Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001201.4ON39939919200.0
KNAG0C001901.4ON4424552983e-29
ZYRO0F18502g1.4ON4504732942e-28
TDEL0C069801.4ON4264552271e-19
SAKL0C00440g1.4ON4624812226e-19
YCL063W (VAC17)1.4ON4234592065e-17
Skud_3.21.4ON4264592003e-16
Suva_3.1511.4ON4214671961e-15
NCAS0B091201.4ON4334591933e-15
Smik_3.131.4ON4254611827e-14
CAGL0B00308g1.4ON4302401755e-13
KLLA0C00462g1.4ON4604781542e-10
NDAI0A001301.4ON4785031435e-09
Kpol_2002.71.4ON4744901312e-07
KLTH0F00462g1.4ON4512271142e-05
Kwal_33.130031.4ON4492301142e-05
TPHA0E040201.4ON5402221142e-05
TBLA0A075801.4ON5131531052e-04
ZYRO0C09218g7.286ON53139741.4
NCAS0A136307.265ON274113703.0
Suva_13.4728.848ON510129695.6
NDAI0A004301.42ON43839686.8
YDL178W (DLD2)7.286ON53038678.7
NOTE: 2 genes in the same pillar as KAFR0D00120 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00120
         (399 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...   744   0.0  
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   119   3e-29
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   117   2e-28
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...    92   1e-19
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...    90   6e-19
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...    84   5e-17
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)       82   3e-16
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...    80   1e-15
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    79   3e-15
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)    75   7e-14
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...    72   5e-13
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    64   2e-10
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...    60   5e-09
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....    55   2e-07
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    49   2e-05
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    49   2e-05
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    49   2e-05
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    45   2e-04
ZYRO0C09218g Chr3 complement(700063..701658) [1596 bp, 531 aa] {...    33   1.4  
NCAS0A13630 Chr1 (2680770..2681594) [825 bp, 274 aa] {ON} Anc_7....    32   3.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...    31   5.6  
NDAI0A00430 Chr1 (73040..74356) [1317 bp, 438 aa] {ON} Anc_1.42 ...    31   6.8  
YDL178W Chr4 (139522..141114) [1593 bp, 530 aa] {ON}  DLD2D-lact...    30   8.7  

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/399 (93%), Positives = 375/399 (93%)

Query: 1   MASLVSDTLLQRSEEAVSQLESWLKQQEQLHQTTAEYKQLNSLCAKSKYISNLLKDDSSS 60
           MASLVSDTLLQRSEEAVSQLESWLKQQEQLHQTTAEYKQLNSLCAKSKYISNLLKDDSSS
Sbjct: 1   MASLVSDTLLQRSEEAVSQLESWLKQQEQLHQTTAEYKQLNSLCAKSKYISNLLKDDSSS 60

Query: 61  IPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHTSPQSTIDSFEPKPLNLLRKNKILE 120
           IPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHTSPQSTIDSFEPKPLNLLRKNKILE
Sbjct: 61  IPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHTSPQSTIDSFEPKPLNLLRKNKILE 120

Query: 121 SPTRSSPVTRGRLERKISINLFPMHTTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGL 180
           SPTRSSPVTRGRLERKISINLFPMHTTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGL
Sbjct: 121 SPTRSSPVTRGRLERKISINLFPMHTTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGL 180

Query: 181 NGDYINPFKENNRLSIXXXXXXXXXXXXXXXXXXXXXXXXTVLVTSPFLTNPKQKLKRSN 240
           NGDYINPFKENNRLSI                        TVLVTSPFLTNPKQKLKRSN
Sbjct: 181 NGDYINPFKENNRLSISFFNGDNTFNDNNSDSESDIDDDDTVLVTSPFLTNPKQKLKRSN 240

Query: 241 SQDSVFWNENYLRKPSFQKQLNLFPSTLTKPTAELSSTQVFLKNTGRLGSSSKALLTSFV 300
           SQDSVFWNENYLRKPSFQKQLNLFPSTLTKPTAELSSTQVFLKNTGRLGSSSKALLTSFV
Sbjct: 241 SQDSVFWNENYLRKPSFQKQLNLFPSTLTKPTAELSSTQVFLKNTGRLGSSSKALLTSFV 300

Query: 301 KDNLQQQQRTHNASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKK 360
           KDNLQQQQRTHNASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKK
Sbjct: 301 KDNLQQQQRTHNASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKK 360

Query: 361 SRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFLY 399
           SRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFLY
Sbjct: 361 SRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFLY 399

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 138/455 (30%), Positives = 215/455 (47%), Gaps = 81/455 (17%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQL-----------------HQTTAEYKQLNSLCAKS 47
           V+D LL RS++A+ QLE W++QQE+L                  Q      QLNSLC +S
Sbjct: 7   VTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLCLRS 66

Query: 48  KYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT----HTSP--QST 101
           +YI   L  + +      + +  RS+I E+L++EF +I+  LNE+      + SP  Q+T
Sbjct: 67  RYIKEKLASERNICS---IRKGRRSYI-ENLVYEFQDIAMSLNELSETNRKNGSPVSQAT 122

Query: 102 I---DSFEPKPLNLLRKNKILESPTRSSPVTRG----RLERKISINLFPMHTTTKC--NS 152
               DSFEPKPL +L + +   +    SP  R     ++ R+   + F       C  +S
Sbjct: 123 TNSSDSFEPKPLRILERQRTCNA---KSPTKRNSNHIKIPRETEKSDF-TENVADCLHSS 178

Query: 153 VPTSPKCKSTSTLNQRTLRNIKSYHYGLNGD-------YINPFKENNRLSIXXXXXXXXX 205
           +P+SP   S  +  Q+T+R  KSYH  LNG         +NPF   NRLS+         
Sbjct: 179 LPSSPLRGSNGS--QQTIRLTKSYHESLNGQKPTSHSPLMNPFNAKNRLSL--YLFDNID 234

Query: 206 XXXXXXXXXXXXXXXTVLVTSPFLTNPK--QKLKRSNSQDSVFWNENYLRKPSFQKQLNL 263
                          TV+  SP ++     + L+R NS +S+          S  ++L  
Sbjct: 235 EKELTPCDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQKLQF 294

Query: 264 FPSTLTKPTAE----LSSTQVFLKNTGRLGSSSKALLTSFVKDNLQQQQRTHNASSFN-- 317
           +PS     T+     +SS  V+ K    + S SK LL+S    + +  + T   S FN  
Sbjct: 295 YPSATNGTTSAQSVFVSSKPVYTKPLS-VQSRSKDLLSSIA--HAEASKDTKTTSVFNGW 351

Query: 318 NIFN-----SVTSEIGKSKLD--KSQIIHTERRVLSDNSIVISTLITSKKSRFNRFSSV- 369
           N+F      ++TSE+G   +   K   I T RR ++ +++VIS   TS + R +R SSV 
Sbjct: 352 NLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGDTLVIS---TSNRPRLSR-SSVR 407

Query: 370 ------DNISPTKKPIINNDVQYSDLNDALNTEFL 398
                  + SP   PI+++ V+ ++L++AL TE L
Sbjct: 408 QPHGYNRHTSPI-TPIVDHQVRQNELSEALETELL 441

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  117 bits (294), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 139/473 (29%), Positives = 219/473 (46%), Gaps = 99/473 (20%)

Query: 1   MASL--VSDTLLQRSEEAVSQLESWLKQQEQLHQTTAEY-------------KQLNSLCA 45
           M SL  +S+ L  RS+EAV QLE W+++Q+ L +   E+              QLNSLC 
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV 60

Query: 46  KSKYISNLLKDD-SSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHTSPQST--- 101
           +S+Y+ + L     +  P  + EQ      +E L++EF +I+ KLNE+  +   Q T   
Sbjct: 61  RSEYVRDKLNAGYQNRKPPIVNEQN----YIEDLVYEFQDITVKLNELAQNQKEQVTPSS 116

Query: 102 ------IDSFEPKPLNLLRKNKILESPTRSSPV-TRGRLERK--ISINLFPMHTTTKCNS 152
                 ++SF+P+PL +  + +     TR SP    G+L+    +  +L  +   +KC S
Sbjct: 117 KHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTS 176

Query: 153 VPTSP-KCKSTSTLNQRTLRNIKSYHYGLNG------------DYINPFKENNRLSIXXX 199
           +P SP K +S   L  R LR  KSY  GLN             + ++ FKEN RLSI   
Sbjct: 177 LPGSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSI--- 233

Query: 200 XXXXXXXXXXXXXXXXXXXXXTVLVTSPF---------LTNPKQKLKRSNSQDSVFWNEN 250
                                TV+ TSP          + + K  L+R NS DSV   + 
Sbjct: 234 ----TFCDDIDEGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTK- 288

Query: 251 YLRKPSFQKQLNLFPSTLTKPTAE--------LSSTQVFLKNTGRLGSSSKALLTSFVKD 302
            ++  S  K     P+ LT PTA         +SS  +     G+  +SSK LL+SF+ +
Sbjct: 289 -VQPISSAK----CPTFLTIPTANRPSMKSVTVSSAPIISSTGGK--ASSKDLLSSFISN 341

Query: 303 NLQQQQRTHNASSFNNIFNS-VTSEIGKSKLDKS----------QIIHTERRVLSDNSIV 351
                ++  N +  NN F+S +   + K K  K+          Q + +ER+   +N ++
Sbjct: 342 TQDYDKKARNDNGNNNRFSSNLIWNLFKQKSQKNRNPTPLRVPQQDVTSERK---ENQLL 398

Query: 352 IS---TLITSKKSRF---NRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFL 398
            +   + + S  SR    N+ SS+  ISPT++ I N +  Y +L +AL+TE +
Sbjct: 399 TTSHPSGVYSSCSRLLVKNQNSSI--ISPTRQRITNGNTMYDELQEALDTELV 449

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 125/455 (27%), Positives = 200/455 (43%), Gaps = 100/455 (21%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQL------------HQTTAEYKQLNSLCAKSKYISN 52
           +S+ LL RS+EA+ QLE W+++Q+ L            +Q      QLNSLC +S+Y+ +
Sbjct: 6   LSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVRSEYVRD 65

Query: 53  LL---KDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIV---------THTSPQS 100
            L   ++   SI +D      R +I E L+ EF +I+ KLNE+          +  S +S
Sbjct: 66  KLNKERERRMSIIND------RKYI-EDLVFEFQDITVKLNELAQSQSIDSTPSSKSTRS 118

Query: 101 TIDSFEPKPLNLLRKN-----KILESPTRSSPVTRGRLERKISINLFPMH-----TTTKC 150
           ++ SF+P+PL L  ++      + ESP ++  V +       S+    +H       +KC
Sbjct: 119 SLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIK-------SVKFSGLHDSKEEAVSKC 171

Query: 151 NSVPTSPKCKSTSTLNQRTLRNIKSYHYGLNG----------DYINP--FKENNRLSIXX 198
            S+P SP   +  T   R++R  KSY  GLN           DY  P  F+EN RLSI  
Sbjct: 172 LSLPGSPVRVTGPT---RSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSI-- 226

Query: 199 XXXXXXXXXXXXXXXXXXXXXXTVLVTSPFLTNPKQKLKRSNSQDSVFWNENYLRKPSFQ 258
                                 TV+   P        L+R NS +S+        K    
Sbjct: 227 -----TVFDDFDEDADSTSDQDTVISLVPADDGKGLPLRRFNSHESILST-----KVQPI 276

Query: 259 KQLNLFPSTL----TKP---TAELSSTQVFLKNTGRLGSSSKALLTSFV--------KDN 303
             L LF S L     +P   +  +SS  VF K +    +SS+ LL++FV           
Sbjct: 277 SSLPLFSSFLLPSSNRPSMKSVRVSSAPVFSKTSA--PASSRDLLSTFVTRPGKASNATG 334

Query: 304 LQQQQRTHNASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKKSRF 363
           ++Q+ +    +++ N F   +S     +  K +   +  R  S+++   S  +     R 
Sbjct: 335 IKQENKLGFFANW-NFFKGPSSASHDIRATKQKA--SASRPESNSADCRSKTLEKMAPR- 390

Query: 364 NRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFL 398
            RFS     SP K P+ ++ + Y DL +AL+TE +
Sbjct: 391 -RFSPR---SPVKAPVFDSLISYEDLREALSTEII 421

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 135/481 (28%), Positives = 212/481 (44%), Gaps = 115/481 (23%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQTTA-------------EYK----QLNSLCAKS 47
           +S  LL RS+EA+ QL+ ++++Q++L++                EY+    QLNSL  +S
Sbjct: 7   ISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLNSLHIRS 66

Query: 48  KYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT-----HTSPQS-- 100
           ++    L+D  +S  H   +  +    +  L+ EF +I+TKLNE+       + SP S  
Sbjct: 67  EH----LRDRIASTDHRASQDGDS---IGHLVTEFQKITTKLNELAATQDRAYQSPGSQS 119

Query: 101 --TIDSFEPKPLNLLRKNKILE--SPTR---SSPVTRGRLERKISIN---LFPMHTTTKC 150
             ++ SFEPKPL +L + K+    SPT+   + P     L +    +   +F  H+  K 
Sbjct: 120 TKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHS--KS 177

Query: 151 NSVPTSPKCKSTSTLN---QRTLRNIKSYHYGLN---------GDYINPFKENNRLSIXX 198
            S+P SP   ++S ++   +R  R+ KS   GLN          + +N FKEN RLSI  
Sbjct: 178 TSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLSISF 237

Query: 199 XXXXXXXXXXXXXXXXXXXXXXTVLVTSP-----FLTNPK-QKLKRSNSQDSVFWNENYL 252
                                 TV+  SP     F   PK + L+R NS +SV   +  L
Sbjct: 238 FDDEIDYSSDED----------TVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVL 287

Query: 253 RK--PSFQKQLNLFPS--TLTKPTAE--------LSSTQVFLKNTGRLGSSSKALLTSFV 300
               P+     +L+       KP AE        + ST   L++  +   +SK LL  FV
Sbjct: 288 PAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFV 347

Query: 301 KDNLQQQQRTHN---------ASSFNN--IFNS---VTSEIG------KSKLDKSQIIHT 340
               +Q+++T +          S F+   +FN+   VTSE G      K    +      
Sbjct: 348 SAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAP 407

Query: 341 ERRV---LSDNSIVISTLITSK-KSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTE 396
            +RV        +  S+LI     SRF        +SP  +P++NN V Y  L++AL TE
Sbjct: 408 AKRVPLGRRKTHLPSSSLIMGPNGSRF--------VSPPNEPVLNNKVSYDALHEALCTE 459

Query: 397 F 397
           F
Sbjct: 460 F 460

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 207/459 (45%), Gaps = 108/459 (23%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQ--LHQTTAEYKQLNSLCAK-SKYISNL--LKDDSS 59
           +++ LL RS+EA+ QL+ W+++Q++  + QTT + + L+ L  + ++Y+S L  L   S 
Sbjct: 9   ITERLLIRSQEAILQLDLWIQRQQRSSICQTT-DQESLDKLSQQYNQYMSQLNSLYVRSE 67

Query: 60  SIPHDLMEQKERSFI--------VESLIHEFNEISTKLNEIVT------HTSPQ-----S 100
           S+   L ++++R  I        +E L+ EF +I+ +LNE+ T      + SPQ     S
Sbjct: 68  SVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQSTRS 127

Query: 101 TIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMHTT---TKCNSVPTSP 157
           ++ SF+P+PL ++ + ++         VT  +  +K S+   P++     +K NS+P SP
Sbjct: 128 SLGSFQPRPLKIIERQRLCM-------VTPSKPPKK-SVGFNPINEVDCPSKTNSLPCSP 179

Query: 158 KCKSTSTLNQRTLRNIKSYHYGLNGD--------YINPFKENNRLSIXXXXXXXXXXXXX 209
           K +       RTLR  KS+  GLN          Y + FK   RLS+             
Sbjct: 180 KKQPA---RNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDEDFDS 236

Query: 210 XXXXXXXXXXXT---VLVTSPFLTNPKQKLKRSNSQDSVFWNENYLRKPSFQKQLNL--F 264
                      T   V VT+       + L+R NS +S+  N     KP+  K LNL  F
Sbjct: 237 DQDTIILPNISTPPHVGVTAKGAE--FEPLRRYNSHESILSN-----KPAPSKSLNLGSF 289

Query: 265 PSTLTKPT-----AELSSTQVFLKNT----------GRLGSSSKALLTSFVKDNLQQQQR 309
            ++  +P+       +S+ QV    T          G   SSSKALL+SF+  +     +
Sbjct: 290 SASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVK 349

Query: 310 THNA----SSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKKSRFNR 365
            +N     +SF + FNS  S I +S                           SK+ R N+
Sbjct: 350 ENNTNLKHASFMDKFNSSLSTISES-------------------------FQSKRGRKNK 384

Query: 366 FSSVD-----NISPTKKPIINNDVQYSDLNDALNTEFLY 399
             + +     N++  +K  ++  V   +L DALNTE L+
Sbjct: 385 GMNEERISNHNVAQEQKNNMDISVSIEELQDALNTELLF 423

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 122/459 (26%), Positives = 204/459 (44%), Gaps = 105/459 (22%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQT-TAEYKQLNSLCAK-SKYISNL--LKDDSSS 60
           +++ LL RS+EA+ QL+ W+++Q++     T++ + L+ L  + ++Y+S L  L   S S
Sbjct: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYVRSES 68

Query: 61  IPHDLMEQKERSFI--------VESLIHEFNEISTKLNEIVT-----------HTSPQST 101
           +   L ++++R  I        +E L+HEF +I+++LNE+ T             S +S+
Sbjct: 69  VRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSPQSQSTRSS 128

Query: 102 IDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMHTT---TKCNSVPTSPK 158
             SF+P+PL ++ + ++         VT  +  +K S+   P++     +K NS+P SPK
Sbjct: 129 SGSFQPRPLKIIERQRVCM-------VTPSKPPKK-SVGFNPINDVDCPSKTNSLPCSPK 180

Query: 159 CKSTSTLNQRTLRNIKSYHYGLN--------GDYINPFKENNRLSIXXXXXXXXXXXXXX 210
                    RTLR  KS+  GLN          Y + FK   RLS+              
Sbjct: 181 ---KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSL--------TFFDEM 229

Query: 211 XXXXXXXXXXTVLVTSPFLTNPK-----------QKLKRSNSQDSVFWNENYLRKPSFQK 259
                     T+++  P ++ P            + L+R NS +S+  N+     P    
Sbjct: 230 DDEDLDSDQDTIIL--PNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKP---APIMSL 284

Query: 260 QLNLFPSTLTKPT-----AELSSTQVFLKNT----------GRLGSSSKALLTSFVK--D 302
            L  FP +  KP+        S+ QV    T          G    SSKALL+SF+   D
Sbjct: 285 SLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPD 344

Query: 303 NLQQQQRTHN--ASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKK 360
            +  +Q   N   +SF + FNS  S I +S  +K      + + ++D  I          
Sbjct: 345 RIAAKQDPTNLKHTSFLDKFNSSLSTISESFQNKK---GKKNKDVNDGRI---------- 391

Query: 361 SRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFLY 399
           S  N  ++ +     KK I++  V   +L DALNTE L+
Sbjct: 392 SNLNHIATQEQ----KKNIMDMSVSIEELQDALNTELLF 426

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 124/467 (26%), Positives = 200/467 (42%), Gaps = 128/467 (27%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQ--------------EQLHQTTAEY-KQLNSLCAKSKY 49
           +++ LL RSEEA+ QL+ W+++Q              ++L Q   +Y  QLNSL  +S+ 
Sbjct: 9   ITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSLYVRSES 68

Query: 50  ISNLL-KDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT------HTSPQ--- 99
           + + L K+    +  +  E K     +E L+HEF +I+ +LN++ T      + SPQ   
Sbjct: 69  VRDKLSKEQWRRLNTEENEHKR----IEDLVHEFQDITVRLNDLATVPNKASNDSPQSQS 124

Query: 100 --STIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMHTT---TKCNSVP 154
             S++DSF+P+PL ++ + ++         VT  +  +K S+   P++     +K NS+P
Sbjct: 125 TRSSLDSFQPRPLKIIERQRLCV-------VTPSKPPKK-SVVFNPINDVECPSKTNSLP 176

Query: 155 TSPKCKSTSTLNQRTLRNIKSYHYGLN--------GDYINPFKENNRLSIXXXXXXXXXX 206
            SPK +        TLR  KS+  GLN          Y + FK   RLS+          
Sbjct: 177 CSPKKQPGKA---HTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSL--------TF 225

Query: 207 XXXXXXXXXXXXXXTVLVTSPFLTNPK-----------QKLKRSNSQDSVFWNENYLRKP 255
                         T+++  P ++ P            + L+R NS +S+  N+     P
Sbjct: 226 FDEMDDEDLDSDQDTIIL--PNISTPSHMDMATKGAEFEPLRRYNSHESILSNKP---AP 280

Query: 256 SFQKQLNLFPSTLTKPT-----AELSSTQV----------FLKNTGRLGSSSKALLTSFV 300
           +    L  FP    KP+       +S+ QV            K  G    +SKALL+SF+
Sbjct: 281 AMSLSLGSFP--FFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFI 338

Query: 301 K--DNLQQQQRTHN--ASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLI 356
              D +  +Q++ N   +SF + FNS  S I +S                          
Sbjct: 339 AQPDRIVVKQKSTNLKHTSFLDKFNSSLSTISES-------------------------F 373

Query: 357 TSKKSRFNRFSSVDNISPTKKPIINND-----VQYSDLNDALNTEFL 398
            +KK + +   + D I P   P  NN+     V   +L DALNTE L
Sbjct: 374 QNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTELL 420

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 115/459 (25%), Positives = 199/459 (43%), Gaps = 98/459 (21%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQ------------------------------LHQTT 34
           +S+ LL RS+EA+ QL+ W+++Q +                              L Q  
Sbjct: 7   ISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLEQYN 66

Query: 35  AEYKQLNSLCAKSKYISN-LLKDDSSSIPHDLMEQ----KERSFIVESLIHEFNEISTKL 89
               QLNSL  + ++I + L+   ++ I +  +E      E+ +I + L+HEF +I+ KL
Sbjct: 67  TYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYI-QDLVHEFQDITQKL 125

Query: 90  NEIVTHTSPQST----------IDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISI 139
           +E+ T  +P +           I+SF+PKPL ++ +     S T S    +  L++K+S 
Sbjct: 126 SELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISR-----SNTHSHLHQQTSLDKKVSF 180

Query: 140 NLFPMHTTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGLNGDYINPFKENNRLSIXXX 199
           N    +++   +    S    S S  N +++  +K   +  + D+        RLSI   
Sbjct: 181 NEDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIF 240

Query: 200 XXXXXXXXXXXXXXXXXXXXXTVLVTS---PFLTNPKQKLKRSNSQDSVFWNENYLRKPS 256
                                   V S   P        L+R NS +S+       RKP+
Sbjct: 241 DDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNSHESIL----SFRKPT 296

Query: 257 FQKQLN-LFP-STLTKPTAE---LSSTQVFLKNTGRLGSSSKALLTSFVK----DNLQQQ 307
             +Q N + P S++ +P+ +   ++S  +F +   R  ++SK LL+SF+     + L QQ
Sbjct: 297 QSRQPNQILPYSSVRQPSMQSVAVNSNPIFSR--MRPNATSKDLLSSFINKPQPNRLHQQ 354

Query: 308 QRTHNASS------FNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKKS 361
           +   N++S      F N FNSVTSEIG +                      + L  +  S
Sbjct: 355 KPKPNSNSLFGKWNFFNKFNSVTSEIGTT---------------------TTQLYPTNSS 393

Query: 362 RFNRFSSVD--NISPTKKPIINNDVQYSDLNDALNTEFL 398
             N+F+  D  + +  ++P+ ++ +   DLNDALNTE L
Sbjct: 394 MSNKFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELL 432

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 121/461 (26%), Positives = 196/461 (42%), Gaps = 112/461 (24%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQ-----------QEQLHQTTAEY----KQLNSLCAKSKY 49
           +++ LL RS+EA+ QL+ W+++           QE L + + +Y     QLNSL  +S+ 
Sbjct: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYVRSES 68

Query: 50  ISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEI------VTHTSPQ---- 99
           + + L  +       L+ +      +E L+ EF +I+ +LNE+      V + SPQ    
Sbjct: 69  VRDKLSKEQQ---RRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQST 125

Query: 100 -STIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMHTT---TKCNSVPT 155
            S+++SF+P+PL ++ + ++         VT  +  +K S+   P++     +K NS+P 
Sbjct: 126 RSSLESFQPRPLKIIERQRLCM-------VTPSKPPKK-SVGFNPINDVDCPSKTNSLPC 177

Query: 156 SPKCKSTSTLNQRTLRNIKSYHYGLN--------GDYINPFKENNRLSIXXXXXXXXXXX 207
           SPK +        TLR  KS+  GLN          Y + FK   RLS+           
Sbjct: 178 SPKKQPAKN---HTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSL--------TFF 226

Query: 208 XXXXXXXXXXXXXTVL---VTSPFLTNPKQK------LKRSNSQDSVFWNENYLRKPSFQ 258
                        TV+   +++P   N   K      L+R NS +S+  N+     P   
Sbjct: 227 DEMDDEDFDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKP---APLMS 283

Query: 259 KQLNLFPSTLTKPT-----AELSSTQVFLKNT----------GRLGSSSKALLTSFVK-- 301
             L  FP +  KP+       +S+ Q     T          G    SSKALL+SF+   
Sbjct: 284 HSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRS 343

Query: 302 DNLQQQQRTHNAS--SFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSK 359
           +    +Q T N    S  + FNS  + I +S     Q    + + L+D            
Sbjct: 344 ERPMVKQNTPNLKHVSLLDKFNSSLTTISES----FQSKKKKNKDLND------------ 387

Query: 360 KSRFNRFSSVDNISPTKK--PIINNDVQYSDLNDALNTEFL 398
                R SS+D+I    +   I++  V   +L DALNTE L
Sbjct: 388 ----ERISSLDHIGAHDRNNCIMDMSVSIEELQDALNTELL 424

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 114/240 (47%), Gaps = 52/240 (21%)

Query: 1   MASL--VSDTLLQRSEEAVSQLESWLKQQ----------------EQLHQTTAEY-KQLN 41
           MASL  +++ LL+RS EA+ QL+ W+  Q                E+L     E+ ++LN
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60

Query: 42  SLCAKSKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTH------ 95
           SL  +S+YI + ++ + ++       +   S I E L+ EF EI+  LNEI         
Sbjct: 61  SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQE-LMLEFKEITLSLNEIAQQDDETNS 119

Query: 96  -------TSPQSTIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMH--- 145
                  TS +S+++SF PKPL +L +  ++ SP  S P       +K +I+  P+H   
Sbjct: 120 KQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPP-------KKRNISFCPIHENL 172

Query: 146 TTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGLNGDYINP---------FKENNRLSI 196
           + T+  S+P+SP   +     ++ L   +S+  GL  +             FK+  RLS+
Sbjct: 173 SVTEYESLPSSPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSL 232

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 123/478 (25%), Positives = 197/478 (41%), Gaps = 111/478 (23%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQE------------QLHQTTAEYKQLNSLCAKSKYISN 52
           V++ L+ R  EAV QLE  ++++             Q+ +  +   +L+SL  +++++  
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLRAEHVQE 66

Query: 53  LLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIV-THTSPQSTIDSFEPK--- 108
            L+      P+D+  + E    +E LI+EF +I+  LNE+   + SP  +  S   K   
Sbjct: 67  SLRHQRKD-PNDVCIEYE---TLEKLIYEFQDITMSLNEVARAYQSPTKSARSGSSKESS 122

Query: 109 --PLNLL------RKNKILESPTRSS-------------PVTRG-RLERKISINLFPMHT 146
             PL  L      R + I  SP + S             P  R  R +      L  +H+
Sbjct: 123 VIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHLHS 182

Query: 147 TTKCNSVPTSPKCKS-----TSTLNQRTLRNIKSYHYGLNG------DYINPFKENNRLS 195
             + NS+P SP   +       +   +TLR  KSY  GLNG      D+   FK  NRLS
Sbjct: 183 VKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNADW-EFFKNKNRLS 241

Query: 196 IXXXXXXXXXXXXXXXXXXXXXXXXTVLVTSP-----FLTN-----PKQKLKRSNSQDSV 245
           +                        TV+  SP     +L+      P ++++R NS +S+
Sbjct: 242 LSVFDDVNTDASDEE----------TVISVSPPNISYYLSQNEDQYPSKQVRRCNSHESI 291

Query: 246 FWNE--------NYLRKPSFQKQLNLFPSTLTKPTAELSSTQVFLKNTGRLGSS--SKAL 295
              +        N + +P++Q       + +TKPT   S++      T  +GS   SK +
Sbjct: 292 LSRKILSPSTPANLIMRPTYQSVWQK-KAIVTKPTISCSTSNSTASPT--IGSPHLSKDM 348

Query: 296 LTSFVKDNLQQQQRTHNASS---------FNNIFNS---VTSEIG----KSKLDKSQIIH 339
           L+ FV     ++ R   +SS         F   FNS   VT EIG     S      I+ 
Sbjct: 349 LSQFVTAPPSKKYRGWFSSSNSTPFASSIFQKWFNSDSLVTKEIGNPDNSSPSSGRPIVE 408

Query: 340 TERRVLSDNSIVISTLITSKKSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEF 397
             +R  S NS   S +I    ++F        I     P++   V Y++L +ALNTEF
Sbjct: 409 NRQRHSSSNSYSTSIVIGPNGAKF--------IRGLNDPLVTCTVSYNELQEALNTEF 458

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 124/503 (24%), Positives = 210/503 (41%), Gaps = 142/503 (28%)

Query: 5   VSDTLLQRSEEAVSQLESWL---KQQEQL------------HQTTAEY----KQLNSLCA 45
           +++ LL RS+EA+ QL+ W+   K+Q++L            H    +Y     QLNSL  
Sbjct: 8   ITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNSLIV 67

Query: 46  KSKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHTSPQST---- 101
           + +YI +    + + +     EQK     +E+L++EF +I+ KLN++       S+    
Sbjct: 68  RVQYIRDKFLHNINQLDSTQDEQK----YIENLVYEFKQITLKLNDLSKKNKTTSSSENS 123

Query: 102 ---------IDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKIS--IN-----LFPMH 145
                    ++SFEPKPL +++               R + ++K+S  IN     +    
Sbjct: 124 SKTASSKSSMESFEPKPLKIIK---------------RTKNDQKVSNTINNDHDLIMQDE 168

Query: 146 TTTKCNSVPTSPKCKS---TSTLNQRTLRNIKSYHYG----------------LNGDYIN 186
              + NS+P+SP  KS   T + N++ LR +KS  +                    D IN
Sbjct: 169 NLQRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTIN 228

Query: 187 P-FKENNRLSIXXXXXXXXXXXXXXXXXXXXXXXXTVLVTSPFLT--NPKQK-------- 235
             FK   RLSI                           +T  +LT  N  Q         
Sbjct: 229 QFFKSQQRLSIGIFDNDDDNIYSTNMGTATR-------ITGEYLTDNNSDQATVISQGTI 281

Query: 236 ---------LKRSNSQDSVFW----------NENYLRKPSFQKQLNLFPSTLTKPTAE-- 274
                    L+R NS +S+            N N L   +F  +L L+ S++ +P+ +  
Sbjct: 282 KRNDDDFTPLRRYNSHESILSQKISSTPLIDNNNNL---TFNSKLPLY-SSIRRPSMQSI 337

Query: 275 -LSSTQVFLKNTGRLGSSSKALLTSFVKD--------NLQQQQRTHNASSFNNIF----- 320
            ++S  +F +++   G +SK LL+SFV          N+Q + +T   S  NN       
Sbjct: 338 HVTSNPIFARSSQ--GKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTI 395

Query: 321 --NSVTSEIGKSK-LDKSQIIHTERRVLSD--NSIVISTLITSKKSRFNRFSSVDNISPT 375
              S +S  G    L++  +I +E    ++   +  I  +  S+    +   ++D+IS  
Sbjct: 396 NQTSTSSFFGNWNFLNRFNMITSETNTTTNRKRNYNIPLVNQSRAHNIDVNDTMDSIS-I 454

Query: 376 KKPIINNDVQYSDLNDALNTEFL 398
           K+P+ +N +   DL DALNTE L
Sbjct: 455 KEPVYDNTISLDDLEDALNTELL 477

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 131/490 (26%), Positives = 208/490 (42%), Gaps = 124/490 (25%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQ------------LHQTTAEYK----QLNSLCAKSK 48
           +S+ LL RS+EA+ QL+ W+++Q+Q            L + T  Y     QLNSL  +S+
Sbjct: 9   LSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYIRSQ 68

Query: 49  YISNLL----KDDSSSIPH------DLMEQKERSFIVESLIHEFNEISTKLNEIV----- 93
            + + L    K  +++I +      ++  Q +    +E LI EF +I+ KLN +      
Sbjct: 69  NVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSD----IEDLIFEFQDITRKLNVLASSRRR 124

Query: 94  -----THTSPQSTIDSFEPKPLNL-LRKNKILESPTRSSPVTRGRLERKISINLFPMHTT 147
                + +S  S+I SF+PKPL + L++NK L+   + + VT            F +   
Sbjct: 125 CSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNKKT-VT------------FDVEEV 171

Query: 148 TKCN-----SVPTSP-KCKSTSTLNQRTLRNIKSYHYGLNGD-------------YINPF 188
           T  N     S+P SP + + +S      LR  KSY  GLN               Y + F
Sbjct: 172 TDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTF 231

Query: 189 KENNRLSIXXXXXXXXXXXXXXXXXXXXXXXXTVL-VTSPFLTNPKQK-----LKRSNSQ 242
           K   RLSI                        + L +  P      QK     L+R NS 
Sbjct: 232 KNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSH 291

Query: 243 DSVFWNENYLRKPSFQKQLNLFP-------STLTKPTAELSSTQV----FLKNTGRLGSS 291
           +S+   +  +R  S  K+  + P       +T T      S+T V    F K      ++
Sbjct: 292 ESILSTK--IRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKADDFYKPNLSNSTT 349

Query: 292 SKALLTSF-VKDNLQQQQRTH----------NASSFN--NIFN---SVTSEIGKSKLDKS 335
           SK +L+ + +K+++Q   R +          + S FN  NIFN     +SE+G  + + +
Sbjct: 350 SKDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSEVGSKQENNT 409

Query: 336 QIIH--TERR----VLSDNSIVISTL-ITSKKSRFNRFSSVDNISPT-KKPIINNDVQYS 387
              H  ++R+     LS N    ST+ I    S F         SPT  +P  +N V + 
Sbjct: 410 TAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMF--------CSPTIYEPTFSNTVSFQ 461

Query: 388 DLNDALNTEF 397
           +L+DALNTE 
Sbjct: 462 ELHDALNTEL 471

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 110/227 (48%), Gaps = 46/227 (20%)

Query: 10  LQRSEEAVSQLESWLKQQEQLHQTT--------------AEY----KQLNSLCAKSKYIS 51
           L  S+ A+++L+S L++Q +L+++               A+Y     QL SL  K++ +S
Sbjct: 12  LALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSLYTKAQKLS 71

Query: 52  N-LLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHT---SPQS----TID 103
           + ++  DS S+    ++Q+     +E+LI EF EI+      ++++   SP S    +I 
Sbjct: 72  DTVILSDSKSLSS--VQQR----AIENLIQEFQEIAKNDENFISYSMRESPNSMSVQSIC 125

Query: 104 SFEPKPLNLL-RKNKILESPTRSS--PVTRGRLERKISINLFPMHTTTK---CNSVPTSP 157
           SF+PKPL +L R+   LESPT+ S  P       R    NL      ++     S P+S 
Sbjct: 126 SFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLGSSPSSI 185

Query: 158 KCKSTSTLNQRTL--RNIKSYHYGLN------GDYINPFKENNRLSI 196
                S  N  TL  R+ KS   GLN       + +N FK+  RLSI
Sbjct: 186 HFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQRLSI 232

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 101/230 (43%), Gaps = 43/230 (18%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQ--------------TTAEY----KQLNSLCAK 46
           ++   L+RSEEA+ +LE  + +Q +L++              T  +Y     QLN L  K
Sbjct: 7   IAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLNCLYIK 66

Query: 47  SKYISNLLKDDSSSIPHDLMEQKER-SFIVESLIHEFNEISTK---LNEIVTHTSPQSTI 102
           ++ + +++ +    +P+   E  ER     ++L +  NE+  +   L +  +  SP S +
Sbjct: 67  AQSLKDMMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDSPSCLSPAS-V 125

Query: 103 DSFEPKPLNLLRK---------NKILESPTRSSPVTRGRLERKISINLFPMHTTTKCNSV 153
            SF+PKPL ++ +          K+  +   +    R   ++        +  T  CN  
Sbjct: 126 SSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKTNSCN-- 183

Query: 154 PTSPKCKSTSTLNQRTLRNIKSYHYGLNGDYINP-------FKENNRLSI 196
            T+  C + +    + +R +KS   GLN  + NP       F++  RLSI
Sbjct: 184 -TNSPCTNEAKKEPKFIRVVKSCGTGLN-KHSNPHENRLSFFRDRQRLSI 231

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 54/222 (24%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQ----TTAE-----------------------Y 37
           +S+ LL RS+EA+ QL+ W+ +Q+Q H      TA                         
Sbjct: 11  LSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYM 70

Query: 38  KQLNSLCAKSKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT--- 94
            QLNSL  +S++I + L  + +++    ++ +     +E L+ EF  I  KLN++     
Sbjct: 71  SQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRN----IEELVFEFQNIREKLNQLAASSK 126

Query: 95  ---HTSPQ-----STIDSFEPKPLNLL-----RKNKILESPTRSSPVTRGRLERKISI-- 139
              H+ P+     S+++S   KPL ++     R +K LE   +   VT G+ E +IS+  
Sbjct: 127 LDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGK-ETRISLTT 185

Query: 140 NLFPMHTTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGLN 181
           N        K +S   SP+         + LRN  SY  GLN
Sbjct: 186 NGIGGKLMIKDDS-DASPQLIDKK---YKVLRNAISYDTGLN 223

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 40/153 (26%)

Query: 5   VSDTLLQRSEEAVSQLESWLKQQ--------------EQLHQTTAEYK----QLNSLCAK 46
           VS  LL +++EAV QL+ W+K Q              E L Q   +Y     QLNSL  +
Sbjct: 7   VSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLYLR 66

Query: 47  SKYISNLLKDDSSS--IPHDLMEQKERSFI-VESLIHEFNEISTKLNE-------IVTHT 96
           ++YI + ++  ++      D+      S   V+ L+ EF  +S K+NE       +   +
Sbjct: 67  AQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVTNGS 126

Query: 97  SPQST------------IDSFEPKPLNLLRKNK 117
           SP S              D F+P+PL +L++ K
Sbjct: 127 SPLSNKSSHSNDSLSKITDGFQPRPLKILQRQK 159

>ZYRO0C09218g Chr3 complement(700063..701658) [1596 bp, 531 aa] {ON}
           highly similar to uniprot|P46681 Saccharomyces
           cerevisiae YDL178W DLD2 D-lactate dehydrogenase located
           in the mitochondrial matrix
          Length = 531

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 28/39 (71%), Gaps = 1/39 (2%)

Query: 233 KQKLKRSNSQDSV-FWNENYLRKPSFQKQLNLFPSTLTK 270
           +Q+L ++N QD++ F+NE+++RK   Q +L L P T+ K
Sbjct: 76  QQELLQANDQDALEFYNEDWMRKYRGQSRLVLRPKTVQK 114

>NCAS0A13630 Chr1 (2680770..2681594) [825 bp, 274 aa] {ON} Anc_7.265
           YIL070C
          Length = 274

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 55/113 (48%), Gaps = 24/113 (21%)

Query: 2   ASLVSDTLLQRSEEAVSQLESWLKQQEQLHQTTAEYKQLNSLCAKSKYISNLL-KDDSSS 60
           AS+V +   + SEEA+ Q      QQE      AE +  +SL      ++ ++ KDD+S+
Sbjct: 126 ASVVDNLNQEASEEALGQ------QQE------AEEEDFDSLADNFANVNVVVSKDDNSA 173

Query: 61  IPHD-LMEQKERSFIVESLIHEFNEISTKLN---------EIVTHTSPQSTID 103
           +  + LM  +E SF V+S +  F  I   LN         E+V H  P S +D
Sbjct: 174 LSFELLMNLQEGSFYVDS-VTPFKSIDQALNESADAELNRELVYHGPPFSNLD 225

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 24/129 (18%)

Query: 281 FLKNTGRLGSSSKALLTSFVKDNLQQQQRTHNASSFNNIF---NSVTSEI--GK------ 329
           +L +T        A +T  +   L+ Q    +  + ++IF   + +T+EI  GK      
Sbjct: 297 YLGDTNNSDDQLCAYITDLIGKKLEYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLT 356

Query: 330 --SKLDKSQIIHTERRVLSDNSIVISTLITS-KKSRFNRFSSVDNISPTKK--------- 377
              KL+K   +H E+ ++  NS+ I+    S ++SR + F SV  +    K         
Sbjct: 357 INEKLEKELKVHYEKVIIFSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRST 416

Query: 378 -PIINNDVQ 385
            P+I+ +VQ
Sbjct: 417 FPMIHQEVQ 425

>NDAI0A00430 Chr1 (73040..74356) [1317 bp, 438 aa] {ON} Anc_1.42
           YCL032W
          Length = 438

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 115 KNKILESPTRSSPVTRGRLERKISINLFPMHTTTKCNSV 153
           +N+++E  T+S P+ R  +ERK+   L P+ T    N  
Sbjct: 178 RNEVIERITQSDPIVRSTIERKVPSLLTPVQTAIPANEA 216

>YDL178W Chr4 (139522..141114) [1593 bp, 530 aa] {ON}  DLD2D-lactate
           dehydrogenase, located in the mitochondrial matrix
          Length = 530

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 233 KQKLKRSNSQDSVFWNENYLRKPSFQKQLNLFPSTLTK 270
           ++ L+ S S+D  F+NE+++RK   Q +L L P ++ K
Sbjct: 76  QEILRASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEK 113

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,632,440
Number of extensions: 1801048
Number of successful extensions: 7829
Number of sequences better than 10.0: 175
Number of HSP's gapped: 8240
Number of HSP's successfully gapped: 181
Length of query: 399
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 287
Effective length of database: 40,638,807
Effective search space: 11663337609
Effective search space used: 11663337609
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)