Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001701.8ON90903747e-48
NDAI0A001701.8ON96892523e-29
TBLA0A049601.8ON96722523e-29
NCAS0B090801.8ON93742497e-29
KNAG0C002501.8ON94942454e-28
CAGL0B00396g1.8ON88892427e-28
Skud_3.61.8ON97972438e-28
YCL057C-A (MOS1)1.8ON97972421e-27
Smik_3.171.8ON97972402e-27
SAKL0C00528g1.8ON110882395e-27
Ecym_10101.8ON82892366e-27
TDEL0C069401.8ON86892367e-27
AFR743W1.8ON82892332e-26
Suva_3.1551.8ON97972332e-26
TPHA0E039801.8ON86832313e-26
KLTH0F00550g1.8ON82892296e-26
Kpol_2002.111.8ON86722281e-25
ZYRO0F18414g1.8ON87692228e-25
Kwal_33.130161.8ON82892211e-24
KLLA0C00550g1.8ON82682132e-23
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00170
         (90 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   148   7e-48
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   101   3e-29
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   101   3e-29
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   100   7e-29
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    99   4e-28
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...    98   7e-28
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...    98   8e-28
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...    98   1e-27
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...    97   2e-27
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...    97   5e-27
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...    96   6e-27
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...    96   7e-27
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...    94   2e-26
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...    94   2e-26
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...    94   3e-26
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...    93   6e-26
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...    92   1e-25
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...    90   8e-25
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...    90   1e-24
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...    87   2e-23

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  148 bits (374), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 75/90 (83%)

Query: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
          MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNML               IFFKRRAFPV
Sbjct: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          WLGIGYGFGRAYSEGDAIFRSNAGLRSVQI
Sbjct: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  101 bits (252), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 58/89 (65%)

Query: 2  SEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVW 61
          +E      P +    +ID+SILNDKWD+VLSN L               IFFKRR FPVW
Sbjct: 8  TEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVW 67

Query: 62 LGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          LGIG+G GR Y+EGDAIFRS+AG+RSV +
Sbjct: 68 LGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  101 bits (252), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (73%)

Query: 19 DRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVWLGIGYGFGRAYSEGDAI 78
          +RSILNDKWD+V+SNML               IFFKRRAFPVWLG+G+G GR YSEGDAI
Sbjct: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84

Query: 79 FRSNAGLRSVQI 90
          FRS AGLRS Q+
Sbjct: 85 FRSTAGLRSFQV 96

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  100 bits (249), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 47/74 (63%), Positives = 54/74 (72%)

Query: 17 SIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVWLGIGYGFGRAYSEGD 76
          +IDRSILNDKWD+VLSNML               IFFKRR FPVWLGIG+G GR Y+EGD
Sbjct: 20 TIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGD 79

Query: 77 AIFRSNAGLRSVQI 90
          AIFRS AGLR+ ++
Sbjct: 80 AIFRSPAGLRTAKV 93

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 99.0 bits (245), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (63%), Gaps = 4/94 (4%)

Query: 1  MSEEDKVGKPAEYSN----NSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRR 56
          MSE        + +N      IDRS+LNDKWD+VLSNML               + F+RR
Sbjct: 1  MSETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRR 60

Query: 57 AFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          AFPVWLGIG+G GR YSEGDAIFRS +G+R+V++
Sbjct: 61 AFPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score = 97.8 bits (242), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 61/89 (68%), Gaps = 3/89 (3%)

Query: 2  SEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVW 61
          ++E+   K  +Y+     RSILNDKWD+VLSNM+               +FFKRR+FPVW
Sbjct: 3  NKEETKAKTVDYTPV---RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVW 59

Query: 62 LGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          LG+G+G GR YSEGDAIFRS AGLRSV++
Sbjct: 60 LGVGFGAGRGYSEGDAIFRSTAGLRSVKV 88

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 98.2 bits (243), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 66/97 (68%), Gaps = 7/97 (7%)

Query: 1  MSEEDKVGKPAEY--SNNSIDR-----SILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFF 53
          MSE+ K+ +PA+   SN+SI       +IL+ KWD+V+SNML               +FF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          KRRAFPVWLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score = 97.8 bits (242), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 63/97 (64%), Gaps = 7/97 (7%)

Query: 1  MSEEDKVGKPAEYS-------NNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFF 53
          MSE+ +  +PA+ +       N S   +IL+ KWD+VLSNML               +FF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          KRRAFPVWLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 97.1 bits (240), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (64%), Gaps = 7/97 (7%)

Query: 1  MSEEDKVGKPAEYS-------NNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFF 53
          MSE+ +  +PA+ +       N S   ++L+ KWD+VLSNML               +FF
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          KRRAFPVWLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score = 96.7 bits (239), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 8/88 (9%)

Query: 1   MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
           MSE+ +V KP        ++SILNDKWD+VLSN++               + FKRRAFPV
Sbjct: 29  MSEQLQVSKP--------NKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPV 80

Query: 61  WLGIGYGFGRAYSEGDAIFRSNAGLRSV 88
           WLG+G+G GR Y+EGDAIFRS+AGLR+V
Sbjct: 81  WLGVGFGLGRGYAEGDAIFRSSAGLRTV 108

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score = 95.5 bits (236), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 60/89 (67%), Gaps = 8/89 (8%)

Query: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
          M E+ +V  P+        RSILNDKWD+VLSN++               +FFKRRAFPV
Sbjct: 1  MGEKLEVAAPS--------RSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPV 52

Query: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89
          WLGIG+G GR Y+EGDAIFRS+AGLR+++
Sbjct: 53 WLGIGFGLGRGYAEGDAIFRSHAGLRTMK 81

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 95.5 bits (236), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 60/89 (67%), Gaps = 4/89 (4%)

Query: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
          MSE+ +    A+    +  RSILNDKWD+VLSNML               +FFKRRAFPV
Sbjct: 1  MSEKSQ----AQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPV 56

Query: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89
          WLGIG+G GR Y+EGDAIFRS AGLRSV+
Sbjct: 57 WLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score = 94.4 bits (233), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 60/89 (67%), Gaps = 8/89 (8%)

Query: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
          MS + +V  P+        RSILNDKWD+VLSN++               +FFKRRAFPV
Sbjct: 1  MSGQLEVSAPS--------RSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPV 52

Query: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89
          WLG+G+G GR Y+EGDAIFRS+AGLR+V+
Sbjct: 53 WLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 94.4 bits (233), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (62%), Gaps = 7/97 (7%)

Query: 1  MSEEDKVGKPAEYS-------NNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFF 53
          MSE+ +   PA+ +       N S   ++L+ KWD+VLSNML               +FF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90
          KRRAFP WLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 93.6 bits (231), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 47/83 (56%), Positives = 58/83 (69%), Gaps = 4/83 (4%)

Query: 12 EYSNNSID----RSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVWLGIGYG 67
          + +NN+++    +SILNDKWD+VLSNML               + FKRRAFPVWLGIG+G
Sbjct: 4  QKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFG 63

Query: 68 FGRAYSEGDAIFRSNAGLRSVQI 90
           GR YS+GDAIFRS AGLRS +I
Sbjct: 64 VGRGYSDGDAIFRSAAGLRSTRI 86

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 92.8 bits (229), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 59/89 (66%), Gaps = 8/89 (8%)

Query: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
          MSE+ KV        +   RS+LNDKWD+VLSN++               + FKRRAFPV
Sbjct: 1  MSEQLKV--------SPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPV 52

Query: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89
          W+G+G+G GR Y+EGDAIFRS+AGLR+V+
Sbjct: 53 WIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score = 92.4 bits (228), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 49/72 (68%)

Query: 15 NNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVWLGIGYGFGRAYSE 74
           ++  RSILNDKWD+VLSN L               I FKRRAFPVWLGIG+G GR YSE
Sbjct: 11 TSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSE 70

Query: 75 GDAIFRSNAGLR 86
          GDAIFRS AGLR
Sbjct: 71 GDAIFRSAAGLR 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score = 90.1 bits (222), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 42/69 (60%), Positives = 50/69 (72%)

Query: 19 DRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVWLGIGYGFGRAYSEGDAI 78
          ++SILNDKWD+VLSN+L               + FKRRAFPVWLGIG+G GR Y+EGDAI
Sbjct: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75

Query: 79 FRSNAGLRS 87
          FRS AGLR+
Sbjct: 76 FRSAAGLRT 84

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score = 89.7 bits (221), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 8/89 (8%)

Query: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPV 60
          MS++ K+          + RS+LNDKWD+VLSN++               + FKRRA PV
Sbjct: 1  MSDQAKIAP--------VSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPV 52

Query: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89
          W+G+G+G GR YSEGDAIFRS+AGLR+V+
Sbjct: 53 WIGVGFGLGRGYSEGDAIFRSSAGLRTVK 81

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 86.7 bits (213), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 49/68 (72%)

Query: 21 SILNDKWDLVLSNMLXXXXXXXXXXXXXXXIFFKRRAFPVWLGIGYGFGRAYSEGDAIFR 80
          SIL+ +WD+VLSN++               +FFKRRAFPVW+G+G+G GR Y+EGDAIFR
Sbjct: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72

Query: 81 SNAGLRSV 88
          +NAGLR V
Sbjct: 73 TNAGLRKV 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,368,809
Number of extensions: 215610
Number of successful extensions: 482
Number of sequences better than 10.0: 20
Number of HSP's gapped: 482
Number of HSP's successfully gapped: 20
Length of query: 90
Length of database: 53,481,399
Length adjustment: 61
Effective length of query: 29
Effective length of database: 46,486,773
Effective search space: 1348116417
Effective search space used: 1348116417
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)