI T FHE+GH +H ++G+ +L   +G      DFVE
Sbjct: 536 DFRWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVE 594

Query: 542 APSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDM 601
            PS ++E +  +   L S+S HY++ + +  ++L +               Q+     D 
Sbjct: 595 LPSILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQ 654

Query: 602 TVHTTNNVE--SLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWA 659
            +H  ++    S++++ +++ L   + ++    + S     FGH+    Y A YY Y++ 
Sbjct: 655 ELHNLDHTTDGSIDVIAIYHRLERRLAVLPD--DQSNWCGKFGHLF--GYGASYYSYLFD 710

Query: 660 EVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGG 693
              A+ ++   F  +P +   G ++++ +L  GG
Sbjct: 711 RAIASKIWDHLFEQDPFNRTNGTKFKEGLLQWGG 744

>KNAG0B06730 Chr2 (1330382..1332172) [1791 bp, 596 aa] {ON}
           Anc_4.355 YJR131W
          Length = 596

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 50/123 (40%), Gaps = 8/123 (6%)

Query: 54  NPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSE 113
            PS L  +     D   R   E    K PT +  ++P   H  +    +  + FL H++ 
Sbjct: 436 TPSGLAPEIVVFNDKGAREVKENGWWKSPTGDFYIKPLDAHNLQRPETVESIMFLYHLTG 495

Query: 114 DPKIREASLKATELLQKFEIEASLRHD-----LFLQFDKIWQEISEKKDDFVKEYDFETW 168
           D K RE      E+L+ FE    +  D      +   D +  E  ++KD+    +  ET 
Sbjct: 496 DKKYREW---GAEILESFEKNTCIHCDDASKKAYSSLDNVINEPFKRKDNVESFWLAETL 552

Query: 169 KFI 171
           K++
Sbjct: 553 KYL 555

>TPHA0E01080 Chr5 (221722..222876) [1155 bp, 384 aa] {ON} Anc_5.358
           YHR075C
          Length = 384

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 27/118 (22%)

Query: 593 QLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAG 652
           QL + L D T   T+ +E+ N   L +   E+   +  GH L       G I + +YS  
Sbjct: 154 QLEYNLNDFTDDFTSLIEAFNRNYLQDITEEKKSFILVGHSLG------GSICTFAYS-- 205

Query: 653 YYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPS 710
                            K  PN     VG+   DIV     ++ + DN++DFL R PS
Sbjct: 206 -----------------KLIPNIQKQIVGITMLDIV-EEAAIFAL-DNVQDFLHRTPS 244

>TDEL0H02560 Chr8 (428642..430099) [1458 bp, 485 aa] {ON} Anc_7.191
           YFR034C
          Length = 485

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 53  WNPSRLLFDAECV-----IDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLI 102
           W P  +  D + +     I N++ + DE S LKKP   NLVRP M+     SPL+
Sbjct: 67  WVPDSMQVDLDHLSHTLFIHNADHVNDEESQLKKPD-SNLVRPEMVFSPMASPLV 120

>ADR179C Chr4 complement(1017980..1018978) [999 bp, 332 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML015C
           (TAF40)
          Length = 332

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 223 EELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKV 282
           EE DG+ D + EQ     D+++ EE    TF +     +LKT KN E  RK  ++  N++
Sbjct: 222 EEGDGIEDEIMEQESDICDDDSKEE---ATFVHTS-NRLLKTTKNSEEIRKGIISQYNQL 277

>KAFR0B04950 Chr2 complement(1027783..1029645) [1863 bp, 620 aa]
           {ON} Anc_2.363 YMR155W
          Length = 620

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 27/56 (48%)

Query: 626 CLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVG 681
           C V  G+     + +F  I++DS+    Y  +W+      ++  KF  + L S++G
Sbjct: 494 CSVIFGYAFGVMFGTFPSIIADSFGTEEYSTIWSLCTTGGLFTVKFFTSVLASDIG 549

>CAGL0L00649g Chr12 complement(80936..83050) [2115 bp, 704 aa] {ON}
           highly similar to uniprot|Q01574 Saccharomyces
           cerevisiae YAL054c ACS1 acetyl-CoA synthetase
          Length = 704

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 22/114 (19%)

Query: 341 KEISILKDIKQKECKELNREYDSHYYI-------YDHRYYDNKYLKDNFNVDLEAISEYY 393
           K++  +++IK K  +  + EY+    +        DHR  DN  +K +++  L+ + EY 
Sbjct: 10  KQVDNIQEIKDKNQEPAHHEYEHLTNVGVVKQKPIDHRLKDN--IKTHYSPHLDGLQEYK 67

Query: 394 PLEHTINGMLKIYEELFKLK---FNEETKNKSVWHEDVKQLAVWKMDNPEKPEF 444
                     + Y+E  +     F+E+ ++   W  D  ++ V  +DNP KP F
Sbjct: 68  ----------RQYQESIENPEKFFSEKARSFMNWFRDFDRVFVPDVDNPTKPSF 111

>SAKL0H12848g Chr8 (1101137..1102564) [1428 bp, 475 aa] {ON}
          weakly similar to uniprot|Q04922 Saccharomyces
          cerevisiae YDR219C Hypothetical ORF
          Length = 475

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 32 RLYSNMTISAFIAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVR 89
          R+ SN +++     + A S NW   RLLFD   V+D    + D++ SL+K +V N +R
Sbjct: 43 RILSNESMTYHRKLKEANSKNWWTKRLLFDFFNVMDGKRHVLDQI-SLRKISVINALR 99

>YIL017C Chr9 complement(318200..320965) [2766 bp, 921 aa] {ON}
           VID28Protein involved in proteasome-dependent catabolite
           degradation of fructose-1,6-bisphosphatase (FBPase);
           localized to the nucleus and the cytoplasm
          Length = 921

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 43  IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLI 102
           I P    S+N++P    FD   ++D+   LY+E++ +  P +  L      H N I  ++
Sbjct: 330 ILPYLVKSFNYDPLPWWFDPFDMLDSLIVLYNEITPMNNPVLTTLA-----HTNVIFCIL 384

Query: 103 NKLCFLQHVSEDPKIREASLKAT 125
           ++  F Q +S  P+  EA+LK T
Sbjct: 385 SR--FAQCLSL-PQHNEATLKTT 404

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,439,398
Number of extensions: 4099590
Number of successful extensions: 13915
Number of sequences better than 10.0: 114
Number of HSP's gapped: 14291
Number of HSP's successfully gapped: 116
Length of query: 723
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 606
Effective length of database: 40,065,477
Effective search space: 24279679062
Effective search space used: 24279679062
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)