Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001401.5ON1041104146600.0
YCL061C (MRC1)1.5ON1096114311381e-137
NDAI0A001401.5ON1091114310731e-128
KNAG0C002201.5ON11619659221e-106
TPHA0E040101.5ON9656908334e-95
TBLA0A075701.5ON12527137804e-86
ZYRO0F18480g1.5ON9606807589e-85
Skud_3.31.5ON11525147597e-84
Smik_3.141.5ON11134677543e-83
Suva_3.1521.5ON11405267482e-82
TDEL0C069701.5ON9417837243e-80
SAKL0C00462g1.5ON11773756572e-70
CAGL0B00330g1.5ON11363845579e-58
KLTH0F00484g1.5ON9934744962e-50
KLLA0C00484g1.5ON9254304907e-50
AFR745W1.5ON10185254882e-49
Kwal_33.130051.5ON9706374836e-49
Ecym_10081.5ON11183344535e-45
Kpol_2002.81.5ON9855273177e-29
NCAS0B091101.5ON1020871326e-07
CAGL0A03696g3.517ON41556771.6
CAGL0K12562g8.34ON1682125772.2
TDEL0D00170singletonON33664752.9
KAFR0E043304.363ON20976708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00140
         (1041 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...  1799   0.0  
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   442   e-137
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   417   e-128
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   359   e-106
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   325   4e-95
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   305   4e-86
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   296   9e-85
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   296   7e-84
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   295   3e-83
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   292   2e-82
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   283   3e-80
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   257   2e-70
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   219   9e-58
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   195   2e-50
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   193   7e-50
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   192   2e-49
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   190   6e-49
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   179   5e-45
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   126   7e-29
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...    55   6e-07
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    34   1.6  
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    34   2.2  
TDEL0D00170 Chr4 complement(25816..26826) [1011 bp, 336 aa] {ON}       33   2.9  
KAFR0E04330 Chr5 (874109..874738) [630 bp, 209 aa] {ON} Anc_4.36...    32   8.8  

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score = 1799 bits (4660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 905/1041 (86%), Positives = 905/1041 (86%)

Query: 1    MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNNDPPALTGEGFLFDNPTLNRIKKRLD 60
            MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNNDPPALTGEGFLFDNPTLNRIKKRLD
Sbjct: 1    MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNNDPPALTGEGFLFDNPTLNRIKKRLD 60

Query: 61   GEEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRXXXXXXXXXXXXXXXRASKGQLH 120
            GEEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERR               RASKGQLH
Sbjct: 61   GEEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERREKQQLHEQQLELTKKRASKGQLH 120

Query: 121  AFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDVNQSTQVIHSATQDDTQ 180
            AFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDVNQSTQVIHSATQDDTQ
Sbjct: 121  AFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDVNQSTQVIHSATQDDTQ 180

Query: 181  VVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYSSSTQDYKTNKFNRHPT 240
            VVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYSSSTQDYKTNKFNRHPT
Sbjct: 181  VVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYSSSTQDYKTNKFNRHPT 240

Query: 241  PEDTQIIPREFDDDASTLPIPEGDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEI 300
            PEDTQIIPREFDDDASTLPIPEGDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEI
Sbjct: 241  PEDTQIIPREFDDDASTLPIPEGDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEI 300

Query: 301  QRELEESQKTKTIPEYKQHVRTPKNVIVFTXXXXXXXXXXXXXXXXXXXXXXXXXQKVQL 360
            QRELEESQKTKTIPEYKQHVRTPKNVIVFT                         QKVQL
Sbjct: 301  QRELEESQKTKTIPEYKQHVRTPKNVIVFTKESYFDEFDSDDEEKEENLESEGDSQKVQL 360

Query: 361  LKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDED 420
            LKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDED
Sbjct: 361  LKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDED 420

Query: 421  GIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIE 480
            GIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIE
Sbjct: 421  GIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIE 480

Query: 481  HQKEVIEKKGLNLEDIEKEKKIVENLLEQEXXXXXXXXXXXXXXXXXLADAQDDENDLDF 540
            HQKEVIEKKGLNLEDIEKEKKIVENLLEQE                 LADAQDDENDLDF
Sbjct: 481  HQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDENDLDF 540

Query: 541  DHSANXXXXXXXXXXXXAIDSDNDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQI 600
            DHSAN            AIDSDNDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQI
Sbjct: 541  DHSANELDESELSGEESAIDSDNDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQI 600

Query: 601  REEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDR 660
            REEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDR
Sbjct: 601  REEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDR 660

Query: 661  IRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYD 720
            IRLIEEKKQHEL              AKGITNFL          WHGIGGIDGEMSDEYD
Sbjct: 661  IRLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYD 720

Query: 721  SEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMXXXX 780
            SEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAM    
Sbjct: 721  SEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLEL 780

Query: 781  XXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFE 840
                    KQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFE
Sbjct: 781  SDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFE 840

Query: 841  PQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARS 900
            PQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARS
Sbjct: 841  PQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARS 900

Query: 901  MRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSI 960
            MRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPT            LLNSRVGTSSI
Sbjct: 901  MRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTDFDKENDDSFDDLLNSRVGTSSI 960

Query: 961  MKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQKKVANLSSSD 1020
            MKTFSATVDINDKFQEG                   ITYMGKMRKLVAPQKKVANLSSSD
Sbjct: 961  MKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVANLSSSD 1020

Query: 1021 IKNTNSRTSKLFSRQDESFES 1041
            IKNTNSRTSKLFSRQDESFES
Sbjct: 1021 IKNTNSRTSKLFSRQDESFES 1041

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  442 bits (1138), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 397/1143 (34%), Positives = 542/1143 (47%), Gaps = 213/1143 (18%)

Query: 1    MDGIFGNLQALKPKKRTT-YKKISDDL--ENDTSESN-----NDPPALTGEGFLFDNPTL 52
            MD     L +L  KKRTT YKK++  +  END +  N     ++PP LTG GFLF N TL
Sbjct: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATL 60

Query: 53   NRIKKRLDGEEKDVVQY------TMNFSQTQLISNLYGGGEDLDAPEVERRXXXXXXXXX 106
            NR+K RL+G++     +      + N   TQLISNLY GGE+L+  EV+           
Sbjct: 61   NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS 120

Query: 107  XXXXXXR--ASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDV 164
                  R   S  Q   F     ++ND +   PTQ+I    L                 V
Sbjct: 121  SFTQTQRIPVSIQQDKVFNVPIHSVNDGK---PTQLIKEDGL-----------------V 160

Query: 165  NQSTQVIHSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYS 224
            N+++Q +       T + + R     ATQ      A++Q    TQ  +SI   +Q I+ S
Sbjct: 161  NETSQALK------TPLTTGRPG---ATQRIDSSGATSQ----TQPIKSIEPQSQIITTS 207

Query: 225  SSTQDYKTNKF------------------NRHPTPEDTQI-IPREF---DDDASTLPIPE 262
            S+  +  + K                   NR P   DTQ+ +P +    +D    + IP+
Sbjct: 208  SNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP---DTQMDVPPQTAHDEDKTQAIGIPQ 264

Query: 263  GDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEIQREL--EESQKTKTI-PEYKQH 319
                   T    KTQID+  +  +    V  TLKI EIQ EL  E+S++ K    EYK+ 
Sbjct: 265  A------THQEQKTQIDTVAQ--TLQDEVPHTLKIREIQSELASEDSKREKARNVEYKKP 316

Query: 320  VRTPKNVIVFTXXXXXXXXXXXXXXXXXXXXXXXXXQKVQLLKNTSPSDKSNDGK----- 374
             +       F+                              L+N  P    ND +     
Sbjct: 317  QKPIPTKKFFSKESFLADFDDSSSNEDDDIK----------LENAHPKPVQNDDELHENK 366

Query: 375  ----RLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSD-DEDGIDRMGEKG 429
                 L D+TR +    P L   ++Y   LKR+++S + I L+LDSD DE G D M    
Sbjct: 367  SVELNLTDETRINEKRVPLL---SSYANNLKREIDSSKCITLDLDSDSDEYGDDDMDSIK 423

Query: 430  --------PISQMSKATVFDIKARLSKK------RPIVKISNDSKTTLHTLFNKLQKASR 475
                    PISQ+SKAT+ ++KARLSK+      RP    S D K   + L N L+KASR
Sbjct: 424  LSKDESVLPISQLSKATILNLKARLSKQNQKLSQRP--NKSKDPKVDHNVLLNTLRKASR 481

Query: 476  QQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEXXXXXXXXXXXXXXXXXLADAQDDE 535
            +QI++HQKEVIE KGL LED+ KEK+IVENLLEQE                       +E
Sbjct: 482  KQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKL------EE 535

Query: 536  NDLDFDHS--------------------ANXXXXXXXXXXXXAIDSDNDYDDFSLEKTKR 575
            ND   +                      A+              DS+ + D+  L++ K 
Sbjct: 536  NDFQLNAHDSGSDSGSESSGFALSGNEIADYESSGSENDNRRESDSEKEDDEIILKQKKS 595

Query: 576  SKKKVIV--EDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNLS-------- 625
               K I+   DSDTE+E       A+ +E+ D+SL + R AINLG YGDN+         
Sbjct: 596  HHVKHIINESDSDTEVE-------AKPKEKADESLPK-RIAINLGHYGDNIGEDTDKFQE 647

Query: 626  -----------LAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHELXX 674
                       +   R T E +   +  V+ E+ +    ++ +K++++L +++K+HE   
Sbjct: 648  TNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHE--- 704

Query: 675  XXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKAN 734
                         +G+TNF           WHGIGG DGE SD+YDS++EKMIDDYSK N
Sbjct: 705  -----AKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNN 759

Query: 735  FNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRR--KGAMXXXXXXXXXXXXKQYR 792
            FNP EIR+MLA ENKE DIKM+ KILYDIKNGGFR +R                  +QYR
Sbjct: 760  FNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYR 819

Query: 793  LKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTIT---T 849
            LKRRELMR++RLE+G+   LVKNPKS AFFESMV+DI+E KNPF   E + +  IT   T
Sbjct: 820  LKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGA-EEEYNLDITSTAT 878

Query: 850  DDGTQENA---NSNEGAASQNP----SKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMR 902
            D  TQ+N+     N G   Q P    +KKV++SE+FVQ++LSFL S+ + + F   + + 
Sbjct: 879  DLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELS 937

Query: 903  --AEANDELIEDLTALKKQSSIKSF----------KTTRASVSQEPTXXXXXXXXXXXXL 950
                 NDE IEDL  LK+ SSIKSF          KT    +  E               
Sbjct: 938  RIQHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTS 997

Query: 951  LNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQ 1010
            L       SI+K+F++  DINDKF+EG                   ITYMGK RKL+AP+
Sbjct: 998  LVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPK 1057

Query: 1011 KKV 1013
            +K 
Sbjct: 1058 RKT 1060

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  417 bits (1073), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 383/1143 (33%), Positives = 549/1143 (48%), Gaps = 154/1143 (13%)

Query: 1    MDGIFGNLQALKPKKRTTYKKIS----------DDLENDTSESNNDPPALTGEGFLFDNP 50
            MD +  +L+ +   ++TTY K S          D +  D +   N  P + G GFLF N 
Sbjct: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 51   TLNRIKKRLDGE---EKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRXXXXXXXXXX 107
            T+++++ RL G+   E++      +  +TQ+I+NLY  GEDL     E+           
Sbjct: 61   TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDL-----EKDLIKHIPVSQT 115

Query: 108  XXXXXRASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDVNQS 167
                    + QL    K + + ND   M PTQVIGST+   E     RT    V     +
Sbjct: 116  QPITNTGERTQLEQEIKVTID-NDSNEM-PTQVIGSTERDDE--TAERTQIGEV-----A 166

Query: 168  TQVIHSATQDDTQVVSAREADTQATQMTQVLSASTQGIY-----NTQETQSITDS--TQP 220
            TQ+I   T D T  +          Q TQ     TQ I      N  +T  I +S  + P
Sbjct: 167  TQLIPGDTYDRTSTM----------QKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVP 216

Query: 221  ISYSSSTQDYKTNKFNRH-----PTPEDTQIIPREFDD------DASTLPIPEGDKTQKD 269
             +++   ++++TN  N +      +   T +I    D+      DAS+  +         
Sbjct: 217  FTFTQKIKNFETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQ-------- 268

Query: 270  TSAVLKTQIDSTTEGTSYSATVSD-------TLKIHEIQRELEESQKTKTIPEYKQHVRT 322
             +A+  T  D     T+   TV+D        L IH+ Q+ELEE ++     +YK++   
Sbjct: 269  ATAIAATVRDDGPSSTALVGTVADDKLSSGSNLAIHKFQKELEEEEQLANNSKYKEYKGI 328

Query: 323  PK----NVIVFTXXXXXXXXXXXXXXXXXXXXXXXXXQKVQLLKNTSP---------SDK 369
             K    N++ FT                          K    +NTS          S  
Sbjct: 329  SKPILTNIVKFTKDSFLQGFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTA 388

Query: 370  SNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKG 429
            S+DG  +  K ++   F  KL+ L+ YE KLK  LNS  Q  L L SDDE   D      
Sbjct: 389  SSDGTTIKPKIKSPKKF-SKLNTLSRYENKLKTVLNSKNQ--LQLGSDDESS-DDTENSL 444

Query: 430  PISQMSKATVFDIKARLSKKRPIVKISNDS--KTTLHTLFNKLQKASRQQIIEHQKEVIE 487
            P+S+ SKAT+  IKARLSK++    +  D    T L+ LF  L+K+SR+QI+E+Q+E+IE
Sbjct: 445  PVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIE 504

Query: 488  KKGLNLEDIEKEKKIVENLLEQEXXXXXXXXXXXXXXXXXLADAQD----DENDLDFDHS 543
             KGLN EDIE EK++VENLLEQE                   +A D    +++D++FD S
Sbjct: 505  NKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKEREDKKNNANDSDSVNDSDVEFDLS 564

Query: 544  ANXXXXXXXXXXXXAIDSDNDYDDFS---LEKTKRSKKKVIVEDSDTEIEDEKMSHNAQI 600
            AN              +SD +  D S   +++    +++ I ED    I+DE +  N   
Sbjct: 565  ANEQEEQ---------ESDAELSDVSKPDIDEEVVYQRRNIDEDG---IQDEDVLDNVDA 612

Query: 601  RE------------------------EKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQ 636
             E                        E D+     RNAI+LG YGDNL+ A ++ + +  
Sbjct: 613  DEEEEEAPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTANVK-SQDDD 671

Query: 637  SGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXX 696
              +      E+ D +  E+ E++RI +IE +K                   KG+T F   
Sbjct: 672  DLEVDDDKNENLDTQPLELTEQERIDIIEAEKTKIKMQQEKMRHKEKEMMKKGVTKFFEM 731

Query: 697  XXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMV 756
                    WHGIGGIDGEMSDEYDS+VEKMIDDYSKANF+P+EIR+MLA ENKE D+ M+
Sbjct: 732  EAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMI 791

Query: 757  EKILYDIKNGGFRKRRKGAMX-XXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAE-TLVK 814
             KILYDIKNGGFRKR++G +             ++Y LKR+ELMR++RLE+G+ E  LVK
Sbjct: 792  NKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVK 851

Query: 815  NPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTI-----TTDDGTQENAN--SNEGAASQN 867
            NPKSKAFFESMV+DI + KN F   EP    +      T DD  +E+A      G + + 
Sbjct: 852  NPKSKAFFESMVEDITDDKNAFND-EPLGETSTQEINNTQDDMKEEDAAVVKENGDSKRI 910

Query: 868  PSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKT 927
              KK ++SEEFVQRTLSFL SS++ ++FA   ++  E +   +E+L +LK+QSSIK F++
Sbjct: 911  KKKKTIISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQS 970

Query: 928  TRASVSQEPTXXXXXXXXXXXXLLNSRVG---TSSIMKTFSATVDINDKFQEGXXXXXXX 984
               + S+                 +S +      SI+K+F +  DIN+KFQ+G       
Sbjct: 971  PSNNSSK--VIKLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTIS 1028

Query: 985  XXXXXXXXXXXXITYMGKMRKLVAPQKKVANLSSSDIKNTNSRT------SKLFSRQDES 1038
                        ITY+GK RKL+AP         S + + N  T        LFS  D+S
Sbjct: 1029 KSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGSLFSTGDDS 1088

Query: 1039 FES 1041
            FE+
Sbjct: 1089 FEN 1091

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  359 bits (922), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 312/965 (32%), Positives = 469/965 (48%), Gaps = 110/965 (11%)

Query: 126  SGNINDLRLMQPTQVIGSTQLAKE--FSPVSRTYF-------KYVPDVNQSTQVIHSATQ 176
            S  + D++L   T +  ST   ++  +SP S           + V    Q+TQVIHS TQ
Sbjct: 197  SRQLRDIKLQSTTHLPTSTSRTRQINYSPTSEGAIGGELLKTQTVNARTQATQVIHSDTQ 256

Query: 177  ----------------DDTQVVSAREADTQATQM-----TQVLSASTQGI----YNTQET 211
                             D+Q     + DTQ TQ+      Q++ A TQ       N Q T
Sbjct: 257  PTQLVDTDTQPTQIVDTDSQPTQIIDTDTQPTQLIDAQPAQIIDAETQPTQIIDTNAQPT 316

Query: 212  QSITDSTQPISYSSSTQDYKTNKFNRHPTPE-----DTQI----IPREFDDDASTLPIPE 262
            Q I   TQP    + + +         P P+      T +    IP      A T   P 
Sbjct: 317  QIIDPDTQPTQLINYSHESNGKHIPTLPAPDALLSTGTSLLGLNIPLHRYATAGTTSNP- 375

Query: 263  GDKTQKDTSAVLKTQIDST---TEGTSYSATVSD-------TLKIHEIQRELEESQKT-- 310
              K + D+  +++  I +     E   +  TV+D       TLKIHEIQ +++E  +   
Sbjct: 376  --KHKNDSQHIIEDNIATMRDRLETQEFQPTVADDVKSGGNTLKIHEIQTQIDEETRNML 433

Query: 311  KTIPEYKQHVRTPKNVIV-FTXXXXXXXXXXXXXXXXXXXXXXXXXQKVQLLKNTSPSDK 369
                E+++    P  V V FT                              + +T+P   
Sbjct: 434  NRGVEHRKSRGVPSRVEVRFTKESFMADFEESDSASDMESDSDQ-------INDTTPETG 486

Query: 370  SNDGKRLPDKTRTSPSFKPK---LHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMG 426
            S+      +K R  P+  PK   + GL++YE  L+ ++N D+ +DL  D D     +   
Sbjct: 487  SSQNSD-SNKAR-KPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGSD-DTYSSEEEYD 543

Query: 427  EKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVI 486
            ++  +SQ SKA V +IKA+  KK+ IVK +N +KTTL +LF+ L+K +RQQI+ HQ E+I
Sbjct: 544  KESKVSQASKAAVLNIKAKALKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEII 603

Query: 487  EKKGLNLEDIEKEKKIVENLLEQEXXXXXXXXXXXXXXXXXLADAQDDENDL-------- 538
              KG+N +D+E+EK+IVE+LLEQE                   +  D +N+         
Sbjct: 604  GTKGINHKDLEREKEIVEDLLEQEILRNKRLREREREREQKEEEQSDMDNNYSANELESF 663

Query: 539  -DFDHSA---NXXXXXXXXXXXXAIDSDND--YDDFSLEKTKRSKKKVIVEDSDTEIEDE 592
             D DH +   +             +DS+++  +  F + K K+ K   I  +SD+E E+ 
Sbjct: 664  DDSDHDSLNEDEPNINDDNNSSNGVDSEDEEEFAAFQVLKGKKRKNMQIQPESDSE-EET 722

Query: 593  KMSHNAQIR---EEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGD 649
              S++ ++    E K      N NAI+LG YG+NL +      TEK   K          
Sbjct: 723  VNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELNNTEKLDTKCM-------- 774

Query: 650  ERDEEIPEKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIG 709
                 + EK+  R +++++   +               KG++NF           WHGIG
Sbjct: 775  -----LDEKEHARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIG 829

Query: 710  GIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFR 769
            GIDGE+SDEYDSEVEKMIDDYS+A+ +P+EIR++L  ENKE D+KMV KIL+DIKNG FR
Sbjct: 830  GIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFR 889

Query: 770  KRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDI 829
            KR +  +            +QYR KR ELM+Q+ L++G+ + LVKN K+KAFF+S+V+DI
Sbjct: 890  KRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDI 949

Query: 830  VEVKNPFAVF----EPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSF 885
            VEVKNPF V           T T D  T+E+ ++ E   +Q   KK +LSEEFVQR+LSF
Sbjct: 950  VEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSF 1009

Query: 886  LNSSKDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXX 945
            LNS++++ +F   + +    +D+ + DL  LKKQSS+KSFK+     S+           
Sbjct: 1010 LNSNRNLTEFEQNQDLARLQHDDDVSDLYTLKKQSSVKSFKSVG---SKNEIINVDANDN 1066

Query: 946  XXXXLLNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRK 1005
                +  +     SI+K+F++ ++++DKF+ G                   +TYM K+RK
Sbjct: 1067 SGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRK 1126

Query: 1006 LVAPQ 1010
            L AP+
Sbjct: 1127 LTAPK 1131

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (59%), Gaps = 16/104 (15%)

Query: 1   MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNND----PPALTGEGFLFDNPTLNRIK 56
           MD +     ++K K+RTTYKK+    +N T E+  D    P +L G GFLF N T+++IK
Sbjct: 1   MDDLLERFNSVKVKRRTTYKKVQ---QNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIK 57

Query: 57  KRLDGEEK-----DVVQYT----MNFSQTQLISNLYGGGEDLDA 91
            RL+ E+      DV + +    +  SQ+QL+S LY GGEDL++
Sbjct: 58  NRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLES 101

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  325 bits (833), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 251/690 (36%), Positives = 349/690 (50%), Gaps = 83/690 (12%)

Query: 390  LHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKK 449
            ++GL NYE  L+R+ N++Q I+ +   +D D         P S  SKA + +I+A  SK+
Sbjct: 320  INGLGNYEHNLRRKANNEQIIEFSESDEDSDT-----NISP-SYASKAVILNIRANKSKQ 373

Query: 450  RPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQ 509
            +P V   +D +TTL  L+N L++AS++QI+ +QKE++EKKG+NLE++EKE +IVENLLEQ
Sbjct: 374  QPKVSQKSD-QTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQ 432

Query: 510  EXXXXXXXXXXXXXXXXXLADAQDD--ENDLDFDHSANXXXXXXXXXXXXAIDSDN---- 563
            E                   + QDD   N  +FD SAN            A  ++N    
Sbjct: 433  EIARNQKIRQREKQKQKK--ENQDDLNSNPEEFDLSANELEDSDIPGSDFAESNNNSEKD 490

Query: 564  ----------------------DYDDFSLEKTKRSKKKV-IVEDSDTEIEDEKMSHNAQI 600
                                  D +D      KR  KK  IV+DSD+EIE       AQI
Sbjct: 491  DEEEENDEEEEDEQEDAPKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIE-------AQI 543

Query: 601  REEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSR-----ESGDERDEEI 655
             + K+       N I+LG YGDN+         E +        R       G  + +E+
Sbjct: 544  VDSKE---IITANTIDLGHYGDNIIQQSRETLNETEESDEEDEERYNAIISEGIRKQKEL 600

Query: 656  PEKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEM 715
             +++  RL E K                     G++             WHGIGG+D + 
Sbjct: 601  EKREAKRLKEMK-------------------TSGVSKMFEVEAEESEDEWHGIGGVDSDF 641

Query: 716  SDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGA 775
            SD YDSEVEKMIDDYS+ NFNP EIR+MLA ENKETD+ +V KILYDIKNGGFR R++  
Sbjct: 642  SDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRD 701

Query: 776  MXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNP 835
                         K YR KRR LMR+KRL++   + +VKNPKSKAFFES+VDDI+E KNP
Sbjct: 702  RDLEFSDDDDDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNP 761

Query: 836  F-----AVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSK 890
            F     ++ +     T T D    E   +N     +    K+++SEEFVQR+LSFLNS +
Sbjct: 762  FDDMNTSIEQIVEKETPTVDIDNDEKLATNVTKKKK----KIVISEEFVQRSLSFLNSCR 817

Query: 891  DMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXL 950
            + D+F                DL  LK+ SSIK+ ++  +S S                 
Sbjct: 818  EQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGS 877

Query: 951  LNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQ 1010
            L + +  +S++ +FS+ VDIN KF+EG                   ITYMG  R+LVAP+
Sbjct: 878  LFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPK 937

Query: 1011 KKVANLSSSDIKNTNSRTSKLFSRQDESFE 1040
            K  + L++S   N+ +  S+LF  Q+ SFE
Sbjct: 938  K--SRLTTSSKANSRTTPSRLFDNQEGSFE 965

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 56/115 (48%), Gaps = 27/115 (23%)

Query: 1   MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNN--------DPPALTGEGFLFDNPTL 52
           MD +F  L   K KKRTTY KI  DL  +  ES +        +   L G G LF N  L
Sbjct: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDG-GILFGNSIL 58

Query: 53  NRIKKRL---DGEEKDVVQ--------------YTMNFSQTQLISNLYGGGEDLD 90
            +I+ RL   D E+KD  +               T  F QTQ+I+NLY GGEDL+
Sbjct: 59  GQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLE 113

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  305 bits (780), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 251/713 (35%), Positives = 346/713 (48%), Gaps = 108/713 (15%)

Query: 393  LNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPI 452
            L+ YE +LK  L  +  IDL  DS++    D +      S  SKA + DI+ +LSKK+P 
Sbjct: 580  LSQYENRLKENLLYNNSIDLYSDSEENTQSDIL-----FSTASKAQILDIRHKLSKKKPQ 634

Query: 453  VKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQE-- 510
            VK     +T L  LFNKL+KAS++QI +HQK  IE KGL LED++KEK+IVENLLEQE  
Sbjct: 635  VKKKT-IQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLLEQEIE 693

Query: 511  ------XXXXXXXXXXXXXXXXXLADAQDDENDLDFDHSANXXXXXXXXXXXXAIDSDND 564
                                   +  A D++   DFDHSAN                D+ 
Sbjct: 694  RNRKIRAKERKRENKKNKVDDKSVQSASDED---DFDHSANELE-------------DSF 737

Query: 565  YDDFSLEKTK---------------RSKK--KVIVEDSDTE----IEDEKMSHNAQIREE 603
            Y+D    K                 R KK  K++ E+SD+E    +E EK+  N      
Sbjct: 738  YNDSDENKEIIEPEEEDSEDDINIFRHKKGLKLVTEESDSENDNPLESEKIPINP----- 792

Query: 604  KDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRE------SGDERDEEIPE 657
                     N INLG YGDNL     + T   ++ K F    E      S +  + E+ E
Sbjct: 793  ---------NIINLGHYGDNLDS---KSTIFNENSKKFIEDIEQFEADNSTENSNNELNE 840

Query: 658  KDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSD 717
             +  R I+++ + +                 G +             W GIGG DGE+SD
Sbjct: 841  LEYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSD 900

Query: 718  EYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMX 777
            EYDSEVEK+IDDYS+ +FNPDEIR  L +ENKE DIKMV +ILYDIKNGGFRKR +  + 
Sbjct: 901  EYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNID 960

Query: 778  XXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFA 837
                       ++YR+KRRE+M++KRLEV   + ++K  KSKAFF SMVDDIVE  NPF 
Sbjct: 961  LELSDDEDDELREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFM 1020

Query: 838  VFEPQRSGTITTDDGTQENANS----------------NEGAASQNPSKKVMLSEEFVQR 881
            + +P    +   +  +  N N                 +    SQ+  KK ++SE+FV +
Sbjct: 1021 ITQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHK 1080

Query: 882  TLSFLNSSKDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXX 941
            TLSFL  SK++++F        ++    I D+ +LK++SSIK+     + +SQ+      
Sbjct: 1081 TLSFLTKSKEVNEFQHVNE-HYKSQIGTINDIQSLKQKSSIKTMHVL-SMMSQDTNVDLD 1138

Query: 942  XXXXXXXXL--------------LNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXX 987
                    +              L+S     SI+K F +T DINDKF++G          
Sbjct: 1139 ASDKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSY 1198

Query: 988  XXXXXXXXXITYMGKMRKLVAPQKKVANLSSS-DIKNTNSRTSKLFSRQDESF 1039
                     IT  G+ RKLVAP K   N + +      +S  SKLF  QD+SF
Sbjct: 1199 KTVGGMKTSITSFGR-RKLVAPVKTHNNFNKNRISNIKSSSNSKLFRNQDKSF 1250

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 1  MDGIFGNLQALKPKKRTTYKKISDDLEND-----TSESNNDPPALTGEGFLFDNPTLNRI 55
          MD +F +L  LK KKRTTYKK+ + +  +     T+ SN  P     EGFLF N  L +I
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLEKI 62

Query: 56 KKRLD 60
          K RL+
Sbjct: 63 KNRLN 67

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  296 bits (758), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 238/680 (35%), Positives = 347/680 (51%), Gaps = 83/680 (12%)

Query: 396  YELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKI 455
            YE KLK +L+S + I L+ D D+         + P+S++SKATV DIKAR SK+ P+ KI
Sbjct: 330  YEYKLKGELDSKRCIQLDDDEDES----DEDVEVPLSRVSKATVLDIKARRSKQEPLSKI 385

Query: 456  SNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEXXXXX 515
                KTTL+ L   L+KAS++QI +HQ E+++ +G  LEDIEK+K+ +ENLLEQE     
Sbjct: 386  KQ-KKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNK 444

Query: 516  XXXXXXXXXXXXLADAQDDENDLDFDH--SANXXXXXXXXXXXXAIDSDND---YDDFSL 570
                          + +D+ NDL+     S N            + DS++D    DD + 
Sbjct: 445  RLARRE--------NEEDNSNDLEDRSYGSGNESENSAFSDIEFSGDSESDDGQEDDMNN 496

Query: 571  EKTKRSKKKVI-VEDSDT-------------------EIEDEKMSHNAQIREEKDDSLFQ 610
            +  +  K+K+    DSD                      ++ KM        E DD+L  
Sbjct: 497  DDERVQKEKMQEAGDSDNISAREDHSDEEDEDSIQKGRTKNHKMLPAEDSDSEHDDTL-- 554

Query: 611  NRNAINLGPYGDNLSL--------APIRITTEKQSGKNFKVSRESGDERDEEIPEKDR-I 661
             RN I+LGPYG+NL +         P+  + E  + +  K         +E I EK R I
Sbjct: 555  PRNIIDLGPYGNNLQVNHEEDMENLPLSDSAEIDAAEEEKT--------NELIMEKIRKI 606

Query: 662  RLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDS 721
             + ++KK+  L              AKG+   L          W G+GG+DG++SDE+DS
Sbjct: 607  EMRKKKKEQRLKDMK----------AKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDS 656

Query: 722  EVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMXXXXX 781
            ++E+MIDD++K+N N D++RQ+LA ENKE D KMV KILYDIKNGGFRKR + A+     
Sbjct: 657  DLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELS 716

Query: 782  XXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEP 841
                   + YRLKRRELM++ R+E  + E   +N KSKAF ESMVDDI E KNPF   +P
Sbjct: 717  DDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFG--DP 774

Query: 842  QRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSM 901
            +      TD  TQEN         +N  K   LS+EFVQR+LSFL+++    +F     +
Sbjct: 775  EMDVEDNTDVDTQEN------DYPKNKEKNT-LSQEFVQRSLSFLSNNNSSREFELGEQI 827

Query: 902  RAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIM 961
                ++E  +D+++LK+ SSI +   + + + ++              L N +    S++
Sbjct: 828  TL-GDEE--QDVSSLKRNSSIHALHNSSSPIKED--LEKENQDEDFITLPNFK--PPSLI 880

Query: 962  KTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQKKVANLSSSDI 1021
            K+ +   D N+KFQ G                   ITY GKMRKLV P+ + + LS    
Sbjct: 881  KSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPR 940

Query: 1022 KNTNSRTSKLFSRQDESFES 1041
              +     KL+  Q  SF++
Sbjct: 941  PASKPTMGKLWESQQNSFDT 960

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 103/231 (44%), Gaps = 34/231 (14%)

Query: 1   MDGIFGNLQALKPKKRTTYKKISDDLENDTSE--SNNDPPALTGEGFLFDNPTLNRIKKR 58
           MD +   L  L  K+RTTYKK+ +  E + ++  SN+ PP + G GFLF N T+++++ R
Sbjct: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60

Query: 59  L----DGEEK-------DVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRXXXXXXXXXX 107
           L    DG  K          +     +QTQ+I++LY G E+L+    ER           
Sbjct: 61  LRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKER----VRLPLSK 116

Query: 108 XXXXXRASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPD---V 164
                   K Q+  +              PT V G     ++ + +     + VP+    
Sbjct: 117 KTSSASQEKTQVIPWA-------------PT-VEGVENNVEQGTDIHEEKTQQVPNEISY 162

Query: 165 NQSTQVIHSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQSIT 215
           +Q TQ I S  Q + + ++ R ++ + T      +A+++   +TQE   IT
Sbjct: 163 DQKTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAATSEDQLDTQEQNPIT 213

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  296 bits (759), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 206/514 (40%), Positives = 278/514 (54%), Gaps = 49/514 (9%)

Query: 570  LEKTKRSKKKVIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDN------ 623
            L K K    K ++ +SD+EIE E+     +++  K       RNAI+LG YGDN      
Sbjct: 646  LNKKKSYHVKHVINESDSEIETEQ-----KMKVSKKFDATPKRNAIDLGHYGDNIDEEAS 700

Query: 624  --------LSLAPI-RITTEKQSGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHELXX 674
                    L+   I  I  +  + +N +      D  DEE+ E  R  LI++KK      
Sbjct: 701  NSFEEATTLNTQKIDNIIIKTHTIENREEEEVENDSIDEEVSEAIRRELIDKKKSQLRQK 760

Query: 675  XXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKAN 734
                        +KGITNF           WHG+GG DGE S+EYDSEVEKMIDDYSK +
Sbjct: 761  EKKHVAELKEFKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNS 820

Query: 735  FNPDEIRQMLADENKETDIKMVEKILYDIKNGGFR-KRRKGAMXXXXXXXXXXXXKQYRL 793
            FN  EIR+MLA ENKE D+KM+ +ILYDIKNGGFR KR K ++            +QYRL
Sbjct: 821  FNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRL 880

Query: 794  KRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEP--QRSGTITTDD 851
            KRRELMR++RLE+G+   LVKNPKSKAFFESMV+DI+E KNPF   E   Q   +  TD 
Sbjct: 881  KRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDL 940

Query: 852  GTQENANSNEGAASQN--------PSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARS--- 900
             TQ+N +   G +++N         SKK ++SE+FVQ++LSFL S+ + D+F   +    
Sbjct: 941  DTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEFEMDKERAR 999

Query: 901  MRAEANDELIEDLTALKKQSSIKSFKTTRA-SVS----------QEPTXXXXXXXXXXXX 949
            ++ +  DE +EDL  LK+ SSIKSF  +   S+S          ++PT            
Sbjct: 1000 IQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPS 1059

Query: 950  LLNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAP 1009
            L+       SI+K+F++  DINDKF+EG                   ITYMGK RKL+AP
Sbjct: 1060 LIGG-FKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAP 1118

Query: 1010 QKKV--ANLSSSDIKNTNSRTSKLFSRQDESFES 1041
            +KK    +  +   K   ++ SKLF    +SF+S
Sbjct: 1119 KKKADRDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152

 Score =  143 bits (360), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 173/575 (30%), Positives = 260/575 (45%), Gaps = 121/575 (21%)

Query: 1   MDGIFGNLQALKPKKR-TTYKKISDDLENDTSE------SNN--DPPALTGEGFLFDNPT 51
           MD +   L +L  KKR TTYKKI+  + +   +      SNN   PPALTG GFLF N T
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 52  LNRIKKRLDG-------------EEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRX 98
           LNR+K RL+G             E +D V        TQLI+NLY GGEDL+        
Sbjct: 116 LNRVKNRLEGIDVPEDDRQIKDNENEDAV-------STQLIANLYDGGEDLE-------- 160

Query: 99  XXXXXXXXXXXXXXRASKGQLHAFTKS--------SGNINDLRLMQPTQVIGSTQLAK-- 148
                          + K  + AFT++        S N+ D+    P   I   + A+  
Sbjct: 161 ------ETKSMGDNASLKDGIAAFTQTQRIPVSIQSENVVDV----PIHSINQGKSARII 210

Query: 149 ----EFSPVSRTYFKYVPDVNQSTQVIHSATQDDTQVVSAREADTQATQM--TQVLSAST 202
                FS  ++T  K +P    + ++I  ATQ     + +R+  +Q  Q+  T+ +   T
Sbjct: 211 RDDGFFSTAAQTQ-KIIP---ATARIIPVATQR----IHSRDTASQTQQVPFTKPIEPQT 262

Query: 203 QGIYNTQETQSITDSTQPISYSSSTQDYKTNKFNRHPTPEDTQII----PREFDDDASTL 258
           Q I  T           P+  + ++  ++T       TP+    I    P + + D    
Sbjct: 263 QIIGTTANDSDTQPLRIPVLTAEASLLFQT-------TPDCVPTIRMDPPSQIEHDKYKT 315

Query: 259 PIPEGDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEIQRE--LEESQKTKTI-PE 315
            +    +T  D     KTQ+D+  +  +    VS TLKI E+Q E  LE+S++ K    E
Sbjct: 316 QLDTMTQTAHDEG---KTQVDTMPQ--TIHDDVSHTLKIRELQSELALEDSKREKARNVE 370

Query: 316 YKQHVRTPKNVIVFTXXXXXXXXXXXXXXXXXXXXXXXXXQKVQLLKNTSPSDKSNDGKR 375
           YK+  R    +I F+                          K Q   N    +K ++   
Sbjct: 371 YKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEVHENKPSE--- 427

Query: 376 LPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDL----------------NLDSDDE 419
            P+  + S      +  L++Y   LKR+++S + I L                N+   DE
Sbjct: 428 -PNSVKNSRESYKNVPLLSSYANNLKREIDSSKCIILDLDSDSDDDGDDYMGGNMSIKDE 486

Query: 420 DGIDRMGEKGPISQMSKATVFDIKARLSKK-RPIVKISN---DSKTTLHTLFNKLQKASR 475
             +       PIS++SKA + ++KARLSK+ + + ++ N    +K   + LFN L+KASR
Sbjct: 487 SAL-------PISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASR 539

Query: 476 QQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQE 510
           +QI++HQ+EVIE KG  LED+ KEK+IVENLLEQE
Sbjct: 540 KQILDHQREVIETKGFKLEDMAKEKEIVENLLEQE 574

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  295 bits (754), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 193/467 (41%), Positives = 248/467 (53%), Gaps = 45/467 (9%)

Query: 591  DEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNL--------------SLAPIRITTEKQ 636
            DE  S N  + +EK D+    R AINLG YGDN+              +    +IT E+ 
Sbjct: 621  DESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDMNTQQTDKITMERN 680

Query: 637  SGKNFKVSRESG----DERDEEIPEKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITN 692
              +N  +  ++     D  +EE  E  R  LI+++K                   KG+TN
Sbjct: 681  IVENKAILEDTAVVDEDNINEEADEAIRRELIDKEKLQLRQKELEKAIKLKELKHKGVTN 740

Query: 693  FLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETD 752
            F           WHGIGG DGE SDEYDS+VEKMIDDYSK NFN  EIR+MLA ENKE D
Sbjct: 741  FFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMD 800

Query: 753  IKMVEKILYDIKNGGFR-KRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAET 811
            +KM+ KILYDIKNGGFR KR K ++            +QYRLKRRELMR++RLE+G+   
Sbjct: 801  VKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDGTK 860

Query: 812  LVKNPKSKAFFESMVDDIVEVKNPFAVFEP--QRSGTITTDDGTQEN--------ANSNE 861
            LVKNPKSKAFFESMV+DI+E KNPF   E   Q   +  TD  T +N          +NE
Sbjct: 861  LVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNE 920

Query: 862  GAASQNPSKKVMLSEEFVQRTLSFLNSSK----DMDQFAPARSMRAEANDELIEDLTALK 917
                 + SKK+++SE+FVQ++LSFL S+     +MD+      M+   +DE IEDL  LK
Sbjct: 921  KGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDK--ELAKMQHGNDDEPIEDLFTLK 978

Query: 918  KQSSIKSF----------KTTRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSAT 967
            + SSIKSF          +T    +  E               L S     SI+K+F++ 
Sbjct: 979  QHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASR 1038

Query: 968  VDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQKKVA 1014
             DINDKF+EG                   ITYMGK RKL+AP++K  
Sbjct: 1039 TDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKRKAG 1085

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (75%), Gaps = 8/87 (9%)

Query: 430 PISQMSKATVFDIKARLSKK------RPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQK 483
           PISQ+SKAT+ ++KARLSK+      RP+     D++   + LFN L+KASR+QI++HQ+
Sbjct: 448 PISQLSKATILNLKARLSKQNQDISQRPLE--GRDARLDHNKLFNTLRKASRKQILDHQR 505

Query: 484 EVIEKKGLNLEDIEKEKKIVENLLEQE 510
           EVIE KG  LED+ KEK++VENLLEQE
Sbjct: 506 EVIETKGFKLEDMVKEKELVENLLEQE 532

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 66/112 (58%), Gaps = 29/112 (25%)

Query: 1   MDGIFGNLQALKPKKR-TTYKKISDDL--ENDTSESN---ND---PPALTGEGFLFDNPT 51
           MD     L +L+ KKR TTYKK++  +  +ND ++ N   ND   PPALTG GFLF N T
Sbjct: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 52  LNRIKKRLDG-------------EEKDVVQYTMNFSQTQLISNLYGGGEDLD 90
           LNR+K RL+G             E++DV       S +QLI+NLY GGEDL+
Sbjct: 61  LNRVKNRLEGGKAPEQEHDNKDDEDEDV-------SSSQLIANLYEGGEDLE 105

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  292 bits (748), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 205/526 (38%), Positives = 277/526 (52%), Gaps = 62/526 (11%)

Query: 572  KTKRSKKKVIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNLSL----- 626
            K K  + K I+++SD+E+EDE+     ++  EK+      RNAI+LG YG+N+ +     
Sbjct: 621  KKKPYRTKHILDESDSEVEDEQ-----KMEVEKNVENVPKRNAIDLGHYGNNIDVDGSNS 675

Query: 627  --API--------RITTEKQS---------------GKNFKVSRESGDERDEEIPEKDRI 661
              A I         ITT+ ++                 N        D+ D+E+ E  R 
Sbjct: 676  FQAAIVLDTQQVGEITTQTKTTEHEDDEGEEEKEETDDNDDDDDNDDDDNDDEVSEAIRR 735

Query: 662  RLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDS 721
             LI+ +K                  +KG+TNF           WHG+GG DGE SDEYDS
Sbjct: 736  ELIDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDS 795

Query: 722  EVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFR-KRRKGAMXXXX 780
            EVEKMIDDYSK  FN  EIR+MLA ENKE D+KM+ KILYDIKNGGFR KR K ++    
Sbjct: 796  EVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELEL 855

Query: 781  XXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFE 840
                    +QYRLKRRELMR++RLE+G+   LVKNPKSKAFFESMV+DI+E KNPF   +
Sbjct: 856  SDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEK 915

Query: 841  P--QRSGTITTDDGTQENANSNEGAASQN---------PSKKVMLSEEFVQRTLSFLNSS 889
               Q   +  TD  TQ+N N+  G  + N          SKK+++SE+FVQ++LSFL S+
Sbjct: 916  ESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN 975

Query: 890  KDMDQFAPARSMR--AEANDEL-IEDLTALKKQSSIKSF----------KTTRASVSQEP 936
             + D+F   R +      N E  + DL  LK+ SSIKSF          +T    ++ E 
Sbjct: 976  -NYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEE 1034

Query: 937  TXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXX 996
                          L       S++K+F++  DINDKF+EG                   
Sbjct: 1035 HTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKAS 1094

Query: 997  ITYMGKMRKLVAPQKKV-ANLSSSDIKNTNSRTSKLFSRQDESFES 1041
            ITYMGK RKL+AP++K   N   + IK + ++ SKLF    +SF+S
Sbjct: 1095 ITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140

 Score =  149 bits (377), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 173/563 (30%), Positives = 256/563 (45%), Gaps = 114/563 (20%)

Query: 1   MDGIFGNLQALKPKKR-TTYKKISDDL--ENDTSESN------NDPPALTGEGFLFDNPT 51
           MD     L +L  KKR TTYKK++  +  EN  ++ N      N PPALTG GFLF N T
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103

Query: 52  LNRIKKRLDG-------------EEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRX 98
           LNR+K RL+G             E++DV      FS TQLI+NLY GGE     E+E + 
Sbjct: 104 LNRVKNRLEGRNELGQDGQDKENEDEDV------FS-TQLIANLYDGGE-----ELESKS 151

Query: 99  XXXXXXXXXXXXXXRASKGQLHAFTKSSGNIN----DLRLMQPTQVIGSTQLAKEFSPVS 154
                           ++    + T+ +  IN     +   +PTQ   +       S   
Sbjct: 152 NGDKNNQKVNVSSFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQ 211

Query: 155 RTYFKYVPDVNQSTQVI--HSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQ 212
              F       ++TQ +  H AT    Q+   + ++ Q    TQ   A+       Q+  
Sbjct: 212 AIPFTTAQITQKTTQCLNNHGATSQTQQIPPTKPSEAQ----TQADVATANDSDTQQKVP 267

Query: 213 SITDSTQPISYSSSTQDYKTNKFNRHPTPEDTQIIPREFDDDASTLPIPEGDKTQKDTSA 272
            +T  T P+  +   Q   T      PT  D                    D+TQ DT  
Sbjct: 268 MLTTETSPLFQTVPDQSPSTQMNTPPPTVHD--------------------DRTQMDT-- 305

Query: 273 VLKTQIDSTTEGTSYSATVSDTLKIHEIQREL---EESQKTKTIPEYKQHVRTPKNVIVF 329
           V +T  D           V  TLKIHE+Q EL   + ++K     EY++  +T   V  F
Sbjct: 306 VAQTMQDK----------VPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRF 355

Query: 330 TXXXXXXXXXXXXXXXXXXXXXXXXXQKVQLLKNTSPSDKSNDGKRLPDKTRTSPSFKP- 388
           +                              L+++ P  + N G  + D ++++P  +P 
Sbjct: 356 SKESFLADFDNSSSDEDTNFK----------LESSQPKQQQN-GYEMIDISQSNP--QPA 402

Query: 389 --------KLHGLNNYELKLKRQLNSDQQIDLNLDS------DDEDGIDRMGEKG---PI 431
                   K+  L+ Y   LKR+++S + I L+LDS      D+    D++ E     PI
Sbjct: 403 EKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPI 462

Query: 432 SQMSKATVFDIKARLSKK-RPIVKISN---DSKTTLHTLFNKLQKASRQQIIEHQKEVIE 487
           SQ+SKAT+F++KARLSK+ + + + SN   D K+  + L N L+KASR+QI++HQ+E++E
Sbjct: 463 SQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVE 522

Query: 488 KKGLNLEDIEKEKKIVENLLEQE 510
            KG  LED+ KEK+IVE+LLEQE
Sbjct: 523 TKGFKLEDMVKEKEIVEDLLEQE 545

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  283 bits (724), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 256/783 (32%), Positives = 373/783 (47%), Gaps = 109/783 (13%)

Query: 295  LKIHEIQRELEESQKTKTIPEYKQHVRTPKNVIVFTXXXXXXXXXXXXXXXXXXXXXXXX 354
            LKIHEI+       +T+T  E+K   R P+ + VFT                        
Sbjct: 230  LKIHEIEEMWSREVQTET-KEHKVKYRAPRPLKVFTKEAFMQDFDKSSDSDSD------- 281

Query: 355  XQKVQLLKNTSPSDKSNDG---------KRLPDKTRTSPSFKPKLHGLNNYELKLKRQLN 405
                Q +K TSP  ++ND          K L DK+  +         L  Y+ +LK +  
Sbjct: 282  -VFDQEIKATSPIGRNNDSISEVGTSDVKVLKDKSSGA---------LTAYQRELKEKAE 331

Query: 406  SDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHT 465
              + + L  +SDDE+ +         S  +KATV  +KARLSK+RP V+ S   K +L  
Sbjct: 332  IAKGVMLLSESDDEEDL-----AVSTSHEAKATVLKLKARLSKRRPPVE-SQHGKASLSA 385

Query: 466  LFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEXXXXXXXXXXXXXXX 525
            L   L+ ++++QI++ QKE IE++GL  ED+EKEK+IVENLLEQE               
Sbjct: 386  LMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKA 445

Query: 526  X-----XLADAQDDENDLDFDHSANXXXXXXXXXXXXAIDSDNDYDDFSLEKTKRSKKKV 580
                   LA     E D D ++S +             I  D DY D   + +  ++ K+
Sbjct: 446  QMNDVPSLALPNRVEEDNDSNYSVSDEDS--------VIKEDLDYSDLESDDSGSNEPKI 497

Query: 581  IVEDSDTEIEDE------------KMSHNAQIREEKDDSLFQNRNAINLGPYGDNLSLAP 628
              + +  EI+ +            K+S       E+++ L  N +AINLG YGDNL    
Sbjct: 498  ASDSAGVEIDSDEDDIRFMKGKAHKISLLNDDESEEEEDLTVN-SAINLGAYGDNL---- 552

Query: 629  IRITTEKQSGKNFKVSRESGDERDEEIPE---------KDRIRLIEEKKQHELXXXXXXX 679
              ITT K        + E   +   EI E         K +IR  EEK++          
Sbjct: 553  --ITTTKDEAHT--SAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQR---------- 598

Query: 680  XXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDE 739
                     G+TN            W G+GG+DGE  D+YDS++EKMIDD+S    N D+
Sbjct: 599  --LKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQ 656

Query: 740  IRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMXXXXXXXXXXXXKQYRLKRRELM 799
            IRQ+L  ENKETD+K V KIL+DIKNGGFRKRR+  +              Y+ ++ ELM
Sbjct: 657  IRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELM 716

Query: 800  RQKRLEVG-EAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENAN 858
            R++RL+ G + + L+KN +SKAFFESMV+DI+++K+PF           +    T E   
Sbjct: 717  RKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPF-----------SNQAETSEKDK 765

Query: 859  SNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPAR-SMRAEANDELIEDLTALK 917
             +EG    +  +K  +S EFVQ++LSFL+SS+D  +F  AR S   E N     DL +LK
Sbjct: 766  KSEGLVDASNKQKDTISHEFVQQSLSFLSSSRDFSEFEVARVSQEGERN----TDLNSLK 821

Query: 918  KQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVDINDKFQEG 977
            + S++K+       +S+               +L      SS++K+F   ++ NDK +EG
Sbjct: 822  QDSTVKTLYAPSNIISE---SERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEG 878

Query: 978  XXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFSRQDE 1037
                               ITY+GKMRKLVAP+K  A + ++  K +    SK+F   + 
Sbjct: 879  RKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTS-KLSTLGNSKIFRNFES 937

Query: 1038 SFE 1040
            SFE
Sbjct: 938  SFE 940

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 1  MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNNDPPALTGEGFLFDNPTLNRIKKRLD 60
          MD +F +      K+R TY+K   + +++ +E    PPA+ G GFLF++ TL+++K RL+
Sbjct: 1  MDKLFESFDNAIKKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLN 60

Query: 61 GEEKDVVQYTMNFSQTQLISNLYGGGEDLD 90
             KD  Q T     TQ++SNLY  GEDL+
Sbjct: 61 ---KDQEQGTQAIDTTQVLSNLYEDGEDLE 87

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  257 bits (657), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 212/375 (56%), Gaps = 31/375 (8%)

Query: 688  KGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADE 747
            KG++             WHG+GG DGE+SDEYDSE+EKM+DDY+K  F+P EIRQMLA E
Sbjct: 813  KGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAE 872

Query: 748  NKETDIKMVEKILYDIKNGGFRKRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVG 807
            +KE D K+V KIL+DIKNGGFR+R KGA+            ++Y  KRREL+RQK LE G
Sbjct: 873  DKEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQRYHAKRRELLRQKVLENG 932

Query: 808  EAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQ--RSGTITTDD--------GTQENA 857
            EA  LV NPKS AFFESMV+D+VE KNPF++ E     SG I+ +D        GTQ +A
Sbjct: 933  EASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAISENDKVDNASEHGTQPDA 992

Query: 858  NSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMD-QFAPAR-------SMRAEANDEL 909
                G   +   K++ +S+EFVQR+LSFLNS  ++D +F   R       S   + ND+L
Sbjct: 993  G---GQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDL 1049

Query: 910  IEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVD 969
             EDL  LK+ S IK+  T   + S+                L       S++ +FS+ +D
Sbjct: 1050 -EDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNSPANGFKL------PSVISSFSSRID 1102

Query: 970  INDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQKKVAN---LSSSDIKNTNS 1026
            IN+KF+EG                   ITY+GK+RKL AP++K +    +          
Sbjct: 1103 INEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAP 1162

Query: 1027 RTSKLFSRQDESFES 1041
            + + LF+  D+SFE+
Sbjct: 1163 KRAGLFADNDDSFEA 1177

 Score =  107 bits (266), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 134/276 (48%), Gaps = 58/276 (21%)

Query: 393 LNNYELKLKRQLNSDQQIDLNLDSD-DEDGIDRMGEKGPISQMSKATVFDIKARLSKKRP 451
           LN+Y+ +LK +L+S + IDL+  SD DE+ +       P S+MSKA V +IKAR SK++ 
Sbjct: 412 LNSYKNQLKARLDSKEHIDLDSSSDEDENSV-------PASKMSKAAVLEIKARTSKRQG 464

Query: 452 IVKISNDSKT----TLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLL 507
           I K      T    +L  LF+ L+KA+++QI++H++E+ EK+GLNLEDIE+EKK VENLL
Sbjct: 465 IKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLL 524

Query: 508 EQEXXXXXX--XXXXXXXXXXXLADAQDDENDLDFDHSANX---------XXXXXXXXXX 556
           EQE                   L + QD     DFD+S N                    
Sbjct: 525 EQEIERNRKIRLREKQREKKKELDEQQDGGYPGDFDYSENELDGEPESEPASGSEDVPDS 584

Query: 557 XAIDS---DNDYDDFS--------------LEKTKRSKKKVIV--------EDSDTEIED 591
            A DS   D D DD S              L K+K+  K++           DSD   ++
Sbjct: 585 DAPDSDVLDEDSDDESREKDRDDEDDEAIVLPKSKKRAKRIANFGSGPGPDSDSDLGSDN 644

Query: 592 EKMSHNAQIREEKDDSLFQNRNAINLGPYGDNLSLA 627
           E +S N            +  N I+LG YG NL+ A
Sbjct: 645 EPISRNGP----------RPGNVIDLGAYGGNLANA 670

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 14/94 (14%)

Query: 5  FGNLQALKPKKRTTYKKISDDLENDTSESNNDP----PALTGEGFLFDNPTL-NRIKKRL 59
           G+L+  K KK+TTY K   D+E   ++  ND     P L+   FLF N T+ +++K RL
Sbjct: 7  LGDLKHPK-KKKTTYVK---DIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKSRL 62

Query: 60 DG---EEKDVVQYTMNFSQTQLISNLYGGGEDLD 90
          +G   EE D  +      QTQ+I N Y  GEDL+
Sbjct: 63 NGVSNEETDGERGDA-LPQTQVIPNYY-DGEDLE 94

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  219 bits (557), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 205/384 (53%), Gaps = 17/384 (4%)

Query: 657  EKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMS 716
            E++RI  I+++ + +                KG+  +           W GIGG+DG+  
Sbjct: 770  EQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDF 829

Query: 717  DEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAM 776
             EYDSEVEKMIDDYSK   +   +RQ + DENKE D+K+V KILYDIKNGGFRKR +  M
Sbjct: 830  GEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDM 889

Query: 777  XXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPF 836
                        +++R KRRELM+Q+ LE  + + L KNPKSKAFFESM+ D+VE KN F
Sbjct: 890  ELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF 949

Query: 837  AVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFA 896
                 Q    +  ++ TQE+       A  N   K+ +SE+FVQ+TLSFL++ +   +F 
Sbjct: 950  DDLSDQIE--LKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQ 1007

Query: 897  PARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXLLNSRVG 956
            P+  M  E     I D+ ALK  SS+ SF  ++ S S++                     
Sbjct: 1008 PSFIMSKEKG---IGDMNALKSNSSL-SF-CSKLSTSRKIINDEEDVIEEFESF-----K 1057

Query: 957  TSSIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQKKVANL 1016
              SI+++FS+   I+DKF++G                   ITY+GK RKLV P+    N 
Sbjct: 1058 RPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK----NG 1113

Query: 1017 SSSDIKNTNSRTSKLFSRQDESFE 1040
             +   +N+N+ TS+LF+ Q++ F+
Sbjct: 1114 PTVRKRNSNN-TSRLFNIQNDPFD 1136

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 65/80 (81%), Gaps = 1/80 (1%)

Query: 431 ISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKG 490
           +S  SKAT+ ++K RLSKK+P+ K+ N+  +T + LFN L+KA++QQI+ H+KE++E +G
Sbjct: 532 LSNKSKATLLNLKVRLSKKKPVKKVHNEKDST-NLLFNNLRKATKQQIMLHRKELMESRG 590

Query: 491 LNLEDIEKEKKIVENLLEQE 510
           LN ED+EK+K +VE+LLE+E
Sbjct: 591 LNFEDLEKQKVMVEDLLEKE 610

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 59/142 (41%), Gaps = 48/142 (33%)

Query: 1   MDGIFGNLQALKPKKRTTYKKI-------SDDLE----------NDTSESNNDPPALTG- 42
           MD +F  L+ +K KKRTTYKK+        D++           N+ S S++    L   
Sbjct: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60

Query: 43  --EGFLFDNPTLNRIKKRL----------------------------DGEEKDVVQYTMN 72
             +GFL  +  L+ I+ RL                              E+ ++V    +
Sbjct: 61  NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120

Query: 73  FSQTQLISNLYGGGEDLDAPEV 94
              TQ+I+  Y GGEDLDA ++
Sbjct: 121 DISTQIINEYYDGGEDLDATDI 142

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  195 bits (496), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 157/474 (33%), Positives = 222/474 (46%), Gaps = 60/474 (12%)

Query: 602  EEKDDSLFQNRNAINLGPYGDNL-SLAPIR---------------ITTEKQSGKNFKVSR 645
            +E+D S+  + N I+LG YG N+ +L  I                +TT  ++    K S 
Sbjct: 546  DEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTTGRNKNLIKPSS 605

Query: 646  ESGDERDEEIPEKDR----IR-LIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXX 700
             S   + E+   +D     IR LIE+ K+ EL              ++     +      
Sbjct: 606  RSSSFQVEDNSHEDMNPGVIRELIEKHKRKELLREAKLEKLHQSKASR----IIDYEAEE 661

Query: 701  XXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKIL 760
                WHGIGG+DGE  D++DS++EKMIDDYS + F+  E+R+   +E    D  MV KIL
Sbjct: 662  SDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKIL 721

Query: 761  YDIKNGGFRKRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKA 820
            +DI+ GGFRKR + A+             +Y  +R+EL+RQK    GEA+ L +NPKSKA
Sbjct: 722  HDIETGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKA 781

Query: 821  FFESMVDDIVEVKNPFAVFEPQRSGTITTDDG-------TQENANSNEGAASQNPSKKVM 873
            FFE++V+DI             RS     D+G       +  NA   + + S    KK +
Sbjct: 782  FFETIVEDI-------------RSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTV 828

Query: 874  LSEEFVQRTLSFLNSSKDMDQFAPARSMRA------EANDELIEDLTALKKQSSIKSFKT 927
            LSE FVQ+TLSFL S +  ++  P  ++ +        N E  +D+ ALK+ SSIKS   
Sbjct: 829  LSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSA 888

Query: 928  TRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXX 987
                    PT             L SR    S    F+  VD N+KF+EG          
Sbjct: 889  --------PTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSY 940

Query: 988  XXXXXXXXXITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFSRQDESFES 1041
                     ITY+GK RKL AP KKVA+  S    +  +    +F+   ESFES
Sbjct: 941  KVAGSSKASITYLGKARKLNAP-KKVAHQQSRKRGHKPAAGFGIFASNSESFES 993

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 54/80 (67%), Gaps = 6/80 (7%)

Query: 436 KATVFDIKARLSKKR-----PIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKG 490
           KA + D+KARLSKK      P  K++++  ++   LF  L+KA++ QI++++KE  + KG
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNF-SSHQILFASLRKANKSQILDYRKEKYQSKG 418

Query: 491 LNLEDIEKEKKIVENLLEQE 510
           ++ + I +EK  +E+LLE+E
Sbjct: 419 IDYDKITEEKNSIESLLERE 438

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 38 PALTGEGFLFDNPTLNRIKKRLDGEEKDVVQYT--------MNFSQTQLISNLYGGGEDL 89
          P +TG GFLF N  L R+K RL  +E      T         + SQTQ++   Y  GEDL
Sbjct: 29 PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY-DGEDL 87

Query: 90 D 90
          +
Sbjct: 88 E 88

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  193 bits (490), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 144/430 (33%), Positives = 204/430 (47%), Gaps = 77/430 (17%)

Query: 614  AINLGPYGDNLSLAPIRITTEK----QSGKNFKVSRESGDERDE---------------- 653
             INLG YGDNL+ + +   TE     QS +N   + E    R                  
Sbjct: 516  GINLGHYGDNLTSSNV---TENDGADQSDRNVPSNSELKMNRSHSAKLLVGELSSDSSVD 572

Query: 654  ------EIPEKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGITNFLXXXXXXXXXXWHG 707
                  E+ E +R RL E  K                  + G+   L          WHG
Sbjct: 573  SDSSEDELDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHG 632

Query: 708  IGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGG 767
            +GG DGE SD+YDS+++ MIDD+SK+ F+   IR+ LA ENKE D +M+ KIL+DI  GG
Sbjct: 633  VGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGG 692

Query: 768  FRKRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVD 827
            FRKR +GA+            +Q+R KRRE+M+QK LE    + +V N KSKAFF+SMV+
Sbjct: 693  FRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLLE--NVDGVVNNSKSKAFFDSMVE 750

Query: 828  DIVEVKNPFAVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLN 887
            DI     P           +T+   T++              KK+++SEEFVQ +LSFL+
Sbjct: 751  DITRKSIP----------AVTSFSNTRDEMG----------KKKIVISEEFVQSSLSFLS 790

Query: 888  SS-KDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTXXXXXXXXX 946
            +   D+++F        EA  +  EDL +LK++S+IKS  + + +               
Sbjct: 791  AKDDDINEFEV-----TEAAHDATEDLESLKQRSNIKSLDSPQRN--------------R 831

Query: 947  XXXLLNSRVGTS------SIMKTFSATVDINDKFQEGXXXXXXXXXXXXXXXXXXXITYM 1000
                 +   GTS      SI+K+FS+  D+NDKF+ G                   IT++
Sbjct: 832  NSAFFDDVDGTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFL 891

Query: 1001 GKMRKLVAPQ 1010
            GK RKL APQ
Sbjct: 892  GKKRKLKAPQ 901

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  192 bits (488), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 157/525 (29%), Positives = 235/525 (44%), Gaps = 91/525 (17%)

Query: 559  IDSD-NDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINL 617
            IDSD  +  D S+  TKR  ++++V+  D   E                   +NR AI+L
Sbjct: 526  IDSDMGEESDHSV-VTKRRSRRILVQSDDEGTE-----------------TTENRQAIHL 567

Query: 618  GPYGDNLS----------------------LAPIRITT---------------EKQSGKN 640
            G YG+N+                       L+P++ TT               E   G +
Sbjct: 568  GVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSPVKTTTSTPKGLTDGRAELDHESPDGHS 627

Query: 641  FKVSRESGDERDE---------EIPEKDRIRLIEEKKQHELXXXXXXXXXXXXXXAKGIT 691
               + + G  + E         E+ ++ R +++ +                     KGIT
Sbjct: 628  LNTNLQQGLSKSESSSTKVSEDELDQETRRKILSDLLARNRKRAERNKLRRREMKKKGIT 687

Query: 692  NFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKET 751
              L          WHGIGG D E+S++YDSEVEKMIDDYS  + N D +R +LA   ++ 
Sbjct: 688  KMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQH 747

Query: 752  DIKMVEKILYDIKNGGFRKRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGEAET 811
            D  +V KIL+DI  GGFR+R KGA+            +Q+R KRREL++QK LE G+   
Sbjct: 748  DENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSK 807

Query: 812  LVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNEGAASQNPSKK 871
            LV NPKS AFF++MVDD+ E     A F            G   +AN +E        +K
Sbjct: 808  LVSNPKSYAFFQTMVDDVTE-----ASF------------GNTFDANIDEKTDPSAAGRK 850

Query: 872  VMLSEEFVQRTLSFLNSSKDMDQFAPARSMRAEAND---ELIEDLTALKKQSSIKSFKTT 928
            +++SE+FV+ TLSFL SSK  D   PA +    ++    E I+DL  LK+ S+IK  K +
Sbjct: 851  IVISEQFVKETLSFL-SSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGS 909

Query: 929  RASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVDINDKFQEGXXXXXXXXXXX 988
                +Q               L   R    S  K+F+   +++DKF+ G           
Sbjct: 910  LELPAQMAELSSGDEGDYGFSLDRFR----SAAKSFNNGTNVDDKFKSGTKAVRILKANK 965

Query: 989  XXXXXXXXITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFS 1033
                    IT++G+ R+L+ P+    + S   + ++    S+LFS
Sbjct: 966  TIGGSKAAITFIGRKRRLIPPKNDYKD-SEPKLNSSKRARSQLFS 1009

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 55/79 (69%)

Query: 432 SQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGL 491
           S +SKA V  IKAR SK     KI     +  + LF KL+KA+R+Q++E ++  IE++G+
Sbjct: 382 SAVSKAAVLAIKARNSKFITPQKIDETKSSKSNELFAKLRKANREQLLEQRRNAIERRGI 441

Query: 492 NLEDIEKEKKIVENLLEQE 510
           N++++E+E++ + NLLEQE
Sbjct: 442 NMQNLEQEREQLGNLLEQE 460

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  190 bits (483), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 179/637 (28%), Positives = 287/637 (45%), Gaps = 93/637 (14%)

Query: 435  SKATVFDIKARLSKKRPIVKISNDSKT----TLHTLFNKLQKASRQQIIEHQKEVIEKKG 490
            SKA + D+KAR+SKK+  + +++  +T    +L  LF+ L+KA+R Q++EH+  ++  +G
Sbjct: 338  SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397

Query: 491  LNLEDIEKEKKIVENLLEQEXXXXXXXXXXXXXXXXXLADAQDDENDLDFDHSANXXXXX 550
            ++L +I KEK+ VE+LLE+E                 +   +D  +D   D   N     
Sbjct: 398  VDLAEIAKEKESVESLLERELARNKKVKQEE------IQKGEDSSSDSSSDEFCNDSSTS 451

Query: 551  XXXXXXXAIDSDNDYDDFSLE---------------------KTKRSKKKVIVEDSDTEI 589
                   A DS N YDD++ E                       K +   ++  +SD E 
Sbjct: 452  LGSHSDSADDS-NGYDDYNQEVDESVDTEVVDLGPLKSKHELSVKTTNLTIVRAESDEED 510

Query: 590  EDEKMSHNAQIRE----EKDDSLFQN---RNAINLGPYGDNL-------SLAPIRITTEK 635
            +   ++   ++R     + DD    N   +  I+LG YG+N+         A  ++    
Sbjct: 511  DPLNVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENILGTERIDEGAGAQVVGTS 570

Query: 636  QSGKNFKVSR--------------ESGDERDEEIPEKDRIRLIEEKKQHELXXXXXXXXX 681
             S    K+ R              E   ++DEE        LIE++K  E          
Sbjct: 571  SSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKLKE-ALREAKMKE 629

Query: 682  XXXXXAKGITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIR 741
                 A G+ +F           W G+GG DGE SD YDSE+++MIDDYS    +P+ +R
Sbjct: 630  LNRSKANGMIDF---EAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLR 686

Query: 742  QMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQ 801
            + L +E K  D  MV++IL+DI+NGGFRKR + AM             +Y  +R+EL+ +
Sbjct: 687  KKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMDLTLSDDEDDDLLRYHARRKELLNE 746

Query: 802  KRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNE 861
            ++    E   L  NPKSKAFF+S             +FE    G I      Q +A+  +
Sbjct: 747  RKSGNQEISVLATNPKSKAFFDS-------------IFEDDLKGGIANLKEYQSHASPLK 793

Query: 862  GAASQNPSKK-VMLSEEFVQRTLSFLNSSKDMD---QFAPARSMRAEANDELIE--DLTA 915
             A  +   K+   +SE+FVQ+TLSFL S +D     +F      +  ++ +  E  D   
Sbjct: 794  AAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEATDFYR 853

Query: 916  LKKQSSIKSFKT-TRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVDINDKF 974
            LK+ S IKSF    R+S+  +              +L+ +  T ++++ F  +VD N+KF
Sbjct: 854  LKQLSGIKSFSAPLRSSIRLQ--------VRNKDGVLSGKANT-TLVERFVRSVDTNEKF 904

Query: 975  QEGXXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQK 1011
            +EG                   IT++GK R L A ++
Sbjct: 905  EEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKR 941

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 38 PALTGEGFLFDNPTLNRIKKRLDGEEKDVVQYTM----------NFSQTQLISNLYGGGE 87
          P + G GFLF+N   N++KKR+   + + + +            +  +TQ I   Y G E
Sbjct: 30 PTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPYDGEE 89

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  179 bits (453), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 167/334 (50%), Gaps = 38/334 (11%)

Query: 689  GITNFLXXXXXXXXXXWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADEN 748
            G+   +          WHG+GG+D E SDEYDS+++KMIDDY+K  F+P EIR++LA E+
Sbjct: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840

Query: 749  KETDIKMVEKILYDIKNGGFRKRRKGAMXXXXXXXXXXXXKQYRLKRRELMRQKRLEVGE 808
             + D  MV KIL+DIK GGFRKR +G +            + YR KR    +QK L+   
Sbjct: 841  LQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSEH 900

Query: 809  AETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNEGAASQNP 868
              ++  NPKS  FFESMVD+       F +  P      T D    ++ N  E    QN 
Sbjct: 901  NTSVKSNPKSLPFFESMVDE-------FTI--PVERALGTPDSPPAQSTNVLE--LKQNT 949

Query: 869  SKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMRAEANDEL-----------IEDLTALK 917
             +K+++SE FV++TLSFL S ++M       +MR+E N E            +EDL  LK
Sbjct: 950  KQKIVISEHFVKQTLSFLTSDENM------TNMRSEINVEKPNNDNDIYSSEVEDLYTLK 1003

Query: 918  KQSSIKSFKTTRASVSQEPTXXXXXXXXXXXXLLNSRVGTSSIMKTFSATVDINDKFQEG 977
            + S+IK   T     S +P                      S+M+TF +  D+NDKF++G
Sbjct: 1004 ETSTIKVLNT----YSGKPIVNEDEDGAEFG------FKAPSVMQTFGSRNDVNDKFKDG 1053

Query: 978  XXXXXXXXXXXXXXXXXXXITYMGKMRKLVAPQK 1011
                               IT++GK RKL+ P++
Sbjct: 1054 FKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKR 1087

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 6/104 (5%)

Query: 408 QQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDS--KTTLHT 465
           Q I L+  SD+E   ++       S M KA + +IKA++SK   + K +  S    TL  
Sbjct: 419 QDIILDSSSDEEHASNQFA----TSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQ 474

Query: 466 LFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQ 509
           LF  L+KA+++QI++H++E+ EK+G++LE +E+E++ VE+LLEQ
Sbjct: 475 LFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQ 518

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  126 bits (317), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 167/527 (31%), Positives = 253/527 (48%), Gaps = 108/527 (20%)

Query: 1   MDGIFGNLQALKPKKRTTYKKISD-DLEND--TSESNNDPPALTGEGFLFDNPTLNRIKK 57
           MD +F  L ALK KKRTTYKK++D D+E++   SE N + P L G+  LF+N  L +I+ 
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGL-GQSILFNNSKLKQIRN 59

Query: 58  RLDG----EEKDVVQY-TMNFSQTQLISNLYGGGEDLDAPEVERRXXXXXXXXXXXXXXX 112
           RL+G     E D  Q  T   + TQ+ISNLY GGEDL+  E ER                
Sbjct: 60  RLEGNNNDSENDSSQAETQVIADTQIISNLYEGGEDLEEKE-ER---------------- 102

Query: 113 RASKGQLHAFTKSSGNINDLRLMQPTQVI-GSTQLAKEFSPVSRTYFKYVPDVNQSTQVI 171
                               R +Q TQ++   TQ+       S TY         S++ I
Sbjct: 103 --------------------RFLQRTQIVEDHTQII----DASVTY---------SSKTI 129

Query: 172 HSATQDDTQ-VVSAREADTQATQMTQV--LSASTQGIYNTQETQSITDSTQPISYSSSTQ 228
            S   D+TQ  ++A +++    Q+++V  L   T  + + ++    T  TQ +     TQ
Sbjct: 130 ESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKKVLDTTLETQEL----ETQ 185

Query: 229 DYKTNKFNRHPTPEDTQIIPREFDDDASTLPIPEGDKTQKDTSAVLKTQIDSTTEGTSYS 288
             KT         + TQ+   +  D     P    D   K +S  ++T +D  T   S  
Sbjct: 186 YGKTQ-------VDKTQVDKTQV-DKTQIFPTLVADDEIKHSSTAVQT-VDDNTHSNS-- 234

Query: 289 ATVSDTLKIHEIQRELEESQ---KTKTI-PEYKQHVRTPKNVIVFTXXXXXXXXXXXXXX 344
                 LKI+EI+R+L+E     K K++  EYK+++    + + F+              
Sbjct: 235 -----ELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFDSSSSE 289

Query: 345 XXXXXXXXXXXQKVQLLKNTSPSDKS-NDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQ 403
                        V  L +T P   + N    LP  ++ S     K  GL+NYE  LK+ 
Sbjct: 290 EDEEG--------VVKLSSTEPETAAMNLENSLPQFSKES-----KFIGLSNYENILKKD 336

Query: 404 LNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTL 463
           +N    I+ + DS+DE  +        +S+ SKAT+  IKA LS+ +P  + S ++K  L
Sbjct: 337 INKQNCIEFS-DSEDETEV-----TSKVSRASKATILSIKANLSRHKP-AQSSINNKNAL 389

Query: 464 HTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQE 510
             LF+ L+KA++ QI++H+KE++E+KG  +E+IEKEK+IVENLLEQE
Sbjct: 390 GNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQE 436

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON}
          Anc_1.5 YCL061C
          Length = 1020

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 6/87 (6%)

Query: 1  MDGIFGNLQALKPKKRTTYKKISDDLEND----TSESNNDPPALTGEGFLFDNPTLNRIK 56
          M+ IF      K +++TTYKKI ++  ND    T   +   P + G GF+F N  +++I+
Sbjct: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60

Query: 57 KRLDGEEKDVVQYTMNFSQTQLISNLY 83
           RLDG+E    + T   +QTQ+I NLY
Sbjct: 61 NRLDGKENK--EDTPVPTQTQMIDNLY 85

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 617 LGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHEL 672
           +G + + L +AP+  T EK      +VS +SGDER E +  + RI L  E++  +L
Sbjct: 232 MGNFVNYLEIAPVAGTDEKPPPLTPQVSGKSGDERKEPMSARSRIALEIEREPDDL 287

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON}
           similar to uniprot|P43565 Saccharomyces cerevisiae
           YFL033c RIM15 protein kinase involved in expression of
           meiotic genes
          Length = 1682

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 25/125 (20%)

Query: 804 LEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNEGA 863
           LE+      +K  +S+AFFE+++D+++++ N      P      T ++ T+++   ++  
Sbjct: 298 LELEYNSVPIKGTRSRAFFETIIDELIDLCNAAININPSEYHETTANELTEQDQQRSDSV 357

Query: 864 ASQN-------PSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMRAEANDELIE----- 911
           + +N       P +K+M ++   Q   ++        QF+P     ++ N E I+     
Sbjct: 358 SCKNNINLLLLPGEKMMKNQNVHQAEFTY--------QFSPT----SKTNIETIQNWSPD 405

Query: 912 -DLTA 915
            DLTA
Sbjct: 406 FDLTA 410

>TDEL0D00170 Chr4 complement(25816..26826) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 121 AFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYF--KYVPDVNQSTQVIHSATQDD 178
            FT  S +   +   +PT ++ S + AKE+ P        K +PD+     VI  A   +
Sbjct: 47  GFTIDSIDYGHIECYRPTNIVNSVESAKEYGPFDYIVVVTKSLPDITNMVDVIAPAVTSE 106

Query: 179 TQVV 182
           T +V
Sbjct: 107 TAIV 110

>KAFR0E04330 Chr5 (874109..874738) [630 bp, 209 aa] {ON} Anc_4.363
           YJR133W
          Length = 209

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 8/76 (10%)

Query: 408 QQIDLNL--DSDDEDGIDRMGEKGPISQM----SKATVFDIKARLSKKRPIVKISNDSKT 461
           Q I L+L  D   EDG++++G++   +Q     + +  FD  + + KK  IV   +D++T
Sbjct: 64  QAIGLSLYEDMGLEDGVEKIGKEVIRTQWLDFGALSEHFD--SLIGKKILIVDEVDDTRT 121

Query: 462 TLHTLFNKLQKASRQQ 477
           TLH   ++LQK  ++Q
Sbjct: 122 TLHYAISELQKEVKEQ 137

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,807,781
Number of extensions: 4432862
Number of successful extensions: 22838
Number of sequences better than 10.0: 250
Number of HSP's gapped: 23644
Number of HSP's successfully gapped: 320
Length of query: 1041
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 921
Effective length of database: 39,721,479
Effective search space: 36583482159
Effective search space used: 36583482159
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)