Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001501.6ON34434414220.0
NDAI0A001501.6ON31727112551e-174
NCAS0B091001.6ON32730512551e-174
TPHA0E040001.6ON31630512531e-174
KNAG0C002301.6ON34927112491e-173
Smik_3.151.6ON31627212451e-173
YCL059C (KRR1)1.6ON31627212441e-172
Kpol_2002.91.6ON33830512461e-172
CAGL0B00352g1.6ON33730512451e-172
SAKL0C00484g1.6ON33930612441e-172
Skud_3.41.6ON31627212401e-172
Suva_3.1531.6ON31627212351e-171
Kwal_33.130111.6ON33427212331e-171
Ecym_10091.6ON33630512311e-170
KLLA0C00506g1.6ON33027112251e-169
TBLA0A049401.6ON31627112171e-168
KLTH0F00506g1.6ON33227212171e-168
TDEL0C069601.6ON35027112121e-167
AFR744W1.6ON34327112011e-165
ZYRO0F18458g1.6ON31427111921e-164
Suva_8.1975.482ON2741571005e-04
SAKL0G03740g5.482ON2661551005e-04
Kpol_543.135.482ON268155996e-04
ZYRO0D11440g5.482ON269155997e-04
KLTH0G02574g5.482ON271155997e-04
Kwal_47.188645.482ON271155997e-04
TDEL0A034605.482ON272155997e-04
Ecym_45525.482ON271155988e-04
NCAS0A119605.482ON270185980.001
Skud_15.3105.482ON276157950.002
KLLA0C06446g5.482ON274155950.002
TPHA0J028205.482ON268155950.002
YOR145C (PNO1)5.482ON274157940.003
Smik_15.3265.482ON274157940.003
KNAG0C046105.482ON277185930.003
KAFR0E036005.482ON276155930.003
NDAI0A043105.482ON274155910.006
CAGL0K09460g5.482ON261155900.008
TBLA0D018905.482ON271155870.020
AAR002W1.420ON178163810.079
KAFR0B030308.309ON46724712.3
AGL183C8.309ON50724712.5
KNAG0G023508.309ON49724684.9
KLLA0D02398g1.290ON120583686.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00150
         (344 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   552   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   488   e-174
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   488   e-174
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   487   e-174
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   485   e-173
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   484   e-173
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   483   e-172
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   484   e-172
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   484   e-172
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   483   e-172
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   482   e-172
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   480   e-171
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   479   e-171
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   478   e-170
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   476   e-169
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   473   e-168
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   473   e-168
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   471   e-167
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   467   e-165
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   463   e-164
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    43   5e-04
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    43   5e-04
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    43   6e-04
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    43   7e-04
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    43   7e-04
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    43   7e-04
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    43   7e-04
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    42   8e-04
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    42   0.001
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    41   0.002
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    41   0.002
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    41   0.002
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    41   0.003
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    41   0.003
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    40   0.003
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    40   0.003
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    40   0.006
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    39   0.008
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    38   0.020
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    36   0.079
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.3  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.5  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   4.9  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    31   6.8  

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/344 (81%), Positives = 279/344 (81%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPTQLPRKVDLEIESGEYFLS                             
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 NYIAPXXXXXXXXXXXXXXXXXXNVADDEAEIDNSEKSVKKHKA 344
           NYIAP                  NVADDEAEIDNSEKSVKKHKA
Sbjct: 301 NYIAPKEESYKSSIDKKKKKRSKNVADDEAEIDNSEKSVKKHKA 344

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/271 (84%), Positives = 246/271 (90%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDTE+I+KW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL  H++AC+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM N+HPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                +YTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLS 271

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/305 (76%), Positives = 249/305 (81%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDT D+DKW  EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL KH++ C+LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPP QLPRKVDLEIESGEYFLS                             
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 NYIAP 305
           NYIAP
Sbjct: 301 NYIAP 305

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/305 (77%), Positives = 250/305 (81%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+NKEKPWDTEDIDKW+ E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           TKAL+KHH+AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPP+QLPRKVDLEIESGEYFLS                             
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 NYIAP 305
           NYIAP
Sbjct: 301 NYIAP 305

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/271 (84%), Positives = 244/271 (90%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+NK+KPWDT+DIDKW  EEFKPEDNASG PFAEESSFMTLFPKYRE+YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           TKAL+ HHIAC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+++
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                VYTPFPP QLPRKVDLEIESGEYFL+
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLN 271

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  484 bits (1245), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/272 (84%), Positives = 247/272 (90%), Gaps = 1/272 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDT+DIDKW+ EEFK EDNASG PFAEESSFMTLFPKYRESYLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KH+IAC+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                 VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/272 (84%), Positives = 247/272 (90%), Gaps = 1/272 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDT+DIDKW+ EEFK EDNASG PFAEESSFMTLFPKYRESYLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KH+IAC+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                 VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  484 bits (1246), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 235/305 (77%), Positives = 247/305 (80%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+NK+KPWDTEDIDKW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           TKAL+K HIAC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQAIKILED+
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPP Q PRKVDLEIESGEYFLS                             
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 NYIAP 305
           +Y+AP
Sbjct: 301 DYVAP 305

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  484 bits (1245), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/305 (75%), Positives = 248/305 (81%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVSTYNK+KPWDTEDIDKW+ EEFKPEDN SG PFAEESSFMTLFPKYRE+YLKS+W DV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KHHI C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV DCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPP QLPRKVDL+IESGEYFLS                             
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 NYIAP 305
           +YIAP
Sbjct: 301 DYIAP 305

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/306 (77%), Positives = 250/306 (81%), Gaps = 1/306 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           M ST+NK+KPWDT +IDKW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KHHIAC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXX-XXXXXXXX 239
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPP QLPRKVDLEIESGEYFLS                            
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 XNYIAP 305
            +Y+AP
Sbjct: 301 KDYVAP 306

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 245/272 (90%), Gaps = 1/272 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N+EKPWDT+DIDKW+ EEFK EDN SG PFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KH+IAC+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                 VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  480 bits (1235), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/272 (83%), Positives = 246/272 (90%), Gaps = 1/272 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDT+D+DKW  EEFK EDNASG PFAEESSFMTLFPKYRE+YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KH+I+C+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                 VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 243/272 (89%), Gaps = 1/272 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           M ST+NK+KPWDT DIDKW+ EEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+ALEKH I+C+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                 VYTPFPP Q PRKVDL+IESGEYFLS
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLS 272

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  478 bits (1231), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/305 (76%), Positives = 250/305 (81%), Gaps = 1/305 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+NK+KPWDT DIDKW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKS W DV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KHH+AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPP QLPRKVDLEIE+GEYFLS                             
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 NYIAP 305
           +YIAP
Sbjct: 300 DYIAP 304

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  476 bits (1225), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 244/271 (90%), Gaps = 1/271 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+NK+KPWDT+++DKW  EEFKPEDN SGLPFAEESSFMTLFPKYRE+YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T++L+ HHIAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                +YTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLS 270

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  473 bits (1217), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/271 (82%), Positives = 244/271 (90%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDT DI+KW+ +EFKPEDNASGLPF EESSFMTLFPKYRE+YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           TK+L+K+H+AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQAI+IL+D+
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLS 271

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  473 bits (1217), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 224/272 (82%), Positives = 243/272 (89%), Gaps = 1/272 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           M ST+NK+KPWDT DIDKW+ EEFKPEDN SG+PFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL+KH+IAC+LDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                 VYTPFPP Q PRK+DL+IESGEYFL+
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLT 272

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  471 bits (1212), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/271 (81%), Positives = 239/271 (88%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+N++KPWDTEDIDKWQ EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+AL  HHIAC+LDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QA+KILE++
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M NVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                VYTPFPP Q PRK+DLEIESGEYFLS
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLS 271

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  467 bits (1201), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/271 (82%), Positives = 242/271 (89%), Gaps = 1/271 (0%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST NK+KPWDT D+DKW  EEF PED+ASGLPFAEESSFMTLFPKYRE+YLKS+WK+V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           T+ALEKHHIAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQAIKIL+D+
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                VYTPFPP QLPRKVDLEIE+GEYFLS
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLS 270

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  463 bits (1192), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/271 (81%), Positives = 237/271 (87%)

Query: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60
           MVST+NK+KPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYRE+YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120
           TKAL K+H+AC+LDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQA+KILEDN
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M N+HPIYHIKELMIKRELAK+PELANEDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPTQLPRKVDLEIESGEYFLS 271
                VYTPFPP Q PRKVDLEIESGEYFL+
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLN 271

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 72/157 (45%), Gaps = 4/157 (2%)

Query: 44  LFPKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R + L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
           T+  I++  + +  +G F  ++  R  V   +L   P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFVVSLILGSPP 256

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       AI +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 248

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 250

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 71/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R + L++ W  +   L +H  +   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  ++ +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++    +  +G F  ++  R  V   +L   P
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAVVSLILGSPP 251

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    AI +L  D++  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    AI +L  D++  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 71/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 254

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  +   +L   P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETIVSLILGSPP 253

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 79/185 (42%), Gaps = 5/185 (2%)

Query: 16  IDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDVTKALEKH-HIACILD 74
           +D+     F   + A G     ES  + + P +R + L++ W  +   L  H  +   ++
Sbjct: 69  LDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWTKIYPPLVDHLKLQVRMN 127

Query: 75  LVEGSMTVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAIKILE-DNMACDVIKIGNFV 132
           L   S+ ++T  K T DP  + K  D IK          +I +L  D++  +  +I +  
Sbjct: 128 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEIKDVK 187

Query: 133 S-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCM 191
           +   +   +   R+ G +G T  A+E  T+  I++    +  +G F  ++  R  V   +
Sbjct: 188 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHILGGFTHIRMAREAVVSLI 247

Query: 192 LNVHP 196
           L   P
Sbjct: 248 LGSPP 252

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 44  LFPKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R + L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
           T+  I++  + +  +G F  ++  R  V   +L   P
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 258

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + LK+ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVSNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  +I +  + +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  +I +  + + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++    +  +G F  ++  R  V   +L   P
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 250

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 44  LFPKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R + L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
           T+  I++  + +  +G F  ++  R  V   +L   P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 44  LFPKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R + L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
           T+  I++  + +  +G F  ++  R  V   +L   P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 81/185 (43%), Gaps = 5/185 (2%)

Query: 16  IDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDVTKALEKH-HIACILD 74
           +D+     F   + AS      ES  + + P +R + L++ W  +   L  H  +   ++
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LVEGSMTVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAIKILE-DNMACDVIKIGNFV 132
           L   S+ ++T  K T DP  + K  D IK          +I +L  D++  +  ++ +  
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 133 S-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCM 191
           + + +   +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V   +
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESVVSLI 254

Query: 192 LNVHP 196
           L   P
Sbjct: 255 LGSPP 259

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 258

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  +I +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++    +  +G F  ++  R  V   +L   P
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESVVSLILGSPP 256

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  V   +L   P
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 243

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYRESYLKSVWKDVTKALEKH-HIACILDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R + L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAIKILE-DNMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  D++  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVVEDCMLNVHP 196
             I++  + +  +G F  ++  R  +   +L   P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESIVSLILGSPP 253

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 67/163 (41%), Gaps = 35/163 (21%)

Query: 54  KSVWKDVTKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           ++VW +V +AL +   A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --IKILEDNMACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPFKGLKEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPE 214
            + G +K L  +      CM  V  I HI ++  + + A+ P+
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ 133

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 112  QAIKILEDNMA-CDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQ--- 167
            +A K++ED +A   ++    FV +K+   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 168  ---GNTVSAMGPFKGLKEVRRVV 187
                N +  +G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,823,273
Number of extensions: 1150828
Number of successful extensions: 3077
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3144
Number of HSP's successfully gapped: 46
Length of query: 344
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 234
Effective length of database: 40,868,139
Effective search space: 9563144526
Effective search space used: 9563144526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)