Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D00130na 1ON59559530460.0
KNAG0C00210na 1ON8153513561e-34
NCAS0C002308.880ON6102942421e-20
Suva_13.488.880ON5912812402e-20
NDAI0G01400singletonON6832482376e-20
KNAG0D05350singletonON6612932367e-20
NDAI0E001208.880ON7492832351e-19
KAFR0A030708.880ON5622702242e-18
Kpol_455.118.880ON5582702109e-17
NDAI0K001408.880ON6452712072e-16
TDEL0B004908.880ON6952752055e-16
KAFR0A03050singletonON5223052036e-16
TPHA0C049908.880ON5732741956e-15
TBLA0C062608.880ON7702611886e-14
SAKL0B05566g8.779ON5051341313e-07
Ecym_14828.779ON5071261215e-06
ZYRO0F12342g8.779ON4562181206e-06
TPHA0I007108.779ON4861371143e-05
KAFR0B035108.779ON6231131126e-05
KLLA0F24816g8.779ON4781261127e-05
KLTH0H15180g8.779ON4941141091e-04
KNAG0J006808.779ON4691071082e-04
AFR538C8.779ON4321151063e-04
Kwal_34.159228.779ON4961141063e-04
Kpol_1045.68.779ON4781141036e-04
TDEL0B033008.779ON4811141000.002
Suva_13.4248.779ON469114980.003
Smik_13.4518.779ON472114940.009
Skud_13.4108.779ON474114940.009
CAGL0M05159g8.779ON449109930.010
YMR239C (RNT1)8.779ON471114930.011
TBLA0B028708.779ON481111930.012
KAFR0C03740singletonON729284920.016
CAGL0I09636g8.779ON734120900.031
NDAI0K02960singletonON46195880.044
NDAI0K008208.779ON517181810.29
NCAS0C007908.779ON675113780.87
KLLA0D09977g2.340ON634138698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00130
         (595 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00130 Chr4 complement(10547..12334) [1788 bp, 595 aa] {ON}...  1177   0.0  
KNAG0C00210 Chr3 complement(30184..32631) [2448 bp, 815 aa] {ON}      141   1e-34
NCAS0C00230 Chr3 complement(25138..26970) [1833 bp, 610 aa] {ON}       98   1e-20
Suva_13.48 Chr13 (73725..75500) [1776 bp, 591 aa] {ON} YMR239C (...    97   2e-20
NDAI0G01400 Chr7 complement(312005..314056) [2052 bp, 683 aa] {ON}     96   6e-20
KNAG0D05350 Chr4 complement(978518..980503) [1986 bp, 661 aa] {O...    96   7e-20
NDAI0E00120 Chr5 (1990..4239) [2250 bp, 749 aa] {ON}                   95   1e-19
KAFR0A03070 Chr1 (629671..631359) [1689 bp, 562 aa] {ON}               91   2e-18
Kpol_455.11 s455 complement(14820..16496) [1677 bp, 558 aa] {ON}...    86   9e-17
NDAI0K00140 Chr11 (18609..20546) [1938 bp, 645 aa] {ON}                84   2e-16
TDEL0B00490 Chr2 complement(86668..88755) [2088 bp, 695 aa] {ON}       84   5e-16
KAFR0A03050 Chr1 complement(623884..625452) [1569 bp, 522 aa] {O...    83   6e-16
TPHA0C04990 Chr3 complement(1075250..1076971) [1722 bp, 573 aa] ...    80   6e-15
TBLA0C06260 Chr3 (1515789..1518101) [2313 bp, 770 aa] {ON}             77   6e-14
SAKL0B05566g Chr2 complement(482433..483950) [1518 bp, 505 aa] {...    55   3e-07
Ecym_1482 Chr1 complement(995669..997192) [1524 bp, 507 aa] {ON}...    51   5e-06
ZYRO0F12342g Chr6 complement(1005809..1007179) [1371 bp, 456 aa]...    51   6e-06
TPHA0I00710 Chr9 (143903..145363) [1461 bp, 486 aa] {ON} Anc_8.7...    49   3e-05
KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {O...    48   6e-05
KLLA0F24816g Chr6 (2308342..2309778) [1437 bp, 478 aa] {ON} simi...    48   7e-05
KLTH0H15180g Chr8 complement(1317079..1318563) [1485 bp, 494 aa]...    47   1e-04
KNAG0J00680 Chr10 (115634..117043) [1410 bp, 469 aa] {ON} Anc_8....    46   2e-04
AFR538C Chr6 complement(1404410..1405708) [1299 bp, 432 aa] {ON}...    45   3e-04
Kwal_34.15922 s34 (115736..117226) [1491 bp, 496 aa] {ON} YMR239...    45   3e-04
Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON} (8627..10...    44   6e-04
TDEL0B03300 Chr2 (588444..589889) [1446 bp, 481 aa] {ON}               43   0.002
Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {...    42   0.003
Smik_13.451 Chr13 complement(732656..734074) [1419 bp, 472 aa] {...    41   0.009
Skud_13.410 Chr13 complement(723047..724471) [1425 bp, 474 aa] {...    41   0.009
CAGL0M05159g Chr13 complement(556347..557696) [1350 bp, 449 aa] ...    40   0.010
YMR239C Chr13 complement(748262..749677) [1416 bp, 471 aa] {ON} ...    40   0.011
TBLA0B02870 Chr2 (660516..661961) [1446 bp, 481 aa] {ON} Anc_8.7...    40   0.012
KAFR0C03740 Chr3 (763425..765614) [2190 bp, 729 aa] {ON}               40   0.016
CAGL0I09636g Chr9 complement(921232..923436) [2205 bp, 734 aa] {...    39   0.031
NDAI0K02960 Chr11 complement(672616..674001) [1386 bp, 461 aa] {...    39   0.044
NDAI0K00820 Chr11 (183793..185346) [1554 bp, 517 aa] {ON} Anc_8....    36   0.29 
NCAS0C00790 Chr3 (137927..139954) [2028 bp, 675 aa] {ON} Anc_8.7...    35   0.87 
KLLA0D09977g Chr4 complement(841852..843756) [1905 bp, 634 aa] {...    31   8.7  

>KAFR0D00130 Chr4 complement(10547..12334) [1788 bp, 595 aa] {ON}
           possible pseudogene; NNN added to avoid internal stop
           codon
          Length = 595

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/595 (97%), Positives = 579/595 (97%)

Query: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDFPIITSTYLEAMIPLHRENLEFVGEK 60
           MISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDFPIITSTYLEAMIPLHRENLEFVGEK
Sbjct: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDFPIITSTYLEAMIPLHRENLEFVGEK 60

Query: 61  WLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEKFNNIEGFKAYIGA 120
           WLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEKFNNIEGFKAYIGA
Sbjct: 61  WLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEKFNNIEGFKAYIGA 120

Query: 121 LVQDEDGPAMKTIITWLAEVRDAQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSF 180
           LVQDEDGPAMKTIITWLAEVRDAQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSF
Sbjct: 121 LVQDEDGPAMKTIITWLAEVRDAQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSF 180

Query: 181 ISKNIGGKYVSSVHLGDTILSIGDPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVDSAE 240
           ISKNIGGKYVSSVHLGDTILSIGDPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVDSAE
Sbjct: 181 ISKNIGGKYVSSVHLGDTILSIGDPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVDSAE 240

Query: 241 KTPNNLVSTANTDPELLTRKIMESVNEKVASIVSQITAEMLHKSPITAKNDVAATMSIEN 300
           KTPNNLVSTANTDPELLTRKIMESVNEKVASIVSQITAEMLHKSPITAKNDVAATMSIEN
Sbjct: 241 KTPNNLVSTANTDPELLTRKIMESVNEKVASIVSQITAEMLHKSPITAKNDVAATMSIEN 300

Query: 301 XXSVEVNTDTKLNDFCLAEAPSKTVSKANKRPSNSSPLEKLTAVASNNGRAKAKTFAKEP 360
             SVEVNTDTKLNDFCLAEAPSKTVSKANKRPSNSSPLEKLTAVASNNGRAKAKTFAKEP
Sbjct: 301 XXSVEVNTDTKLNDFCLAEAPSKTVSKANKRPSNSSPLEKLTAVASNNGRAKAKTFAKEP 360

Query: 361 KTVSAKAHNNVISHTLEPTLQRENVPVIISVKAEKALANDTTGNSRTLPGKCTPEQAYSS 420
           KTVSAKAHNNVISHTLEPTLQRENVPVIISVKAEKALANDTTGNSRTLPGKCTPEQAYSS
Sbjct: 361 KTVSAKAHNNVISHTLEPTLQRENVPVIISVKAEKALANDTTGNSRTLPGKCTPEQAYSS 420

Query: 421 FIFKEAPDTGLNRDTGPKVKKERKGGKXXXXXXXXXXXXXXXXSATDFNIPIKSVCDKLA 480
           FIFKEAPDTGLNRDTGPKVKKERKGGK                SATDFNIPIKSVCDKLA
Sbjct: 421 FIFKEAPDTGLNRDTGPKVKKERKGGKEEEEEEEEEEEEEEEESATDFNIPIKSVCDKLA 480

Query: 481 KFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQVAASDA 540
           KFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQVAASDA
Sbjct: 481 KFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQVAASDA 540

Query: 541 LQNKKYKTKLMGRNNEDEMKPELLENYADDNDNSKDEIETSFSRPDLLNPQYSLT 595
           LQNKKYKTKLMGRNNEDEMKPELLENYADDNDNSKDEIETSFSRPDLLNPQYSLT
Sbjct: 541 LQNKKYKTKLMGRNNEDEMKPELLENYADDNDNSKDEIETSFSRPDLLNPQYSLT 595

>KNAG0C00210 Chr3 complement(30184..32631) [2448 bp, 815 aa] {ON} 
          Length = 815

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/351 (28%), Positives = 171/351 (48%), Gaps = 61/351 (17%)

Query: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDF--PIITSTYLEAMIPLHR------- 51
           MIS+Y +N R+S+D  +I  YY FD N+ +       PIIT+  LE ++  H+       
Sbjct: 63  MISTYLANARSSVDIVKICDYYKFDENIWSSTALIKEPIITNPILEFLVLAHKKLQKSNT 122

Query: 52  ----ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEK 107
               E L+FVG+ WL +L++ IL  +F  +    LEKL++ +L+NE L++  +  RL + 
Sbjct: 123 AKNNELLQFVGDSWLKSLIASILYKKFPHASAKALEKLKSDLLTNETLDLWSANNRLLKS 182

Query: 108 FNNI------------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQLK 149
             ++                    FKAYIGAL+ D     +  +++WL+ + + ++  LK
Sbjct: 183 LPDLVTKMHPNASEEEVLNYRRSCFKAYIGALILDRSHHELNDVVSWLSSLCETRVGILK 242

Query: 150 NANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIGDPSNTT 209
             NL+ LY  + K+QL++ +E NKS   + FI+ +IG  +   V +G T+L       T 
Sbjct: 243 AQNLRGLYAKNLKEQLVQFMEGNKSEKPLKFITTHIGASHSCKVVIGSTVLGTAR-GVTA 301

Query: 210 QETEHNVSKKVLNDQVLLSKHSIFS----------------------------TVDSAEK 241
            E E   +  VL +  LL+K++++S                             V   E 
Sbjct: 302 VEAERKAASIVLGNVELLTKYTVYSDSVPIYQKPLASNNSENSEEKAVIAESEAVKENEN 361

Query: 242 TPNNLVST-ANTDPELLTRKIMESVNEKVASIVSQITAEMLHKSPITAKND 291
             N      +  D E LT  I+  ++E++ S+VS+IT ++L +  I++ ++
Sbjct: 362 AENERAKIFSPIDDEKLTEHILSKLSERLESMVSEITLKILQEKNISSPDN 412

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 54/78 (69%)

Query: 470 IPIKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNK 529
           +P++   DK AK  +Y  +G  N FPEYVT+QLG+NDF+S  ++K  PD  +G GR  +K
Sbjct: 605 LPLQHQFDKTAKAQVYGAVGRLNMFPEYVTVQLGVNDFYSCCSIKGEPDSLMGEGRGFSK 664

Query: 530 KIDEQVAASDALQNKKYK 547
           KI EQVAA  ALQ+ K++
Sbjct: 665 KIAEQVAAGAALQSDKWR 682

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 472 IKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKI 531
           + + CDK A   L   LG     PEY T  L  + F+ST  V+    L L  G    K +
Sbjct: 736 VHTSCDKTAMGRLQALLGEAGFIPEYKTRMLAPSHFYSTCNVRGTSVL-LAEGHGLTKLV 794

Query: 532 DEQVAASDALQN 543
            +Q+AA +A+ N
Sbjct: 795 SQQIAAENAMFN 806

>NCAS0C00230 Chr3 complement(25138..26970) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 131/294 (44%), Gaps = 44/294 (14%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNFDSNLH--NPYNDFPIITSTYLEAMIPLHR-------- 51
           ++S  + +R ++D   IF +Y F++N    +PY  +P+ +   LE +  +HR        
Sbjct: 77  VASCLNQVRPTLDIKNIFDHYKFENNSSPVDPYVHYPVCSDQNLENLAFIHRSLPNMNVK 136

Query: 52  -----------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLS 100
                      E LEF+G+ WL AL++ I+  ++ ++ +  L K++ A+++N  L  +  
Sbjct: 137 LTELQKTVMSNERLEFLGDSWLGALVAYIIYKKYPYANEGALSKMKEAIVNNNNLEKICE 196

Query: 101 KIRLPEKF-----------------NNIEGFKAYIGALVQDEDGPAMKTIITWLAEVRDA 143
           K+   E+                  N  +  +AYIGALV D        +  WL E+ + 
Sbjct: 197 KLGFKERLKENIPRSSMKIKDRLTKNYADCVEAYIGALVIDRFSTEFNDVALWLEELSEE 256

Query: 144 QLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIG 203
              +L    +K     + K +L   L+ N    ++S+   N    +   V LG+ +L IG
Sbjct: 257 HFIELGPMMVKEPLNKNAKGELGAFLQFNNIGAKISYKRLNDKSPFKVEVRLGNNLLGIG 316

Query: 204 DPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVDSAEKTPNNLVSTANTDPELL 257
           D SN  +E E   + + L    L+ K+S+        +    ++  A+  P+LL
Sbjct: 317 DGSN-VREAEQRAAMEALAQPKLIQKYSLHDI-----ELERGMIEEADNVPQLL 364

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 472 IKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKI 531
           + SV DK A   LY  LG    +PEY T QLG+ DF++   +K V  + +G+G   +KKI
Sbjct: 527 LNSVYDKEASGRLYALLGKYKLYPEYNTEQLGMTDFYTVCFIKGV-GVEIGKGHGRSKKI 585

Query: 532 DEQVAASDALQNKKYKTKLMGRNN 555
            +  +A DAL  K  K  L   NN
Sbjct: 586 SQHKSAEDALNGKALKEYLRHCNN 609

>Suva_13.48 Chr13 (73725..75500) [1776 bp, 591 aa] {ON} YMR239C
           (REAL)
          Length = 591

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 129/281 (45%), Gaps = 41/281 (14%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDF---PIITSTYLEAMIPLHR------- 51
           ++SY    + S+D   +F  Y F+ N+ +P + F   P++T+ +LE +  +HR       
Sbjct: 71  VASYLKTDQRSLDIESVFQRYKFE-NVDSPVHQFVHYPVVTNIHLENLAFVHRSVPNMNV 129

Query: 52  ------------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEAL---- 95
                       E LEF+G+ WL A ++ IL  ++ FS +  L ++++A+++N  L    
Sbjct: 130 NLTEVQKTVMSNERLEFLGDSWLGAFVAYILYRKYPFSDEGALSRMKSAIVNNNNLERLS 189

Query: 96  -----------NVLLSKIRLPEK-FNNI-EGFKAYIGALVQDEDGPAMKTIITWLAEVRD 142
                      N+  SK+R+ +K F +  +  +AYIGALV D        ++ W+ E+  
Sbjct: 190 QKLGFKERLKENIPRSKMRIKDKPFKHYADCVEAYIGALVIDRFSAEFVDVVDWIEELSQ 249

Query: 143 AQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSI 202
            Q   L     K     + K +L   L+ NK   ++ +   N    + S V LGD  L  
Sbjct: 250 DQFNTLGGIMEKKPLNKNAKGELGNYLQFNKLGAKIKYFCLNNQPPFTSEVRLGDIFLGR 309

Query: 203 GDPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVDSAEKTP 243
           G+  N  +E E   + + ++D  ++ K+SI    D     P
Sbjct: 310 GEGQN-IKEAEQRAAMEAIDDIDIIQKYSIHDMEDRDSVYP 349

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 471 PIKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKK 530
           P  +  DK+A   LY  +G  +  P+Y   +L    F    T       TLG G    +K
Sbjct: 509 PDSTGVDKIASDKLYAYMGRFHLTPKYTFKKLTNGSFHCVCTAGEFA-TTLGEGDAKRRK 567

Query: 531 IDEQVAASDALQNK 544
           I +  AA+ AL++K
Sbjct: 568 IAQHTAAAQALRSK 581

>NDAI0G01400 Chr7 complement(312005..314056) [2052 bp, 683 aa] {ON}
          Length = 683

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 122/248 (49%), Gaps = 16/248 (6%)

Query: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDF---PIITSTYLE---------AMIP 48
            I +Y  N +AS+D ++IF YY +DS   +P +++   PIIT T L+          +  
Sbjct: 76  FIGTYLKNAQASLDISKIFEYYQYDSE-SSPLDNYIKEPIITDTNLQKLASSTVSNGITS 134

Query: 49  LHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEKF 108
           + R  LE++G  W++AL+S +L ++F  + +  LE L + +L N+  + + S        
Sbjct: 135 IDRNRLEYLGANWMNALISIVLFNQFPNANKKGLENLHDQIL-NDKQDWIKSTTFNTMNH 193

Query: 109 NNIEGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQLKNANLKVLYPSDYKQQLIEL 168
           NN E   +Y GAL+ D   P    I+ WL+     +L  +K   L  +     K+ LIE 
Sbjct: 194 NN-ENLNSYFGALIFDRSIPQFNDILKWLSISTKDKLNSIKYNYLIDVNAKTPKEALIEF 252

Query: 169 LENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIGDPSNTTQETEHNVSKKVLNDQVLLS 228
           +++NK   ++ FI   +   ++  V LG+  L  G+  N  +  E   ++  L+   L+ 
Sbjct: 253 MKDNKDGLKLRFIRLTVNSPFIIEVKLGNVSLGKGE-DNVIEIAEQKAAQDALSKPELIE 311

Query: 229 KHSIFSTV 236
            +S +  V
Sbjct: 312 NYSKYPIV 319

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 476 CDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQV 535
           CDK +K +LY  LG  N FPEY T Q+ +NDF+S   ++    + LG GR +NK+I +Q+
Sbjct: 606 CDKSSKASLYAILGKVNLFPEYKTSQIDMNDFYSFCILRGT-AIILGEGRGSNKQISQQI 664

Query: 536 AASDALQNK 544
           AA  A++ +
Sbjct: 665 AAEHAIEGE 673

>KNAG0D05350 Chr4 complement(978518..980503) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 136/293 (46%), Gaps = 42/293 (14%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNFDSN---LHNPYNDFPIITSTYLEAMIPLHR------- 51
           I SY    R ++D   +F  + FD+N   +H  +  +P+++   LE +  +HR       
Sbjct: 81  IGSYLVENREALDLEHMFEVFRFDANESPVHC-FIQYPVVSDAQLENLAFVHRSFPNMNV 139

Query: 52  ------------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLL 99
                       E LEF+G+ WL A+++  L  ++ ++ +  L ++++A+++N  L  + 
Sbjct: 140 HLSAAERTVMSNERLEFLGDSWLGAIVAYFLYKKYPYANEGALSRMKSAIVNNNNLEKIC 199

Query: 100 SKIRLPEKFN-NIEGFK----------------AYIGALVQDEDGPAMKTIITWLAEVRD 142
           S++   ++   N+ G+K                AYIGA V D      + +  W+ ++ +
Sbjct: 200 SRLGFKQRLRANVPGYKMKIRDSFSKYHADVVEAYIGAFVVDRFKTEFQELADWIEKLSE 259

Query: 143 AQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSI 202
            QL       L      + K +L ELL+ NK+  ++++        +     LG+ +LS 
Sbjct: 260 EQLQLFGPEMLNTPLNKNAKGELAELLQFNKTGGKLTYRRMTQTSPFKVQALLGNIVLSE 319

Query: 203 GDPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTV-DSAEKTPNNLVSTANTDP 254
           G  +N  ++ E   +   L+   L++K+S+F  V + +E+ P   +  +N +P
Sbjct: 320 GSGAN-VKDAERRAAMAALDKPELIAKYSLFDIVPNESEENPVEQLPDSNMNP 371

>NDAI0E00120 Chr5 (1990..4239) [2250 bp, 749 aa] {ON} 
          Length = 749

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 132/283 (46%), Gaps = 40/283 (14%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNF--DSNLHNPYNDFPIITSTYLEAMIPLHR-------- 51
           I+SY  +++ S D   IF +Y F  DS   + +  +P+++   LE +  +HR        
Sbjct: 73  IASYLYSVQPSFDVESIFEHYAFHEDSTPVDQFIKYPVVSDASLENLAFIHRSLPNMNVN 132

Query: 52  -----------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLS 100
                      E LEF+G+ WL AL++  L  ++ F+ +  L K++ A+++N+ L  +  
Sbjct: 133 LTESQRTMMSNERLEFLGDSWLGALVAYSLYKKYPFANEGALSKMKQAIVNNDNLEKISK 192

Query: 101 KIRLPEKF-NNI----------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRDA 143
           K+  PEK   NI                +  +AYIGALV D      K +  WL ++ + 
Sbjct: 193 KLGFPEKLRGNIPHTSLRKKDKKSKLYADCVEAYIGALVVDRYSAEFKEVSQWLEDLSED 252

Query: 144 QLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIG 203
              ++ ++  +     + K +L E+L+ NK   +V + + N    +   V LG+ +L +G
Sbjct: 253 IFEEMGDSLTRDPLNKNSKGELAEILQFNKLGKKVEYKTLNKKSPFRVEVRLGNIVLGVG 312

Query: 204 DPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVDSAEKTPNNL 246
              N  +E E   +   L +   L K++  S ++S  K  N+L
Sbjct: 313 VGDN-IKEAEQRSAMFALENPKELEKYTA-SPIESTSKVNNDL 353

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 477 DKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQVA 536
           DK A   LY  LG  N  PEY T   G + F++   +K +  +T+G G   +KKI + +A
Sbjct: 676 DKEASEKLYALLGKSNMCPEYETTNEG-DGFYTVCRIKGM-GITIGEGSGRSKKISQHIA 733

Query: 537 ASDALQNKKYKTKLMGR 553
           A +AL+NK+ K KL+ R
Sbjct: 734 AGNALRNKEVK-KLLSR 749

>KAFR0A03070 Chr1 (629671..631359) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 125/270 (46%), Gaps = 41/270 (15%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNFDSNLHNP---YNDFPIITSTYLEAMIPLHR------- 51
           ++S     +  +D   +F  YNF+S+ ++P   Y  +PI T   LE +  +H        
Sbjct: 73  VASRLKAAKKVLDIQSVFKQYNFESD-NSPVDEYIHYPICTDRRLENLAFIHSSYPNMNV 131

Query: 52  ------------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLL 99
                       E LEF+G+ WL AL++ I+ +++ ++ +  L K+++A++SN  L  + 
Sbjct: 132 KLTETQKIVMCNERLEFLGDSWLGALVAYIIYNKYPYADEGALSKMKDAIVSNSNLEKIC 191

Query: 100 SKIRLPEK-FNNI----------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRD 142
           +K+   E+   NI                +  +AYIGALV D      K I  WL E+  
Sbjct: 192 TKLGFKERLLENIPRSSMKIKNKFSKYYADCVEAYIGALVVDRFSAEFKDIADWLTELAQ 251

Query: 143 AQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSI 202
               +L     K     + K +L E L+ NK   +++++       +   + LG  +L+ 
Sbjct: 252 EHFEELGPDMFKKPLNKNAKGELAEFLQFNKLGLKLAYVRVTNKTPFKVQLKLGTILLAE 311

Query: 203 GDPSNTTQETEHNVSKKVLNDQVLLSKHSI 232
           G   N  +E EH  + +VL ++ L+ K+S+
Sbjct: 312 GQGPN-VREAEHRAAMEVLANKELIEKYSL 340

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 477 DKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQVA 536
           DK +   LY  LG     P+Y   Q G ++F +  ++K      LG G   +KKI + +A
Sbjct: 487 DKESSGRLYALLGSIKLHPDYEIFQEGPSEFHAICSIKGTGTF-LGEGTGRSKKIAQHIA 545

Query: 537 ASDAL 541
           A +AL
Sbjct: 546 AGNAL 550

>Kpol_455.11 s455 complement(14820..16496) [1677 bp, 558 aa] {ON}
           complement(14820..16496) [1677 nt, 559 aa]
          Length = 558

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 124/270 (45%), Gaps = 39/270 (14%)

Query: 10  RASIDFNQIFAYYNF-DSNLH-NPYNDFPIITSTYLEAMIPLHR---------------- 51
           R S+D   +F  ++F DSN   + +  +P++    LE +  +H+                
Sbjct: 81  RYSLDLIDLFQSHDFKDSNTDVDMFIKYPVVYDENLENLAFMHKSFPNMNAHLNDAQKTQ 140

Query: 52  ---ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEKF 108
              E LEF+G+ WL AL+S I+  RF  + +  L +++ ++++N  L    +K+   ++ 
Sbjct: 141 LSNERLEFLGDSWLGALVSYIVYTRFPSANEGMLSQMKESIVNNNNLFDWSTKLNFTKRL 200

Query: 109 -NNI----------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQLKNA 151
             NI                +  +AYIGALV D  G     I  WL E+ + +L +    
Sbjct: 201 QGNIATPTRVVKDKMSKRYADCVEAYIGALVIDRFGTEFLDIKEWLEELSEKKLAKSSQM 260

Query: 152 NLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIGDPSNTTQE 211
            +K     + K +L ELL+ NK  H++ +        +   V +GD +L   +  N+ +E
Sbjct: 261 VIKEPLNKNAKNELAELLQINKLGHKLHYRKLTEMPPFRVEVKIGDILLDEAE-GNSIRE 319

Query: 212 TEHNVSKKVLNDQVLLSKHSIFSTVDSAEK 241
            EH  + KVL +  LL K+S++   D   K
Sbjct: 320 AEHRAAMKVLENDELLRKYSVYDLEDGNSK 349

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 476 CDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQV 535
           CD  AK  LY  L     FP+Y  +Q  +++F +   +K    + L  GR  +KKI +Q 
Sbjct: 479 CDPNAKQALYTLLSRSQVFPDYEMVQHSMDNFTANCIIKG-SGIFLASGRGRSKKIAQQN 537

Query: 536 AASDALQNKKYKTKLMGRNN 555
           AAS AL++   K+ L  +NN
Sbjct: 538 AASAALRSPILKSILEEQNN 557

>NDAI0K00140 Chr11 (18609..20546) [1938 bp, 645 aa] {ON} 
          Length = 645

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 120/271 (44%), Gaps = 41/271 (15%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNFDSNLHNPYNDF---PIITSTYLEAMIPLHR------- 51
           +++Y +N+R S D   IF  ++F+ N  +P + F   P+ T   LE +  +H+       
Sbjct: 72  VANYLTNMRNSFDLEAIFKAHHFE-NGKSPVDKFISYPVCTDPNLEHLAFIHKSLPNMNV 130

Query: 52  ------------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLL 99
                       E LEF+G+ WL A ++ I+  ++ ++ +  L K+++A+++N  L  L 
Sbjct: 131 RLTELQKTIMSNERLEFLGDSWLGAFIAFIIYKKYPYANEGALSKMKDAIVNNNNLEKLS 190

Query: 100 SKIRLPEKF-NNI----------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRD 142
            K+   E+   NI                +  +AYIGALV D      K +  WL E+  
Sbjct: 191 EKLGFKERLKENIPRSSMKIKDRLTKHYADCVEAYIGALVVDRFATEFKDVSDWLEELST 250

Query: 143 AQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSI 202
                L     +     + K +L ELL+ N    ++++        +   V+LGD  L  
Sbjct: 251 EHFENLGPLMFREPLNRNAKGELGELLQFNNIGAKINYTKLTENSPFSVEVYLGDIFLGK 310

Query: 203 GDPSNTTQETEHNVSKKVLNDQVLLSKHSIF 233
           GD  N  +E E   +   L D  L+ K+S +
Sbjct: 311 GDGPN-IREAEQRAAMAALADHALIQKYSSY 340

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 477 DKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVP-DLTLGRGRRTN 528
           DK A   LY  LG    +PEY+  QL ++ F +T  +K +   L  G GR  N
Sbjct: 587 DKEASGKLYAMLGKIGLYPEYIIEQLSIDHFVATCNLKGLGIHLGTGEGRSKN 639

>TDEL0B00490 Chr2 complement(86668..88755) [2088 bp, 695 aa] {ON} 
          Length = 695

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 121/275 (44%), Gaps = 41/275 (14%)

Query: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLHN--PYNDFPIITSTYLEAMIPLHR------- 51
           ++S Y + +   I  + +F +Y F+    N      +P++++ YLE +  LHR       
Sbjct: 68  LVSKYINEVHYGI--SNVFQHYKFEEGAPNVDRVVKYPVVSNAYLENLAFLHRSCSSMNV 125

Query: 52  ------------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLL 99
                       E LEF+G+ WL A +S  L  ++ ++ + +L K+ +A+++N  L    
Sbjct: 126 HVTEVDRAVATNERLEFLGDSWLGAFVSYTLYKKYPYANEGSLSKMRSAIVNNVNLAKWC 185

Query: 100 SKIRLPEKF-NNI----------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRD 142
            ++   E+   NI                + F+AY+GALV D+       I+ W+ ++ +
Sbjct: 186 KQVGFDERLRGNIPKMVNKLKDMTSKYHADCFEAYVGALVVDKYSIEFGEIVDWIEDLSE 245

Query: 143 AQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSI 202
               ++    +K     + K +L  LL  NK   ++ +   N    +   V LGD  L+ 
Sbjct: 246 EVFREMGTKMIKEPMNKNAKHELATLLTCNKVGAKLEYQRLNSTSPFKVEVKLGDISLAT 305

Query: 203 GDPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVD 237
           G+ S + +E E   + K L D   +  +S +   D
Sbjct: 306 GEGS-SIKEAEQRAAMKALLDTSKIKTYSFYELDD 339

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 477 DKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQVA 536
           D  +K  LY  LG R   P Y T   GL  F S   ++   ++ LG GR ++KK  EQ+A
Sbjct: 598 DASSKQELYAYLGQRGFRPYYETKSEGLQSFSSDCMIQGF-NIILGSGRASSKKQAEQIA 656

Query: 537 A 537
           A
Sbjct: 657 A 657

>KAFR0A03050 Chr1 complement(623884..625452) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 136/305 (44%), Gaps = 60/305 (19%)

Query: 1   MISSYFSNLRASIDFNQIFAYYNFDSNLH--NPYNDFPIITSTYLEAMIPLHR------- 51
           + +++  N R+  D  +IF  Y FD N      + ++P++T   LE +  +H+       
Sbjct: 27  LAANHVKNARSVFDMGEIFKKYEFDENSSPLGGHIEYPVVTDAPLEVLAFIHKSFINSNV 86

Query: 52  ------------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLL 99
                       E L+FVGE WL+AL+S +L  ++ ++ + TL +++  +++N  L  L 
Sbjct: 87  NLTEEQRIAMCNERLQFVGENWLNALVSYVLYRKYPYTNEATLTRMKQCIINNSNLERLY 146

Query: 100 SKIRLPEK-FNNI----------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRD 142
            K+   EK   NI                   +AYIGAL  D  G   + +  W+ E+ +
Sbjct: 147 EKLGFKEKLLENIPPAALNKKEKKEKQYAGCMEAYIGALAVDRFGVDFEELANWIEELSN 206

Query: 143 AQL----TQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSF--ISKNIGGKYVSSVHLG 196
             L    +QL++ N       + K +L ++L+ N    ++S+  +SKN    Y   V LG
Sbjct: 207 EHLVDETSQLQSVN------KNAKNELAKILQFNVLQKKISYRILSKN--SPYNVRVELG 258

Query: 197 DTILSIGDPSNTTQETEHNVSKKVLNDQVL--LSKHSIFSTVDSAEKTPNNLVSTANTDP 254
           + IL  G   +     +      + N ++L  LS H I     S E TP++  S+ N D 
Sbjct: 259 EYILGEGTGIDIKDAEQRAAMDALSNFELLEQLSSHEI-----SNESTPSS-ASSLNKDE 312

Query: 255 ELLTR 259
               R
Sbjct: 313 MFAPR 317

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 477 DKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPD-LTLGRGRRTNKKIDEQV 535
           DK A   L+  L   + +PEY+  +    +F +T  +  V   L+ G GR  +KKI +  
Sbjct: 447 DKEASSKLHTLLAKCDCYPEYLVEETDSGEFHTTCRIMGVGTFLSEGTGR--SKKIAQHN 504

Query: 536 AASDALQNKKYKTKLMGR 553
           AA+ ALQ+K  K  L  R
Sbjct: 505 AAASALQSKNLKKILNKR 522

>TPHA0C04990 Chr3 complement(1075250..1076971) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 124/274 (45%), Gaps = 39/274 (14%)

Query: 2   ISSYFSNLRASIDFNQIFAYYNFDSNLH--NPYNDFPIITSTYLEAMIPLHR-------- 51
           I+S    +R  +DF  +F  + F+      + Y ++P++    L+ +  +H+        
Sbjct: 77  ITSEIHKVRPKMDFVTLFDNFEFNEKKSELDRYINYPVVYDEQLDNLAFIHKSIPNMNNN 136

Query: 52  -----------ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLS 100
                      E LEF+G+ WL ++++ I+ +++  + +  L  ++ A++SN+ L     
Sbjct: 137 LDITSQKVLSNERLEFLGDSWLGSIVAYIVYNKYPNADEGLLTNIKAAIVSNQNLYEWSL 196

Query: 101 KIRLPEKFNN--------IEG---------FKAYIGALVQDEDGPAMKTIITWLAEVRDA 143
           ++    + N+        ++G          +AYIGALV D        +  W+ E+   
Sbjct: 197 RLNFDARLNSNISKSTKLVKGKSNKRYADCVEAYIGALVVDRFNTEFLDVKEWIEELAHE 256

Query: 144 QLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGGKYVSSVHLGDTILSIG 203
           QL   K+ + K+    + K +L  LL+ NK    +++   N    +   V LGD  L+  
Sbjct: 257 QLEAFKSESNKIPINKNAKYELASLLQVNKLGASLNYKRLNNSSPFKIEVRLGDMALATA 316

Query: 204 DPSNTTQETEHNVSKKVLNDQVLLSKHSIFSTVD 237
           +  N  +E E   + KVL D  LL K+S++  VD
Sbjct: 317 EGQN-VKEGEQRAAMKVLADNKLLLKYSVYDFVD 349

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 476 CDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRRTNKKIDEQV 535
           CD  AK  LY  L   + FP YVT Q  L D FS+  +       LG G   +KKI E  
Sbjct: 492 CDIKAKEKLYCMLSREHVFPTYVTEQRTL-DTFSSKCIIQGSGKVLGEGIGRSKKISEHR 550

Query: 536 AASDAL 541
           +ASDAL
Sbjct: 551 SASDAL 556

>TBLA0C06260 Chr3 (1515789..1518101) [2313 bp, 770 aa] {ON} 
          Length = 770

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 120/261 (45%), Gaps = 45/261 (17%)

Query: 32  YNDFPIITSTYLEAMIPLHR-------------------ENLEFVGEKWLSALLSRILCH 72
           Y  +PI+++  LE +  +HR                   E LEF+G+ WL AL+S I+  
Sbjct: 99  YIRYPIVSNPELEHLAFIHRSYTSMNVNLTEEQKIIMSNERLEFLGDSWLGALVSYIIYV 158

Query: 73  RFSFSKQNTLEKLENAMLSNEALNVLLSKIRLPEKF-NNI----------------EGFK 115
           ++  + +  L K++ A+++N  L     ++   ++  NNI                +  +
Sbjct: 159 KYPTANEGALSKMKEAIVNNINLYEWSGQLGFRDRLQNNIPAASMKVKDKLSKRYADCVE 218

Query: 116 AYIGALVQDEDGPAMKTIITWLAEVRDAQLTQLKNANLKVLYPSDYKQQLIELLENNKSN 175
           AYIGALV D  G   K +  WL  +   +L ++    L+  +  + K +L   L+ NK  
Sbjct: 219 AYIGALVVDRYGSEYKDLTDWLYSLSQDKLDEISPGLLRYDFNKNAKGELASYLQANKLG 278

Query: 176 HEVSFISKNIGGKYVSSVHLGDTIL--SIGDPSNTTQETEHNVSKKVLNDQVLLSKHSIF 233
            +V ++  N    + +   LGD +L  ++G   +  +E E   +   L+++ L+ ++S F
Sbjct: 279 AKVHYVRLNDSTPFRAQALLGDIVLGEAVG---HNAREAEQRAAMVALSNRELIQQYSSF 335

Query: 234 STVD----SAEKTPNNLVSTA 250
              D    + E+TP++  S A
Sbjct: 336 DLEDLNGPTIEETPSSASSIA 356

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 467 DFNIPIKSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFSTVTVKHVPDLTLGRGRR 526
           + N  +K   D  A   LYK L     +P+Y +I+     F S  TVK V    LG G  
Sbjct: 684 NMNSTVKIPSDNNAMEVLYKALTKEQLYPDY-SIEDHAKGFLSVCTVKGVGTY-LGEGFG 741

Query: 527 TNKKIDEQVAASDALQ 542
            NKK+ +  AA DA++
Sbjct: 742 RNKKLAKHHAAQDAIR 757

>SAKL0B05566g Chr2 complement(482433..483950) [1518 bp, 505 aa] {ON}
           similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 505

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 63/134 (47%), Gaps = 20/134 (14%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+  ++ IL +RF    +  L +L   ++SNE L       R  
Sbjct: 223 MIKAHNERLEFLGDSILNTTITMILYNRFPHFSEGQLSQLRMKLISNERLKKWSFMYRFN 282

Query: 106 EKF--------NNIEG-----------FKAYIGALVQDEDGPAMKTIITWLAEVRDAQLT 146
           EK          N+E            F+AYIG L++D+    ++ +  WL+++ D  + 
Sbjct: 283 EKLKTNLDNKPENVEFQLGKQKLFADVFEAYIGGLIEDDPKSNLRRVRKWLSKLADPVIE 342

Query: 147 QLKNANLKVLYPSD 160
           ++    +  L P+D
Sbjct: 343 EVMKKEI-ALAPTD 355

>Ecym_1482 Chr1 complement(995669..997192) [1524 bp, 507 aa] {ON}
           similar to Ashbya gossypii AFR538C
          Length = 507

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 20/126 (15%)

Query: 45  AMIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRL 104
           AMI  H E LEF+G+  L+  ++ I+ ++F    +  L +L   +++NE L       RL
Sbjct: 268 AMIKAHNERLEFLGDSILNTTMTMIIYNKFPSFNEGRLSQLRMKLINNERLKEWSFMYRL 327

Query: 105 P-------EKFNNI------------EGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQL 145
           P       E  NN             + F+AYIG L++D+    +  +  WLA + +  +
Sbjct: 328 PSMLKTNVETINNTPDFLNGKLKLYADVFEAYIGGLIEDDPKKNLPKVRKWLAALSEPVI 387

Query: 146 -TQLKN 150
            T+++N
Sbjct: 388 QTEMEN 393

>ZYRO0F12342g Chr6 complement(1005809..1007179) [1371 bp, 456 aa]
           {ON} similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 456

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 96/218 (44%), Gaps = 39/218 (17%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALN------VLL 99
           MI  H E LEF+G+  L+ +++ I+ ++F    +  L KL   ++SNE L        L 
Sbjct: 213 MIKAHNERLEFLGDSVLNTVITMIIYNKFPRYTEGQLSKLRMTLVSNERLKEWTFMYGLE 272

Query: 100 SKIR-----LPEKFNNIEG--------FKAYIGALVQDEDGPAMKTIITWLAE------- 139
            K+R       E  N  +G        F+AYIG L++D+    M  +  WL++       
Sbjct: 273 KKLRTNFDMTKENANFQQGKRKLYADVFEAYIGGLIEDDPKHNMPRVRKWLSKLAKPVMD 332

Query: 140 ---VRDAQLTQLKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISK--NIGGKYVSSVH 194
              V+D  L   ++ +L      + K+QL  L+     N     + +  N     V    
Sbjct: 333 EVTVKDVGLESTEDLDL------NAKRQLYSLIGFAALNLHYVTVKRPTNTDPNTVVECR 386

Query: 195 LGD-TILSIGDPSNTTQETEHNVSKKVLNDQVLLSKHS 231
           +GD T+L  G+  N  +      ++ VL D+ +L K+S
Sbjct: 387 VGDGTVLGSGEGRN-IKIAGLKAAQNVLKDKAVLEKYS 423

>TPHA0I00710 Chr9 (143903..145363) [1461 bp, 486 aa] {ON} Anc_8.779
           YMR239C
          Length = 486

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 29/137 (21%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           M+  H E LEF+G+  L+ +++ IL ++F    +  L  L   ++SNE +        LP
Sbjct: 230 MVNTHNERLEFLGDSILNTVITMILYNKFPTFSEGQLSSLRRHLVSNECIKKWSYLYDLP 289

Query: 106 -----------EKFNNIEG--------FKAYIGALVQDEDGPAMKTIITWLAEV------ 140
                      +K N   G        F+AYIG L++D+    M  +  WL+++      
Sbjct: 290 GNLKTNLETEQDKLNFHYGHKKIHADVFEAYIGGLIEDDPKHNMPKVRKWLSKLAKPIID 349

Query: 141 ----RDAQLTQLKNANL 153
               +D  L Q  N NL
Sbjct: 350 ELTKKDISLQQPDNLNL 366

>KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {ON}
           Anc_8.779 YMR239C
          Length = 623

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 19/113 (16%)

Query: 44  EAMIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLS--- 100
           E M+  H E LEF+G+  L+AL++ I+ ++F       L KL   +++NE L    S   
Sbjct: 317 EEMLHAHNERLEFMGDSVLNALVTNIIYNQFPQYGDGQLSKLRIELVNNERLKEWASMYG 376

Query: 101 ---KIRLPE-------KFNN------IEGFKAYIGALVQDEDGPAMKTIITWL 137
              K+R  E       KF N       + F+AYIGAL++++    +  I  WL
Sbjct: 377 LDKKLRFKELSERARSKFLNGKQKLHADVFEAYIGALMEEDPKGNLLNIREWL 429

>KLLA0F24816g Chr6 (2308342..2309778) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q02555 Saccharomyces cerevisiae YMR239C RNT1
           RNAase III cleaves a stem-loop structure at the 3' end
           of U2 snRNA to ensure formation of the correct U2 3' end
          Length = 478

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 16/126 (12%)

Query: 44  EAMIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIR 103
           + +I  H E LEF+G+  L+  ++ I+ ++F    +  L +L   +++NE L       +
Sbjct: 223 QEIIRSHNERLEFLGDSILNTTMTTIIYNKFPHFDEGQLSQLRMRLINNELLKEWSFLYK 282

Query: 104 LPEKF--------NNIEG--------FKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQ 147
            P++         +N +G        F+AYIG LV+D     +  I  WLA++ +  +++
Sbjct: 283 FPDELKTHNVKPDDNKDGKQKLYADVFEAYIGGLVEDNGKKNLPKIRKWLAKLAEPVISK 342

Query: 148 LKNANL 153
             N+++
Sbjct: 343 GLNSDI 348

>KLTH0H15180g Chr8 complement(1317079..1318563) [1485 bp, 494 aa]
           {ON} similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 494

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+  ++ IL ++F    +  L KL   ++SNE L       +  
Sbjct: 219 MIKAHNERLEFLGDSILNTTITMILYNKFPHLSEGQLSKLRMKLISNERLKKWSFLYKFN 278

Query: 106 EKF---------NN----------IEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           EK          NN           + F+AYIG L++D+    +  +  WL+++
Sbjct: 279 EKLRTNLDKTCENNDFKHGKQKLYADVFEAYIGGLIEDDPKHNLPKVRKWLSKL 332

>KNAG0J00680 Chr10 (115634..117043) [1410 bp, 469 aa] {ON} Anc_8.779
           YMR239C
          Length = 469

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 19/107 (17%)

Query: 50  HRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEAL----------NVLL 99
           H E LEF+G+  ++ ++++I+  RF       L  L   +++N  +          N+L 
Sbjct: 213 HNERLEFLGDSVMNFVVTKIIYKRFPSYDDGQLTILRQKLINNNQIREFSELYGLSNMLR 272

Query: 100 SKIRLPEKFNNIEG---------FKAYIGALVQDEDGPAMKTIITWL 137
           S I L  KF++ +          F++YIG LV+D+    ++T+  WL
Sbjct: 273 SNINLFGKFSDYQTGKKKVEADVFESYIGGLVEDDPENHLETVYRWL 319

>AFR538C Chr6 complement(1404410..1405708) [1299 bp, 432 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR239C
           (RNT1)
          Length = 432

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 20/115 (17%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+  ++ I+ ++F    +  L +L   +++N+ L       +LP
Sbjct: 200 MINSHNERLEFLGDSILNTTMTMIIYNKFPGFNEGRLSQLRTKLINNDRLKEWSFMYQLP 259

Query: 106 EKFN-NIEG-------------------FKAYIGALVQDEDGPAMKTIITWLAEV 140
            K   NIE                    F+AYIG LV+++    +  I  WLA++
Sbjct: 260 SKLRTNIEMFNGTTHEVSNGKLKLYADVFEAYIGGLVEEDGKKNLPRIRKWLAKL 314

>Kwal_34.15922 s34 (115736..117226) [1491 bp, 496 aa] {ON} YMR239C
           (RNT1) - Ribonuclease III [contig 272] FULL
          Length = 496

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+  ++ IL ++F    +  L KL   ++SNE L       +  
Sbjct: 219 MIKAHNERLEFLGDSILNTTITMILYNQFPHLTEGQLSKLRMKLISNERLKKWSFLYKFN 278

Query: 106 EKFNN-------------------IEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           EK                       + F+AYIG L++D+    +  +  WL+++
Sbjct: 279 EKLRTNLDKTCENSDFRQGKQKLYADVFEAYIGGLIEDDPKHNLPKVRKWLSKL 332

>Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON}
           (8627..10063) [1437 nt, 479 aa]
          Length = 478

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+ +++ I+ ++F    +  L KL   ++SNE +          
Sbjct: 220 MINAHNERLEFLGDSVLNTIMTMIIYNKFPTFTEGQLSKLRMNLVSNERIKSWTYLYNFD 279

Query: 106 EK-------------FNN------IEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           +K             F N       + F+AYIG L++D+    M  +  WL ++
Sbjct: 280 KKLKTNFDLGNDKSHFQNGKQKLYADVFEAYIGGLIEDDPKHNMPKVRKWLTKL 333

>TDEL0B03300 Chr2 (588444..589889) [1446 bp, 481 aa] {ON} 
          Length = 481

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEAL---------- 95
           MI  H E LEF+G+  L+ +++ I+ ++F    +  L KL   ++SNE +          
Sbjct: 223 MINAHNERLEFLGDSVLNTVMTMIIYNKFPRFTEGQLSKLRMGLVSNERIKTWSFLYDFD 282

Query: 96  -----NVLLSK----IRLPEKFNNIEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
                N  ++K     +  ++    + F+AYIG L++D+    M  +  WL+++
Sbjct: 283 KHLKTNFDVTKDNACFQQGKRKLYADVFEAYIGGLIEDDPKHNMPKVRKWLSKL 336

>Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {ON}
           YMR239C (REAL)
          Length = 469

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+++++ I+ ++F    +  L  L   ++SNE +       +  
Sbjct: 230 MINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWAIMYKFH 289

Query: 106 EK-------------FNN------IEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           EK             F N       + F+AYIG L++D+    +  I  WL ++
Sbjct: 290 EKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKL 343

>Smik_13.451 Chr13 complement(732656..734074) [1419 bp, 472 aa] {ON}
           YMR239C (REAL)
          Length = 472

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+++++ I+ ++F    +  L  L   ++SNE +          
Sbjct: 233 MINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFH 292

Query: 106 EK-------------FNN------IEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           EK             F N       + F+AYIG L++D+    +  I  WL ++
Sbjct: 293 EKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKL 346

>Skud_13.410 Chr13 complement(723047..724471) [1425 bp, 474 aa] {ON}
           YMR239C (REAL)
          Length = 474

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNV-------- 97
           MI  H E LEF+G+  L+++++ I+ ++F    +  L  L   ++SNE +          
Sbjct: 235 MINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYHFH 294

Query: 98  --LLSKIRLPEKFNNIEG---------FKAYIGALVQDEDGPAMKTIITWLAEV 140
             L +   L ++ +N +          F+AYIG L++D+    +  I  WL ++
Sbjct: 295 ERLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKL 348

>CAGL0M05159g Chr13 complement(556347..557696) [1350 bp, 449 aa]
           {ON} similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239c RNT1 double-stranded ribonuclease
          Length = 449

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 14/109 (12%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           +I  + E LEF+G+  L+ +++ I+ ++F    +  L +L   ++ NE L        LP
Sbjct: 209 IIKSNNERLEFLGDSILNTVMTMIIYNKFPSLNEGNLTELRKKLVKNETLREWSELYELP 268

Query: 106 EKF--------------NNIEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           ++                + + F+AYIG L++D+    +  I  WL ++
Sbjct: 269 KQLKSNLSPDVDLSTSKTSADIFEAYIGGLMEDDPKTNLVKIRKWLKKL 317

>YMR239C Chr13 complement(748262..749677) [1416 bp, 471 aa] {ON}
           RNT1RNAase III; involved in rDNA transcription and rRNA
           processing; also cleaves a stem-loop structure at the 3'
           end of U2 snRNA to ensure formation of the correct U2 3'
           end; involved in polyadenylation-independent
           transcription termination
          Length = 471

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 19/114 (16%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKIRLP 105
           MI  H E LEF+G+  L+++++ I+ ++F    +  L  L   ++SNE +          
Sbjct: 232 MINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFH 291

Query: 106 EK-------------FNN------IEGFKAYIGALVQDEDGPAMKTIITWLAEV 140
           EK             F N       + F+AYIG L++D+    +  I  WL ++
Sbjct: 292 EKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKL 345

>TBLA0B02870 Chr2 (660516..661961) [1446 bp, 481 aa] {ON} Anc_8.779
           YMR239C
          Length = 481

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 16/111 (14%)

Query: 46  MIPLHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALN------VLL 99
           M+  H E LE++G+  L+  +S I+ ++F    +  L KL   +++NE L        L 
Sbjct: 239 MLNAHNERLEWLGDSILNTTISTIIYNKFPNYSEGKLSKLRIMLINNENLREWTYLYGLE 298

Query: 100 SKIRLPEKFNNIEG----------FKAYIGALVQDEDGPAMKTIITWLAEV 140
             I+  +      G          F+AYIG L++D+    +  I  WLA++
Sbjct: 299 KGIKAAKSGEQKNGSLSAKAYADVFEAYIGGLMEDDAQKNLPKIRKWLAKL 349

>KAFR0C03740 Chr3 (763425..765614) [2190 bp, 729 aa] {ON} 
          Length = 729

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 119/284 (41%), Gaps = 51/284 (17%)

Query: 36  PIITSTYLEAMIPL-----HREN---------LEFVGEKWLSALLSRILCHRFSFSKQNT 81
           P+IT   L+ M+       H +N         LEF+G  +L   +S +L  +F  S  + 
Sbjct: 105 PVITDPQLKNMLAQKFSKQHAQNTAGLCQDIRLEFIGSFFLKLFISILLLRKFPNSTNDV 164

Query: 82  LEKLENAMLSNEAL-----NVLLSKIRLPEKFN--NIEGFKAYIGALVQDEDGPAMKTII 134
           L   E  + +++ L     +    K   P   N   I  FK YIG LV D        +I
Sbjct: 165 LLSTEQKIFTSDNLLSWYTSAGFDKSGSPFHSNEAKIAYFKKYIGGLVLDNIACGYLHVI 224

Query: 135 TWLAEVRDAQLTQLKNANLKVLYPS--------DYKQQLIELLENNKSNHEVSFISKNIG 186
            WL  +       L+N +LK++ P+         +K++LI+ +++    H ++ I +   
Sbjct: 225 DWLGAL-------LEN-DLKIVEPTMSYESSFVKHKRKLIDYVKSKFPEHTIASIERVND 276

Query: 187 GKYVSSVHLGDTILSIGDPSNTTQETEHNVSKKVLNDQVLLSKHS---------IFSTVD 237
             +   V +G   L+    +N+    E N S K + +    ++++         +FS ++
Sbjct: 277 DAFDIEVKVGGITLARC-KNNSRDLAEENASMKAIQEIAYSNEYAEYKNILDRVLFSDIN 335

Query: 238 SA-EKTPNNLVSTANTDPELLTR---KIMESVNEKVASIVSQIT 277
           +  E  P   +S A       +R   K M+ V++  +S   +I+
Sbjct: 336 AMLESAPKKRISEAGKSDAQNSRKKAKQMKKVSQAASSFERRIS 379

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 473 KSVCDKLAKFNLYKELGVRNHFPEYVTIQLGLNDFFS-TVTVKHVPDLTLGRGRRTNKKI 531
           K V DK +K  L+  LG     P Y T       F S   TV    ++ LG G   +K+I
Sbjct: 636 KLVFDKSSKQKLHSLLGKLKDHPRYETAHHTKTHFISRCFTVG--GNMLLGTGAGKSKQI 693

Query: 532 DEQVAASDALQNKKYKTKLMGRN 554
            EQ AASDAL       KL+ R+
Sbjct: 694 AEQKAASDALH------KLLARD 710

>CAGL0I09636g Chr9 complement(921232..923436) [2205 bp, 734 aa] {ON}
           some similarities with uniprot|Q02555 Saccharomyces
           cerevisiae YMR239c double-stranded ribonuclease
          Length = 734

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 19/120 (15%)

Query: 52  ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEAL-----------NVLLS 100
           E LEF+G+  ++++++ I+   F       + +L   ++SN  L           ++L+ 
Sbjct: 457 ERLEFLGDSVINSIMTTIIYKSFPNYDAGQMTRLRVLLVSNRRLEKWAYLYGLQKHLLIR 516

Query: 101 KIRLPEKFNN--------IEGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQLKNAN 152
           K  L E  N+         + F+AY+G LV+D+    M  I  WL+ + +  +  + + N
Sbjct: 517 KSILNEMLNSGSKVYKIYADLFEAYVGGLVEDDPTGNMPKIRDWLSTLAEEAIKTISDKN 576

>NDAI0K02960 Chr11 complement(672616..674001) [1386 bp, 461 aa] {ON}
           
          Length = 461

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 6/95 (6%)

Query: 49  LHRENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNVLLSKI------ 102
           L+ + L  +GE WL+++L+ +L  +F      +L    N +L N+     ++ +      
Sbjct: 131 LYFDRLTALGEVWLTSILTNVLFKQFPLIDSKSLTSKVNEILKNKNTRFWINGVNSLKFF 190

Query: 103 RLPEKFNNIEGFKAYIGALVQDEDGPAMKTIITWL 137
            L    N    FK YIG+L+ D +G     +  W+
Sbjct: 191 ELGTTTNYPLVFKQYIGSLIIDNNGSPPPDVTEWI 225

>NDAI0K00820 Chr11 (183793..185346) [1554 bp, 517 aa] {ON} Anc_8.779
           YMR239C
          Length = 517

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 78/181 (43%), Gaps = 24/181 (13%)

Query: 52  ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEAL---------------- 95
           E LEF+G+  L+ +++ I+  +F    +  L  L   ++ N+ L                
Sbjct: 257 ERLEFLGDSILNTIMTTIIYDKFPDYNEGQLSYLRTELVRNKCLKEWSYLYGFDKKLKAD 316

Query: 96  -NVLLSKIRLPEKFNNIEGFKAYIGALVQDEDGPAMKTIITW---LAEVRDAQLTQLK-N 150
            N LL+      K    + F+AYIG L++D+    +  I  W   LAE   A++T+ K  
Sbjct: 317 INFLLAHDDKGAKKYIADIFEAYIGGLMEDDPVRNLPRIRKWLKKLAEPVIAEVTKTKVG 376

Query: 151 ANLKVLYPSDYKQQLIELLENNKSN-HEVSFIS-KNIGGKYVSSVHLGD-TILSIGDPSN 207
              K     + K++L  L+     N H V   +  NI  + +    +GD T+L  G   N
Sbjct: 377 VTAKETKDVNAKRELYSLIGYAALNLHYVPIKTPTNIESEAIVECRVGDGTVLGRGVAKN 436

Query: 208 T 208
           T
Sbjct: 437 T 437

>NCAS0C00790 Chr3 (137927..139954) [2028 bp, 675 aa] {ON} Anc_8.779
           YMR239C
          Length = 675

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/113 (19%), Positives = 53/113 (46%), Gaps = 16/113 (14%)

Query: 52  ENLEFVGEKWLSALLSRILCHRFSFSKQNTLEKLENAMLSNEALNV------LLSKIRLP 105
           E LEF+G+  L+ +++ I+ ++F    +  L +L   ++ N+ +           ++++ 
Sbjct: 383 ERLEFLGDSILNTVMTMIIYNKFPHYNEGELSRLRVELVRNDCIKKWSFMYGFDKRLKIG 442

Query: 106 EKFNN----------IEGFKAYIGALVQDEDGPAMKTIITWLAEVRDAQLTQL 148
             F             + F+AYIG L++++    +  I  WL ++ +  + +L
Sbjct: 443 NTFTYDSAHTDKKLIADTFEAYIGGLMEEDPKKNLPKIRKWLQKLAEPVIEKL 495

>KLLA0D09977g Chr4 complement(841852..843756) [1905 bp, 634 aa] {ON}
           similar to uniprot|P40969 Saccharomyces cerevisiae
           YMR168C CEP3 Essential kinetochore protein component of
           the CBF3 complex that binds the CDEIII region of the
           centromere contains an N-terminal Zn2Cys6 type zinc
           finger domain a C-terminal acidic domain and a putative
           coiled coil dimerization domain
          Length = 634

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 57/138 (41%), Gaps = 36/138 (26%)

Query: 129 AMKTIITWLAEVRDAQLTQ-LKNANLKVLYPSDYKQQLIELLENNKSNHEVSFISKNIGG 187
            ++TI T   +VR  Q+   L N N   +YPS         L NN   H +  ++K +G 
Sbjct: 250 VLRTIFTLPPDVRTLQIFLILSNTNFLQIYPS---------LGNNILVHCIH-LAKVLGI 299

Query: 188 KYVSSVHLGDTILSIGDPSNTTQETEHNVSKKVLNDQVLLSKHSIF---STVDSAEKTPN 244
           K        D  L I D  +T  +               LS H+I+   STVD    +PN
Sbjct: 300 K--------DFKLKINDSGSTRLQK--------------LSMHNIWFRLSTVDYMRSSPN 337

Query: 245 NLVSTANTDPELLTRKIM 262
            +++    +   LTRK +
Sbjct: 338 KIIALHTDNSSALTRKTL 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,123,542
Number of extensions: 2954822
Number of successful extensions: 11334
Number of sequences better than 10.0: 195
Number of HSP's gapped: 11902
Number of HSP's successfully gapped: 219
Length of query: 595
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 480
Effective length of database: 40,294,809
Effective search space: 19341508320
Effective search space used: 19341508320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)