Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001601.7ON1111114732e-62
Kpol_2002.101.7ON1111131842e-18
Suva_3.1541.7ON1131151817e-18
Skud_3.51.7ON1131151652e-15
YCL058W-A (ADF1)1.7ON1131141642e-15
NDAI0A001601.7ON1231101522e-13
TPHA0E039901.7ON1161131434e-12
Smik_3.161.7ON1131141425e-12
KNAG0C002401.7ON1261081392e-11
NCAS0B090901.7ON1191061295e-10
CAGL0B00374g1.7ON121931286e-10
SAKL0C00506g1.7ON105871224e-09
TBLA0A049501.7ON113951191e-08
Kwal_YGOB_YCL058W-A1.7ON105951051e-06
Kwal_33.13015singletonOFF105951051e-06
ZYRO0F18436g1.7ON11294946e-05
TDEL0C069501.7ON11193912e-04
KLTH0F00528g1.7ON104106902e-04
Smik_11.3181.214ON60237700.30
Skud_11.2921.214ON60337700.32
YKR056W (TRM2)1.214ON63937700.33
Skud_7.3664.219ON115733670.96
Suva_11.2901.214ON60337642.2
KLLA0C00528g1.7ON11644613.4
AFR743CA1.7ON10187603.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00160
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...   186   2e-62
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    75   2e-18
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    74   7e-18
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    68   2e-15
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    68   2e-15
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    63   2e-13
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    60   4e-12
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    59   5e-12
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    58   2e-11
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    54   5e-10
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    54   6e-10
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    52   4e-09
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    50   1e-08
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    45   1e-06
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    45   1e-06
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    41   6e-05
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    40   2e-04
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    39   2e-04
Smik_11.318 Chr11 (539465..541273) [1809 bp, 602 aa] {ON} YKR056...    32   0.30 
Skud_11.292 Chr11 (531043..532854) [1812 bp, 603 aa] {ON} YKR056...    32   0.32 
YKR056W Chr11 (549448..551367) [1920 bp, 639 aa] {ON}  TRM2tRNA ...    32   0.33 
Skud_7.366 Chr7 (615061..618534) [3474 bp, 1157 aa] {ON} YGR070W...    30   0.96 
Suva_11.290 Chr11 (533228..535039) [1812 bp, 603 aa] {ON} YKR056...    29   2.2  
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    28   3.4  
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    28   3.4  

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score =  186 bits (473), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 97/111 (87%)

Query: 1   MGKSKTARQAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXX 60
           MGKSKTARQAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELN        
Sbjct: 1   MGKSKTARQAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKR 60

Query: 61  XXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                 NALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL
Sbjct: 61  RLSKTKNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 75.5 bits (184), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (61%), Gaps = 4/113 (3%)

Query: 1   MGKSKTARQAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTI--TNVQELNXXXXXX 58
           M KS  + +  GN  KK K RKNVISQSE+K+NK+ +EK N++ I  +++ +LN      
Sbjct: 1   MAKSSVSMRKKGNVGKKSK-RKNVISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNG 59

Query: 59  XXXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                    ALE++KL  D  +D E    IE   KET+DSMLKQIE+++GFSL
Sbjct: 60  QSEGNKER-ALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 74.3 bits (181), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 69/115 (60%), Gaps = 6/115 (5%)

Query: 1   MGKS----KTARQAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXX 56
           MGKS    KT  + GG  + K + +K  IS +E K+ KL VE+ N+ + T +  L     
Sbjct: 1   MGKSSMRKKTQGKNGG--VGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPTLLKEAS 58

Query: 57  XXXXXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                     + LE ++L+ DQARD +V+++IET+  +T DSMLKQIEMISGFSL
Sbjct: 59  KQDLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 68.2 bits (165), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 6/115 (5%)

Query: 1   MGKS----KTARQAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXX 56
           MGKS    KT  + GG  + K   +K  IS +ERK+ KL VEK N+ +   +  L     
Sbjct: 1   MGKSSLRMKTQGKNGG--VGKKVQKKRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETA 58

Query: 57  XXXXXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                     + L+ ++L+ DQA+D +V++ I+T+  +T DSML+QIEMISGFSL
Sbjct: 59  TQEPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 67.8 bits (164), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 1   MGKSKTARQAGGNRI---KKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXX 57
           MGK    ++  G  +   KK++ +K  IS +ERK+ KL VEK N+ + T +  L      
Sbjct: 1   MGKCSMKKKGVGKNVGVGKKVQ-KKRSISTAERKRTKLQVEKLNKSSETMIPTLLREAST 59

Query: 58  XXXXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                      L+ ++L+ DQ +D +V++ I T+  +T DSMLKQIEMISGFSL
Sbjct: 60  QEPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 63.2 bits (152), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 8/110 (7%)

Query: 8   RQAGGNRIKKIKS---RKNVISQSERKKNKLIVEKFNQQTI--TNVQELNXXXXXX---X 59
           R   G +I+K K+   + NVI QS+RKKNK+ V  FN+++    NV ELN          
Sbjct: 12  RLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQK 71

Query: 60  XXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGF 109
                  ++L    LL+DQ +D E    I+T+ K+  D ML+QIEMISGF
Sbjct: 72  QDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 59.7 bits (143), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 2   GKSKTARQAGGNRIKKIKSRKNV---ISQSERKKNKLIVEKFNQQTITNVQELNXXXXXX 58
           GKS   +++  N  K +K RKN+   +S   RK  K  VEK N+  + +  ++N      
Sbjct: 4   GKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALN 63

Query: 59  XXXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                   + LE K L  D  +D ++ + IE+K KET  S+L+QIEM+SGFSL
Sbjct: 64  GKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 59.3 bits (142), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 4/114 (3%)

Query: 1   MGKSKTARQAGGNRI---KKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXX 57
           MGK+   R++ G  +   KK++ R++ IS + +K+ KL VEK N+ +   +  L      
Sbjct: 1   MGKNSMRRKSVGKNVGVGKKVQKRRS-ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGA 59

Query: 58  XXXXXXXXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
                    + L+   L+ DQ +D +V+++I+ +  +T D+MLKQIEMISGFSL
Sbjct: 60  QEPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 58.2 bits (139), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 14  RIKKIKSR--KNVISQSERKKNKLIVEKFNQQTITNVQ--------ELNXXXXXXXXXXX 63
           R++K K R     I  SERK+NKL VEK N+ T   ++        E++           
Sbjct: 19  RVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNR 78

Query: 64  XXXNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
               +L+ +KL  D+++D  +++ +  K KET+ SML QIEMISGFSL
Sbjct: 79  TVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 54.3 bits (129), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 57/106 (53%), Gaps = 7/106 (6%)

Query: 9   QAGGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQ---TITNVQELNXXXXXXXXXXXXX 65
           + G N++KK    KN IS S+RKK K  VEK N++      NV +L              
Sbjct: 18  KTGKNQVKK---NKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDL-QKKKNLSKKPEPL 73

Query: 66  XNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
            + L  + LL DQ +D E++  I  + K T+DS+ KQIEMISGF+ 
Sbjct: 74  KSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 53.9 bits (128), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 6/93 (6%)

Query: 23  NVISQSERKKNKLIVEKFNQQT----ITNVQELNXXXXXXXXXXXXXXNALETKKLLHDQ 78
           N IS SERKK+K++  + N+      +  +QELN               AL+   L+ DQ
Sbjct: 31  NKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQ--TALDMNCLVKDQ 88

Query: 79  ARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
            RD +V+++IE    ET   MLKQ+E++SGFSL
Sbjct: 89  KRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 25  ISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXXXNALETKKLLHDQARDHEV 84
           I +S++K+ ++ VE+ N+Q    + +LN                L+ K L  DQ +D E 
Sbjct: 21  IKKSQKKRTRIQVEQLNKQEFL-LSDLNMTNAGSTKTKEKPK-TLQAKALAQDQKKDKET 78

Query: 85  KQNIETKLKETEDSMLKQIEMISGFSL 111
           +  +E + K+T D+ML Q+EMISGFSL
Sbjct: 79  RDKLEKQRKDTNDNMLAQLEMISGFSL 105

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 50.4 bits (119), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 6/95 (6%)

Query: 19  KSRKNVISQSERKKNKLIVEKFNQQT--ITNVQELNXXXXXXXXXXXXXXNALETKKLLH 76
           K + N IS  ++K+ KL VEK N+Q   ++++  LN              N L +K+L  
Sbjct: 23  KVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNV----NTLSSKQLKK 78

Query: 77  DQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           DQ +D  +   I+ K K+T D ++ QIEMISGFSL
Sbjct: 79  DQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 17  KIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXXXNALETKKLLH 76
           K +  KNVI + ++ + KL VE+ N++    + ELN               +L+  +L+ 
Sbjct: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFL-ISELNKREDTKRQSSPL--ESLKPSRLVK 70

Query: 77  DQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           D  +D   ++ +E++ K T++++L+Q+E+ISGFSL
Sbjct: 71  DIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 17  KIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXXXNALETKKLLH 76
           K +  KNVI + ++ + KL VE+ N++    + ELN               +L+  +L+ 
Sbjct: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFL-ISELNKREDTKRQSSPL--ESLKPSRLVK 70

Query: 77  DQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           D  +D   ++ +E++ K T++++L+Q+E+ISGFSL
Sbjct: 71  DIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 40.8 bits (94), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 18  IKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXXXNALETKKLLHD 77
            K  K  IS S++K+ K  VEK + + +    E+               ++L  + L  D
Sbjct: 20  FKKPKKSISHSDKKRTKSKVEKLDAKGLL-PSEIFKLNRSASSKTSNGSSSLLARNLEQD 78

Query: 78  QARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           +  D + +     K KET++++L+QIEMISGFSL
Sbjct: 79  RKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%)

Query: 19  KSRKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXXXNALETKKLLHDQ 78
           K+ K  IS+ + KK K  VE  N+ T +  + +               N LE + L  D 
Sbjct: 19  KNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDW 78

Query: 79  ARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
            +D ++++  + + +E  +++ KQIE ISGFSL
Sbjct: 79  QKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 60/106 (56%), Gaps = 4/106 (3%)

Query: 7   ARQAGGNRIKKIKS-RKNVISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXX 65
           AR+  G + +  +   K VI + ++ + KL VE+ N+++   + ELN             
Sbjct: 2   ARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFL-ISELNEREHNTKRTPAL- 59

Query: 66  XNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
             +L+   L+ D+ +D  +++ +E + + T++++++Q+E+ISGFSL
Sbjct: 60  -ESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>Smik_11.318 Chr11 (539465..541273) [1809 bp, 602 aa] {ON} YKR056W
           (REAL)
          Length = 602

 Score = 31.6 bits (70), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 75  LHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           +H QARD      +E  LKETE+    QIE I GF  
Sbjct: 556 VHSQARD------VEYFLKETENGSAYQIESIRGFDF 586

>Skud_11.292 Chr11 (531043..532854) [1812 bp, 603 aa] {ON} YKR056W
           (REAL)
          Length = 603

 Score = 31.6 bits (70), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 75  LHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           +H QARD      +E  LKETE+    QIE I GF  
Sbjct: 557 VHSQARD------VEYFLKETENGSAYQIESIRGFDF 587

>YKR056W Chr11 (549448..551367) [1920 bp, 639 aa] {ON}  TRM2tRNA
           methyltransferase, 5-methylates the uridine residue at
           position 54 of tRNAs and may also have a role in tRNA
           stabilization or maturation; endo-exonuclease with a
           role in DNA repair
          Length = 639

 Score = 31.6 bits (70), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 75  LHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           +H QARD      +E  LKETE+    QIE I GF  
Sbjct: 593 VHSQARD------VEYFLKETENGSAHQIESIRGFDF 623

>Skud_7.366 Chr7 (615061..618534) [3474 bp, 1157 aa] {ON} YGR070W
           (REAL)
          Length = 1157

 Score = 30.4 bits (67), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 68  ALETKKLLHDQARDHEVKQNIETKLKETEDSML 100
           +LET+KL HD   DH ++ +I    + + DS+ 
Sbjct: 323 SLETQKLFHDVLYDHSIRDSILEVYELSSDSIF 355

>Suva_11.290 Chr11 (533228..535039) [1812 bp, 603 aa] {ON} YKR056W
           (REAL)
          Length = 603

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 75  LHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           +H QARD      +E  LKETE+    +IE I GF  
Sbjct: 557 VHSQARD------VEYFLKETENGSSYKIESIRGFDF 587

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 68  ALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111
           +LE +K+      D EV +  + + K TE  +  Q+E+ISGFSL
Sbjct: 73  SLEGQKVREHYKEDKEVVKKHDKEKKATEKKIEDQLELISGFSL 116

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 27.7 bits (60), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 25  ISQSERKKNKLIVEKFNQQTITNVQELNXXXXXXXXXXXXXXNALETKKLLHDQARDHEV 84
           IS++++K+ KL VEK +++ +   +                   L+   L  DQ  D + 
Sbjct: 22  ISKADKKRAKLQVEKLDKRGVLLAELTAAAPAAKT-------GVLQAASLAQDQRSDAQA 74

Query: 85  KQNIETKLKETEDSMLKQIEMISGFSL 111
           +Q    +    +  +++Q+E I+GFSL
Sbjct: 75  QQQRAQERSNVDKKVVQQLEAIAGFSL 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.123    0.309 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,763,628
Number of extensions: 258045
Number of successful extensions: 1337
Number of sequences better than 10.0: 45
Number of HSP's gapped: 1327
Number of HSP's successfully gapped: 45
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)