Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0D001101.3ON36536516850.0
NCAS0B091301.3ON36735412261e-169
NDAI0A001201.3ON37737111691e-160
KNAG0C001801.3ON35935211451e-156
Suva_3.1501.3ON36135411411e-156
KAFR0I00130singletonON34434211201e-153
YCL064C (CHA1)1.3ON36035411181e-152
Skud_3.11.3ON36036511111e-151
Smik_3.121.3ON36036010971e-149
TBLA0A049201.3ON36034110491e-142
Kpol_2002.61.3ON35035210461e-142
KAFR0F04430singletonON34334010221e-138
TPHA0E040401.3ON35734410121e-136
CAGL0B00286g1.3ON3603519661e-129
NCAS0A15330singletonON3473449231e-123
ZYRO0F15774gsingletonON4103399131e-120
SAKL0C00418g1.3ON3643398991e-119
NDAI0K02950singletonON3343348611e-114
KLTH0F00440g1.3ON3413328431e-111
ZYRO0F18524g1.3ON3353338071e-105
Ecym_10061.3ON3643427991e-104
Smik_9.2na 1ON3383287931e-103
KNAG0D05380singletonON3343427761e-101
KLLA0C00440g1.3ON3773497711e-99
AFR747W1.3ON4263357715e-99
SAKL0C13904gsingletonON3393297583e-98
Scer_YGOB_SDL1 (SDL1)na 1ON3373287366e-95
Skud_9.2na 1ON3393377332e-94
TDEL0D06540singletonON3373286767e-86
KLLA0E01805gsingletonON3223276103e-76
KNAG0A01150singletonON2312265051e-61
YIL167W (SDL1)singletonOFF2101894682e-56
YIL168WsingletonOFF1271252818e-30
SAKL0F11858g7.367ON5622011551e-10
KLLA0E19779g7.367ON5672001382e-08
KAFR0K017007.367ON5792041302e-07
TDEL0C018007.367ON5692001212e-06
NCAS0A142307.367ON5692001203e-06
ACR232C7.367ON5602001194e-06
Kpol_530.167.367ON5662011194e-06
CAGL0I05126g7.367ON5712001185e-06
ZYRO0B02772g7.367ON5692011185e-06
TPHA0F031307.367ON5682041168e-06
NDAI0A018107.367ON5702641168e-06
TBLA0C050707.367ON5752301151e-05
Smik_5.2257.367ON5762911113e-05
YER086W (ILV1)7.367ON5762911105e-05
Ecym_47087.367ON5702231106e-05
Suva_5.1997.367ON5762911106e-05
Skud_5.2057.367ON5762911096e-05
KNAG0C036907.367ON5772001052e-04
SAKL0A10626gsingletonON3202851014e-04
Kwal_33.148227.367ON562198970.002
KLTH0B04884g7.367ON573200950.003
YKL218C (SRY1)na 2ON326164880.020
Skud_11.2na 2ON326166840.056
KLLA0C18029g4.148ON384154830.077
NDAI0J017604.131ON44891731.4
KAFR0F034504.148ON386135731.5
NCAS0A016904.103ON18893692.6
Suva_6.338.46ON102960679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0D00110
         (365 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   653   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    476   e-169
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   454   e-160
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   445   e-156
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   444   e-156
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   436   e-153
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   435   e-152
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   432   e-151
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   427   e-149
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   408   e-142
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   407   e-142
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              398   e-138
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   394   e-136
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   376   e-129
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            360   e-123
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   356   e-120
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   350   e-119
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             336   e-114
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   329   e-111
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   315   e-105
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   312   e-104
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      310   e-103
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   303   e-101
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   301   1e-99
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   301   5e-99
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   296   3e-98
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   288   6e-95
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      286   2e-94
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            265   7e-86
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   239   3e-76
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   199   1e-61
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   184   2e-56
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   112   8e-30
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    64   1e-10
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    58   2e-08
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    55   2e-07
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    51   2e-06
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    51   3e-06
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    50   4e-06
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    50   4e-06
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    50   5e-06
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    50   5e-06
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    49   8e-06
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    49   8e-06
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    49   1e-05
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    47   3e-05
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    47   5e-05
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    47   6e-05
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    47   6e-05
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    47   6e-05
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    45   2e-04
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    44   4e-04
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    42   0.002
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    41   0.003
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    39   0.020
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    37   0.056
KLLA0C18029g Chr3 complement(1601829..1602983) [1155 bp, 384 aa]...    37   0.077
NDAI0J01760 Chr10 complement(432212..433558) [1347 bp, 448 aa] {...    33   1.4  
KAFR0F03450 Chr6 (686311..687471) [1161 bp, 386 aa] {ON}               33   1.5  
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    31   2.6  
Suva_6.33 Chr6 complement(57692..60781) [3090 bp, 1029 aa] {ON} ...    30   9.0  

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/365 (87%), Positives = 320/365 (87%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
           KGTKRPEVF              CQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             ERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFE      
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNKET 360
           DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNKET
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNKET 360

Query: 361 FLKNI 365
           FLKNI
Sbjct: 361 FLKNI 365

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  476 bits (1226), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/354 (64%), Positives = 263/354 (74%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFFP   ++ S S+PQFFLKYECLQPSGSFKSRGIGNLI+K A++I K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G K P+VF               QRLSLPCTVVVPTATKQRM+EKI+ TGANVII+GA 
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD YLK SVMN I+ N  +PIYVHPFDNP IWEGHS++VDEI+DTL EQ +  + IK
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             E+HKL DKIP+VGVET+GCHVFNTSLKLGKQ+EF       
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY TRSV+V+D DVIETCLKYT+D+NMV EPACGAS+HLAYN 
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFL 354
           +ILENALG KL+ DD ++VIACGGSSNT+QD+EETL+RLR +       P  F+
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFI 354

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  454 bits (1169), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 220/371 (59%), Positives = 266/371 (71%), Gaps = 10/371 (2%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKS-----NSLPQFFLKYECLQPSGSFKSRGIGNLILKQA 55
           MSVVYNKTPLLRQFF  + ++ S      + PQFF+KYECLQPSGSFKSRGIGNLILK A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 56  MQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVI 115
           M I+K G K P+VF              CQRLSLPCTVVVPTATKQRM+EKIK TGANVI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 116 IDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQ 175
           I+GA WKEAD +LK S+MNKI+ N I+PIYVHPFDNPLIWEGH+++VDEIMD+L +Q + 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 176 PSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEX 235
            + +KGIVCSV             +++ L DKIP+VGVET+GCHVFNTSLKL KQ+EF  
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 236 XXXXXXXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIH 295
                            FE A KY TRSV+++D +VIETCLKYT+DYNMV EPACGASIH
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 296 LAYNIDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEE-----NAAMTLP 350
           LAY+ DILE +LG KL  DD ++VIACGGSSNT  D+E  LL ++++E     +++ T+P
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360

Query: 351 NPFLKVNKETF 361
           N     N + F
Sbjct: 361 NFIDTENTQHF 371

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  445 bits (1145), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 257/352 (73%), Gaps = 11/352 (3%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFFPG       +LPQ FLKYECLQPSGSFKSRGIGNLILK AM+I K
Sbjct: 1   MSLVYNKTPLLRQFFPG------KNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G +R  VF              CQRLSLPCTVVVPTATK RM+EKI++TGA VI++GA 
Sbjct: 55  IGERRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAH 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEADQ+LKK+VM++I+    +PIYVHPFDNP IWEGH+++VDEIM+TL  QK+Q  N+K
Sbjct: 115 WKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             E+H L +KIP+VGVET GCHV NTSL L KQ+EFE      
Sbjct: 175 GIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY TRSV+V D+ VIETCLKYT+D+NMV EPACGA++HLAYN+
Sbjct: 235 TSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNV 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNP 352
           DILE ALG  LT +D ++VIACGGSSNTL+D+E+TL+ L S+     ++P+P
Sbjct: 295 DILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK-----SIPSP 341

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  444 bits (1141), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/354 (59%), Positives = 256/354 (72%), Gaps = 6/354 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFFPG       SL QF+LKYECLQPSGSFKSRGIGNLILK A++I K
Sbjct: 1   MSIVYNKTPLLRQFFPG------KSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G + P+VF              CQRLSLPCTVVVPTATK+RM+EKI++TGA VI++GAF
Sbjct: 55  NGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD YLK +VMN I+   ++PIYVHPFDNP IWEGHSS+VDEI+  L+ Q+V    +K
Sbjct: 115 WKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             ERH L DKIP+VGVET+GCHVFNTSL++G+ V+F+      
Sbjct: 175 GIVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY T+SV+V+D DVIETCLKY+  +NMVTEPACGA++HL Y+ 
Sbjct: 235 TSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHT 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFL 354
           DILE AL TKL  DD V++IACGGSSNT+QD+EETL  ++ E   A+ L + F+
Sbjct: 295 DILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFI 348

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  436 bits (1120), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/342 (59%), Positives = 251/342 (73%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M +VYNKTPL+ Q FPGT+ R S+SLPQ  +KYE LQPSGSFKSRGIGNL+ ++A+QI K
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
             TK PEVF               Q+LSLPCTVVVP ATKQRMIEKI+ TGA V I G F
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WK AD+Y+K SV+N+IN  +++PIYVHP D+PLIWEG+S IVDE+M++L+EQK+ PS +K
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
            IVCSV             ER+KL DKIP+VGVET+G HVFNT LK GK +EFE      
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A+KY  R VIVKD +V+ETCL+YT+DYNM+TEPACGA+IHLAY++
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSE 342
           DILE AL T+L  DD V++IACGGSSN+L DMEETL +++SE
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSE 342

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  435 bits (1118), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 253/354 (71%), Gaps = 6/354 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFFPG  S       QFFLKYECLQPSGSFKSRGIGNLI+K A++I K
Sbjct: 1   MSIVYNKTPLLRQFFPGKAS------AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G + P+VF              CQRLSLPCTVVVPTATK+RM++KI++TGA VI+ GA+
Sbjct: 55  DGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +LK +VMNKI+   I+PIYVHPFDNP IWEGHSS++DEI+  L+ Q +  + +K
Sbjct: 115 WKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             ER+ L D+IP+VGVET GCHVFNTSLK+G+ V+F+      
Sbjct: 175 GIVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY TRSV+++D DVIETCLKYT  +NMV EPACGA++HL YN 
Sbjct: 235 TSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNT 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFL 354
            ILENALG+KL  DD V++IACGGSSNT++D+EE L  +R ++   + + + F+
Sbjct: 295 KILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFI 348

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  432 bits (1111), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 208/365 (56%), Positives = 260/365 (71%), Gaps = 7/365 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFFP      S S  QFFLKYECLQPSGSFKSRGIGNLILK A++I K
Sbjct: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G + P+VF              CQRLSLPCTVVVPTATK+RM+EKI++TGA VI++GA+
Sbjct: 55  DGRRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +LK ++MN+I+   ++PIYVHPFDNP IWEGHSS+VDEI+  L+ Q++  + +K
Sbjct: 115 WKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             ER+ L DKIP+VGVET GCHVFNTSL++G+ V+F+      
Sbjct: 175 GIVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY T+SV+++D DVIETCLKYT   NMV EPACGA++HL Y+ 
Sbjct: 235 TSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHT 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNK-E 359
           +ILE ALG+KL  DD V++IACGGSSNT+QD+EETL  L+ +   A+   + F+ V K  
Sbjct: 295 EILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTS 354

Query: 360 TFLKN 364
           T LK+
Sbjct: 355 TILKS 359

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  427 bits (1097), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 250/360 (69%), Gaps = 6/360 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFFPG       S  QFFLKYECLQPSGSFKSRGIGNLI+K A++I K
Sbjct: 1   MSIVYNKTPLLRQFFPG------KSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G K P++F              CQRLSLPCTVVVPTATK+RM+EKI++TGA VI+ GA+
Sbjct: 55  DGKKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +LK  VM KI+   ++PIYVHPFDNP IWEGHSS+VDE++  L  Q++  + +K
Sbjct: 115 WKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             ER+ L DKIP+VGVET GCHVFNTSL++G+ V+F+      
Sbjct: 175 GIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       F+ A KY TRSV+++D DVI+TCLKYT  +NMV EPACGA++HL YN 
Sbjct: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNKET 360
           +ILE ALG+KL  DD V++IACGGSSNT+QD+EE L         A+ + + F+   K T
Sbjct: 295 EILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTT 354

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  408 bits (1049), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/341 (56%), Positives = 242/341 (70%), Gaps = 7/341 (2%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLRQFF G+       +PQFFLKYEC+QPSGSFKSRGIGNLILK   +I+ 
Sbjct: 1   MSIVYNKTPLLRQFFRGSP------IPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54

Query: 61  KG-TKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGA 119
               KRP+VF               +RLS+PCTVVVPTATK+RM+ KIKDTGA VI++G 
Sbjct: 55  SNLNKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114

Query: 120 FWKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNI 179
            W EAD YL+  V+NKI+ NEI+PIYVHPFDNPLIWEGHS+++DEI+++L EQ +   N+
Sbjct: 115 HWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNV 174

Query: 180 KGIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXX 239
           K I CS+             E++ L  KIP++GVET GC VFNTSLKL K V+F      
Sbjct: 175 KAITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTI 234

Query: 240 XXXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYN 299
                        FENALKY T+SV+V + DVI+TCL+YT D+N V EPACGA++HLAYN
Sbjct: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294

Query: 300 IDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLR 340
             ++ENAL T LTKDD ++VIACGGSSNT+Q++EE LL+ +
Sbjct: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  407 bits (1046), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 206/352 (58%), Positives = 254/352 (72%), Gaps = 7/352 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLL+ FFPG       +LPQF+LKYE LQPSGSFKSRGIGNLILK A++I K
Sbjct: 1   MSLVYNKTPLLKHFFPG------KNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
              K+P VF               QRLSLPCTVVVPTATK+RM++KI+ TGANVII G  
Sbjct: 55  INVKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNH 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +LK+++MN+INK++I+PIYVHPFDNPLIWEGHS++VDEIM+T  +QK    N+K
Sbjct: 115 WKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
            IVCSV             E++ L DKIPVVGVET+GCHVFNTSLKL K VEF       
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       F+ A KY T+SV+V+D DV+ETCLK+T D+NMV EPACGA+IHL Y+ 
Sbjct: 235 TSLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHT 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLR-SEENAAMTLPN 351
           D+LE ALGTKLT DD V+++ACGGSSNT++++E  LL L    + A+ T+P+
Sbjct: 295 DLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPS 346

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  398 bits (1022), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 240/340 (70%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M  VYNKTPLLR +F       S+S PQ F KYE  QP  SFKSRGIGNLILK A ++ +
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
           +G K  EVF              C+ LS+PCTVVVP++TK RM+EKI+ TGA VI+ G F
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD+YL+ SV+NK++ ++++P+YVHPFD+PLIWEGHS+I+DEI+++L ++ V  S +K
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           G+VCS+             ERH L DKIPV+ VETEGCHVFNT L+LGK VEFE      
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY ++ V+++D DV+ETCL+Y++D NM+ EPAC AS+HLAYN+
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLR 340
           DILE AL  KL+KDD +++IACGGS+ TLQD++++L +L+
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLK 340

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  394 bits (1012), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/344 (54%), Positives = 234/344 (68%), Gaps = 6/344 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS VYNKTPLLR  FPG       +LPQ FLKYEC QPSGSFKSRGIGNLI   +++I K
Sbjct: 1   MSQVYNKTPLLRHLFPG------KNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
              K PEVF               + LSLPCTVVVPTATK RM+EKIK TGANVI+ G  
Sbjct: 55  NSKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNH 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD YLK +V++ I+K  I+PIYVHPFDN  IWEGH++++DEI++T  +Q +    +K
Sbjct: 115 WKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
            IVCSV             E+H L  KIPVVGVET GCHVFNTSLK+GK ++FE      
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FE A KY T+S++V D  V+ETCLK+T+D NMV EPACGA++H+ YN+
Sbjct: 235 TSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNM 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEEN 344
           DILE +LG KL  DD V++IACGGSSNT+Q++E +L  L+++ N
Sbjct: 295 DILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  376 bits (966), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 241/351 (68%), Gaps = 12/351 (3%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           VYNKTPL+RQ FP        S+PQ +LK+EC QPSGSFKSRGIG+LI KQ+ +I   G 
Sbjct: 3   VYNKTPLIRQIFP--------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54

Query: 64  -KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWK 122
            K+P VF               + L+LPCTVV+PTATKQRM +KI+ TGANVI+ G FWK
Sbjct: 55  GKKPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114

Query: 123 EADQYLKKSVMNKINK--NEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           EAD YLK ++++K+ +    ++PIYVHPFDNP IWEGH+S+VDEI++  + + +  + IK
Sbjct: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
            IVCSV             E++ L DKIP+VGVET+GCHVFNTSL++ K V F+      
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       F+ A +YGT+SV++ D DV++TCL+YT D+NMV EPACGA++HLAY+ 
Sbjct: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPN 351
           +ILE  LGTKL  DD V+V+ACGGSSNT++DME  L RL +EEN  + +PN
Sbjct: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEEN-NINIPN 344

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  360 bits (923), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 228/344 (66%), Gaps = 3/344 (0%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS+VYNKTPLLR+ FP     K  S PQ ++KYE LQPSGSFKSRGIG+LI+K A+++ +
Sbjct: 1   MSLVYNKTPLLRRVFP--TGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQ 58

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G K   VF               Q L LPCTVVVPT+TK RM+EKI++ G  VI+ G+ 
Sbjct: 59  LGGKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSH 118

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +LK SV+  +++ E +PIYVHPFD+P +WEGHS++VDEI+DT R Q V  + +K
Sbjct: 119 WKEADSFLKNSVIPSVDRIE-EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVK 177

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
            IVCSV             E++ L DKIPV+ +ET+GC+ FN  LK  KQVE        
Sbjct: 178 AIVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVA 237

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FEN  +Y + SV+++D DV+ TCLKY  D+N++TEPACGAS+H+AYN 
Sbjct: 238 TSLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNT 297

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEEN 344
            ++E ALG KL  DD +V+IACGGS+NT++D++ +  +L +E N
Sbjct: 298 KLIEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEAN 341

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  356 bits (913), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 226/339 (66%), Gaps = 6/339 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M  +YNKTPLL+Q F    S       Q F+KYECLQPSGSFKSRGIG+LI K+A  I  
Sbjct: 47  MPSIYNKTPLLKQIFNHATS------AQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQG 100

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G K P VF               Q+L+LPCTVV+PT TKQRM +KI+  GANV++ G+ 
Sbjct: 101 DGRKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSH 160

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +LK  + N++N   ++PIYVHPFDNP IWEGH+SIVDEI+ +L+ +    + +K
Sbjct: 161 WKEADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVK 220

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             E++ L +KIP++ VET+GCHV NTSL++G+ VEF       
Sbjct: 221 GIVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVA 280

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                        +   KYG++S++++D +V++TCLKY +++NM+TEPACGAS+HL Y+ 
Sbjct: 281 TSLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHP 340

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRL 339
            ++E ALG  L KDD ++VIACGGSSNT+ D+EE+L +L
Sbjct: 341 QLIERALGKNLDKDDVIIVIACGGSSNTILDLEESLAKL 379

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  350 bits (899), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/339 (48%), Positives = 218/339 (64%), Gaps = 3/339 (0%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M+  Y+KTPLLR+ FP   S   ++ PQF +KYE  QPSGSFKSRGIG+LI + A +I  
Sbjct: 1   MTSFYSKTPLLRRIFP---SSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIES 57

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
           +G K   VF              C+  SLPCTVVVPT T  RM+ KI+ TGA+VI+ G  
Sbjct: 58  EGNKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNH 117

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           W +ADQYL +SVM  I+  + +P+Y HPFDNP+IWEGHS+IVDEI+++L  Q++  S +K
Sbjct: 118 WGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCS+             E+H L   IP++GVET+GC VF+ SLK GK + F+      
Sbjct: 178 GIVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                        ENALKY T+SV++ DADV+ TCL +  D N+V EPACGAS+H  YN 
Sbjct: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRL 339
            +LE+ LG  L  +D ++VIACGGSS T+QD+++  +RL
Sbjct: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  336 bits (861), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 212/334 (63%), Gaps = 6/334 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS +YNKTPLLRQ F   K       P+ FLKYE LQPSGSFKSRGIG LIL+   ++ +
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIG-----PRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQ 55

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G K   VF               + L +PCTVVVP +TK+RM+ KI+ TGA+V+I G  
Sbjct: 56  DGNKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDH 115

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD +L+KS M +++  +  PIYVHPFD+P+IWEGHS+I+DEI+ TL+ +K+    +K
Sbjct: 116 WKEADDFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GI+CSV             ERH L   IPV+ VET+GC V N SLK G  V+        
Sbjct: 175 GIICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVA 234

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       FENA+KY +RS+ + D DV+ETCLKY  D++M  EPACGAS+HLAYN 
Sbjct: 235 TSLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNP 294

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEE 334
            I+E+ALGT L+  D V+V+ CGGSS TL D+E 
Sbjct: 295 GIVESALGTALSNHDIVIVVLCGGSSCTLHDLES 328

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  329 bits (843), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 212/332 (63%), Gaps = 1/332 (0%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M   + KTPLL  +F  + +R  N  PQF LK E LQPSGSFKSRGIG +I KQA++I  
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQ-PQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRS 59

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
           +G K P VF               + LS+PC+VVVP +T  RM++KI + GA V + G  
Sbjct: 60  EGNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD++LK+S+++  N +    IY HPFD+PLIWEGHSSIVDEI+D+L+EQK+   NIK
Sbjct: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
            IVCSV              RHKLV KIP++GVE++GC VFN+SLKLGK  EFE      
Sbjct: 180 AIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                        ENAL+Y T+SV++ D ++I TCL++  + N++ EPACGA++HL Y  
Sbjct: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDM 332
           DIL  AL +  T +D +++I CGGS+ +  D+
Sbjct: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  315 bits (807), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 209/333 (62%), Gaps = 9/333 (2%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M+  Y KTPLLRQ       + +  LPQ F+KYE LQP GSFKSRGIGNLI  ++    +
Sbjct: 1   MNNWYYKTPLLRQIL---NWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS----E 53

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
            G  +  V                +++ LPCTVVVPT+TKQRM++KIK++GA VII G+ 
Sbjct: 54  NGLVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSH 113

Query: 121 WKEADQYLKKSVMNKI-NKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNI 179
           WKEAD YL+++ +    N     P+YVHPFD+P +WEGHS++V EI+D LREQ +   N+
Sbjct: 114 WKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENV 173

Query: 180 KGIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXX 239
           +GIVCSV             E H L DKIPV+ VET GC+V N SL  G+ V  +     
Sbjct: 174 RGIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSL 233

Query: 240 XXXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYN 299
                        FENA++YG +S++++D DVIETCL+Y  D+  + EPACGAS+H+ Y+
Sbjct: 234 ATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYH 293

Query: 300 IDILENALGTKLTKDDTVVVIACGGSSNTLQDM 332
            ++LEN LG   +KDD +V+IACGGS+ T +D+
Sbjct: 294 PELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  312 bits (799), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/342 (45%), Positives = 213/342 (62%), Gaps = 6/342 (1%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           MS +Y KTPLLR+ F G  + + + +PQF +KYE  QPSGSFKSRGIGNLI  +  +I +
Sbjct: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
              K+P VF               QR+ +PCTVVVPT+T+QR+IEKI  TGA +I  G +
Sbjct: 60  DPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119

Query: 121 WKEADQYLKKSVMNKINKNEID----PIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQP 176
           + EAD YLK  +    NKN  D    PIYVHPF++PLIW GHS IV+EI+++LR + +  
Sbjct: 120 FAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179

Query: 177 SNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXX 236
           S +KGIVCSV             ERH L + IP++GVETEGC V + SL  GK + F+  
Sbjct: 180 SRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239

Query: 237 XXXXXXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHL 296
                              A KY T+S+++ + +V++TCL++T + N+VTEPACGA++HL
Sbjct: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299

Query: 297 AYNIDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLR 338
            Y+  IL   LG  L+ +D V++IACGGS+ TL D+ E  L+
Sbjct: 300 GYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLK 340

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  310 bits (793), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/328 (45%), Positives = 204/328 (62%), Gaps = 5/328 (1%)

Query: 5   YNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTK 64
           Y KTPL+RQ F   K+      P F++K++ LQP GSFKSRGIG+LI K+  +   +G+ 
Sbjct: 6   YEKTPLIRQVFDNGKTN-----PLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSG 60

Query: 65  RPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEA 124
           +  VF              C+ ++L CTVVVP  TK RM++KI+  GA VII G  W EA
Sbjct: 61  KLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEA 120

Query: 125 DQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVC 184
           D+YLK+ VM +  ++    +YVHPFD+ +IWEGHS+IVDEI+  L+E+ + P  +KG+VC
Sbjct: 121 DEYLKQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVC 180

Query: 185 SVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXX 244
           SV             ER++L  KIP+V VET GC V N SLK G  V  E          
Sbjct: 181 SVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLG 240

Query: 245 XXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILE 304
                   FE+ + YG +SV++ D DV++TCL+Y  DYN + EPACGAS+HL Y+ +ILE
Sbjct: 241 SPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILE 300

Query: 305 NALGTKLTKDDTVVVIACGGSSNTLQDM 332
            ALG KL++DD V++IACGGS  T +D+
Sbjct: 301 KALGQKLSEDDVVIIIACGGSCMTYEDL 328

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  303 bits (776), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/342 (43%), Positives = 203/342 (59%), Gaps = 8/342 (2%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M  +YNKTPLL +   G         P F  KYE +QP GSFK RG+ +LI K+  QI  
Sbjct: 1   MPALYNKTPLLPKNLSGGDG------PTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKS 54

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
           +G K P VF              C  LS+PCTVVVPT TK RM+EKI+   A VI+ G+ 
Sbjct: 55  EGKKPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSN 114

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
           WKEAD YL+ +V+   + N + PIYV+PFD+PL+WEGHS+++DEI++ L ++ ++   +K
Sbjct: 115 WKEADDYLRGTVI--ASNNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVK 172

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             E H+L   IPVV VET+GC V   SL   K V         
Sbjct: 173 GIVCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIA 232

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                       F+NA+K+ +RSV++ D+DV+ TC +Y  D+N + EPACGA+IH AY+ 
Sbjct: 233 TSLGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHY 292

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSE 342
            ILE ALG KLT  D +++I CGGS  T+QD+E    +L ++
Sbjct: 293 KILEKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLDTD 334

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  301 bits (771), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 150/349 (42%), Positives = 212/349 (60%), Gaps = 11/349 (3%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           +++KTPLL+  F  +K       PQ  LKYE LQPSGSFKSRGIG+LI  +  +I K   
Sbjct: 24  LFSKTPLLKHQFKRSKG------PQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSP 77

Query: 64  KR-PEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWK 122
           ++   VF                 L++PCTVVV  AT+ R+IEKI+  GA+V++ G  WK
Sbjct: 78  EKIGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWK 137

Query: 123 EADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGI 182
           EAD ++K+ +M K++  + +PIY HPFDNPLIWEGHS +VDEIMD L   K+  + IKGI
Sbjct: 138 EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGI 197

Query: 183 VCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXX 242
           VCS              +R+ L DKIP+V VET+G  V + SL++G  VEFE        
Sbjct: 198 VCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATS 257

Query: 243 XXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDI 302
                     ++N  ++G++S ++ D +VI TCL+++ D N+V EP CGA+++  YNID 
Sbjct: 258 LGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDK 317

Query: 303 LENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPN 351
           L+N LG+ +  DD V++I CGGSS +L+D++E    L S  N    LP+
Sbjct: 318 LQNILGSDIKDDDYVILIGCGGSSTSLEDLKE----LSSFTNCEFELPS 362

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  301 bits (771), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 151/335 (45%), Positives = 205/335 (61%), Gaps = 3/335 (0%)

Query: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60
           M+  Y KTPL+R  F     R + + P+  LKYE  QPSGSFKSRGIGNLI K+  +I +
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTAN-PEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ 127

Query: 61  KGTKRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120
             + +P VF               ++L LPCTVVVP  T++RM+E+I+ TGA+VI  G+ 
Sbjct: 128 NSSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187

Query: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180
            KE+D YL+  +M  +N  ++ PIY HPFDNPLIWEGH+++VDE+++ L  Q VQ  ++K
Sbjct: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247

Query: 181 GIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXX 240
           GIVCSV             E+H L D IPVV VETEGC V + SL LG+ V         
Sbjct: 248 GIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMN-PKSVA 306

Query: 241 XXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300
                          A KY T+SV++    V++TCL + ++ N+VTEPACGA++HL Y+ 
Sbjct: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366

Query: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEET 335
           +ILE  LG  LT  D V+VIACGGS+  L D++E+
Sbjct: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKES 400

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  296 bits (758), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 201/329 (61%), Gaps = 5/329 (1%)

Query: 5   YNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTK 64
           YNKTPLL +    T     +  P+FFLKYE LQP GSFKSRGIG L+ K   +  + G K
Sbjct: 8   YNKTPLLPRVLTTT-----DGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGK 62

Query: 65  RPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEA 124
              VF               Q  S+ CTVVVP  TK RM+EKI+ TGA V++ G  W  A
Sbjct: 63  SLAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMA 122

Query: 125 DQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVC 184
           D+YL++ VM +++ +++ P+YVHPFDNP+IW+GHS+IVDE++  L+E+ V    +K IVC
Sbjct: 123 DEYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVC 182

Query: 185 SVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXX 244
           SV             E H+L D+IP++ +ET+GC V N SL  G  V  E          
Sbjct: 183 SVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLA 242

Query: 245 XXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILE 304
                   FENA KY ++S+++KD+ VIETCL +  D  +V EPACGAS++  Y+ ++L 
Sbjct: 243 SPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLP 302

Query: 305 NALGTKLTKDDTVVVIACGGSSNTLQDME 333
             +G +LT+DD +VVIACGGS+ T +D+E
Sbjct: 303 LYIGKELTEDDVIVVIACGGSAVTYKDLE 331

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  288 bits (736), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 199/328 (60%), Gaps = 6/328 (1%)

Query: 5   YNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTK 64
           Y KTPL+RQF     + K+NS   F++K+E LQP GSFKSRGIG+LI K   +   +G+ 
Sbjct: 6   YEKTPLIRQFL---NNGKTNSW--FYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG 60

Query: 65  RPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEA 124
           +  VF              C+ ++L C+VVVP  TK RM++KI+  GA VII G  W EA
Sbjct: 61  KLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEA 120

Query: 125 DQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVC 184
           D+YL+   M + +++    +YVHPFDN  IWEGHS+IVDEI++ L+E  +    +K +VC
Sbjct: 121 DEYLRHE-MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVC 179

Query: 185 SVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXX 244
           SV             +R++L +KIPVV VET GC V N SLK G  V  E          
Sbjct: 180 SVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLA 239

Query: 245 XXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILE 304
                   FE+  KYG +SV++ D DV+ TCL+Y  DYN + EPACGAS+HL Y+ +ILE
Sbjct: 240 SPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILE 299

Query: 305 NALGTKLTKDDTVVVIACGGSSNTLQDM 332
           + L  K+ +DD V++IACGGS  T +D+
Sbjct: 300 DILEQKIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  286 bits (733), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 144/337 (42%), Positives = 198/337 (58%), Gaps = 5/337 (1%)

Query: 5   YNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTK 64
           Y +TPL+ Q F         + P+ ++K+E LQP GSFKSRGIG+LI +   +    G+ 
Sbjct: 6   YERTPLIHQVF-----NNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSG 60

Query: 65  RPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEA 124
           +  VF              C  ++L CTVVVP  TK RMI+KI++ GA VII G+ W EA
Sbjct: 61  KLAVFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEA 120

Query: 125 DQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVC 184
           D+YL++ +M + ++     +YVHPFD+  IWEGHS+IVDE++  L+E+ +  + IK +VC
Sbjct: 121 DEYLRQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVC 180

Query: 185 SVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXX 244
           SV             ER+ L  KI V+ VET GC V N SL  G  +  E          
Sbjct: 181 SVGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLG 240

Query: 245 XXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILE 304
                   FE+   YG +SV++ D DV+ TCL+Y  DYN + EPACGAS+HL Y+ +ILE
Sbjct: 241 SPYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILE 300

Query: 305 NALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRS 341
           NAL  KL+ DD V++IACGGS  T +D+ ET  R+ S
Sbjct: 301 NALEQKLSDDDIVIIIACGGSCMTYEDLVETSRRISS 337

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  265 bits (676), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 188/328 (57%), Gaps = 5/328 (1%)

Query: 6   NKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKR 65
           +K+PLL + F   +S K    PQFFLKYE LQPSGSFKSRGIG LI  +A +   +    
Sbjct: 5   HKSPLLNRRF--KESEKDG--PQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSD 60

Query: 66  PEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEAD 125
             VF               + L+L CTVVVP  TK+ MI++I++ G+ VI+ G  W  AD
Sbjct: 61  VHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMAD 120

Query: 126 QYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCS 185
            YLK+ VM K+  N ++P+YVHPFD+PL+WEGHS ++DEI++ L+EQ     ++KGI+CS
Sbjct: 121 TYLKEVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICS 179

Query: 186 VXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXXX 245
           V             ERH    KIP++ VET G      SL  GK V              
Sbjct: 180 VGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGS 239

Query: 246 XXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILEN 305
                  FE A++Y TRS +  D + + T L++ ++ N++ EPAC AS+ L Y++D L  
Sbjct: 240 PYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNK 299

Query: 306 ALGTKLTKDDTVVVIACGGSSNTLQDME 333
            L  KL+  D V+VI CGGS+ T+ D+E
Sbjct: 300 LLSCKLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  239 bits (610), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 184/327 (56%), Gaps = 14/327 (4%)

Query: 7   KTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRP 66
           KTPLL    P       N  P F LKYE LQP GSFKSRGI +LI K  M          
Sbjct: 7   KTPLLPFREP------LNGGPTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENEL 59

Query: 67  EVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQ 126
            V+              C  L +PCTV+VP +TK RMI+KI+  GA V+I G  WKEAD 
Sbjct: 60  AVYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADT 119

Query: 127 YLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSV 186
           YL++ VM + + +  + +YVHPFDNP+IW+GHS+++DEI++ L E     +++KGIVCSV
Sbjct: 120 YLREYVMRQSSYS--NTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSV 177

Query: 187 XXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXXXX 246
                        ERH L   IPV  +ET+GC V + SL  G+ V  +            
Sbjct: 178 GGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGST 237

Query: 247 XXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILENA 306
                 F+ A+K+ ++S+++ D +V++TCL++  + +++ EPACGAS+H  Y  ++L   
Sbjct: 238 EICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL--- 294

Query: 307 LGTKLTKDDTVVVIACGGSSNTLQDME 333
               L  DD VVVI CGGS NT  D++
Sbjct: 295 --GPLGPDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  199 bits (505), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 94/226 (41%), Positives = 139/226 (61%), Gaps = 2/226 (0%)

Query: 114 VIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQK 173
           V +  A  KEAD YL+  V++     ++ PIYV+PFD+PLIWEGHS+I+DEI++TL ++ 
Sbjct: 5   VFVHVANLKEADYYLQNVVIDL--YKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQEN 62

Query: 174 VQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEF 233
           ++  ++KGI+CS              E++ L   IPVV VET+GC V N SL   K V+ 
Sbjct: 63  IEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQL 122

Query: 234 EXXXXXXXXXXXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGAS 293
           +                  F+N +KY ++S+++ D+D ++TC KY  D+  V EPACGAS
Sbjct: 123 DSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGAS 182

Query: 294 IHLAYNIDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRL 339
           +H AY+ ++LE AL  KL  DD +++IACGGS  T QD+E   ++L
Sbjct: 183 VHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQL 228

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  184 bits (468), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 117/189 (61%)

Query: 144 IYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHK 203
           +YVHPFDN  IWEGHS+IVDEI++ L+E  +    +K +VCSV             +R++
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 204 LVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXXXXXXXXXXFENALKYGTRS 263
           L +KIPVV VET GC V N SLK G  V  E                  FE+  KYG +S
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 264 VIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNIDILENALGTKLTKDDTVVVIACG 323
           V++ D DV+ TCL+Y  DYN + EPACGAS+HL Y+ +ILE+ L  K+ +DD V++IACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 324 GSSNTLQDM 332
           GS  T +D+
Sbjct: 192 GSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  112 bits (281), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 77/125 (61%), Gaps = 5/125 (4%)

Query: 5   YNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTK 64
           Y KTPL+RQF     + K+NS   F++K+E LQP GSFKSRGIG+LI K   +   +G+ 
Sbjct: 6   YEKTPLIRQFL---NNGKTNSW--FYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG 60

Query: 65  RPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEA 124
           +  VF              C+ ++L C+VVVP  TK RM++KI+  GA VII G  W EA
Sbjct: 61  KLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEA 120

Query: 125 DQYLK 129
           D+YL+
Sbjct: 121 DEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 83/201 (41%), Gaps = 17/201 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +  K   V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAKL-----DESQKTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K    +   N      + PFD
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTN------IPPFD 191

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  +I  EI+     Q    S IK + C+V             +R  +   I V
Sbjct: 192 HPYVIAGQGTIAMEIL----RQVHNASKIKAVFCAVGGGGLITGVGAYLKR--IAPHIKV 245

Query: 211 VGVETEGCHVFNTSLKLGKQV 231
           +GVET      +TSLK GK+V
Sbjct: 246 IGVETYDAATLHTSLKAGKRV 266

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 80/200 (40%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +  K   V                  +++P
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAKL-----DETQKNAGVIACSAGNHAQGVAFSSNHMNIP 142

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   GA V++ G  + EA     +    +   +      + PFD
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAKLECARLAEERGMTD------IPPFD 196

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  +I  EI+     Q    SNI  + C+V             +R  +   I V
Sbjct: 197 HPYVIAGQGTIAMEIL----RQVQNGSNIGAVFCAVGGGGLISGIGSYLKR--IAPHIKV 250

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET      + SLK GK+
Sbjct: 251 IGVETYDAATLDVSLKNGKR 270

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 88/204 (43%), Gaps = 19/204 (9%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K    +  +G     V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLGIP 154

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K+   K+++ E     + PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA-----KAECAKLSE-ERGLTNIPPFD 208

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSN-IKGIVCSVXXXXXXXXXXXXXERHKLVDKIP 209
           +P +  G  ++  EI+     ++V  +N I  +   V             +R  +   I 
Sbjct: 209 HPYVIAGQGTVAMEIL-----RQVHNANKINAVFVPVGGGGLIAGVGAYLKR--IAPHIK 261

Query: 210 VVGVETEGCHVFNTSLKLGKQVEF 233
           V+GVET      +TSL+ GK+ E 
Sbjct: 262 VIGVETYDATTLHTSLQNGKRTEL 285

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 83/200 (41%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +G     V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDSQKNQG-----VIACSAGNHAQGVAFAAKHMSIP 144

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K+   ++++ E     + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA-----KAECTRLSE-ERGLTNIPPFD 198

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+  +R      + I  +                 +R  +   I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET      +TSLK GK+
Sbjct: 253 IGVETFDSATLHTSLKNGKR 272

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 79/200 (39%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +G     V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAYAAKHLGIP 144

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K    +   N      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 198

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     ++V  +N  G V  V                ++   I V
Sbjct: 199 HPYVIAGQGTVAMEIL-----RQVHNANKIGAVF-VPVGGGGFIAGVGAYLKRIAPHIKV 252

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET      +TSLK  K+
Sbjct: 253 IGVETFDAATLHTSLKHNKR 272

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 79/200 (39%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I         +  K   V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISNL-----DEYQKSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
             +V+PT+T       +   GA V++ G  + EA     +  + +++K    P    PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKAECAR--LAQLHKLTDIP----PFD 190

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  +I  EI+     Q    S I  + C V             +R  +   I +
Sbjct: 191 HPYVIAGQGTIATEIL----RQVHNASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET      +T+LK G++
Sbjct: 245 IGVETHDAPTLHTALKQGRR 264

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 81/201 (40%), Gaps = 17/201 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N++ K          K   V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAKL-----DDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     +    +   N      + PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN------IPPFD 195

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     ++V  +N  G V  V                ++   I +
Sbjct: 196 HPYVIAGQGTVAMEIL-----RQVHKANKIGAVF-VPVGGGGLIAGVGAYLKRIAPHIKI 249

Query: 211 VGVETEGCHVFNTSLKLGKQV 231
           +GVET   +   TSL+ GK+V
Sbjct: 250 IGVETFDANCLYTSLQSGKRV 270

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 79/200 (39%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +G     V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAKLDDTQRNQG-----VIACSAGNHAQGVAYAARHLDIP 146

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K    +   N      + PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 200

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     ++V  SN  G V  V                ++   I +
Sbjct: 201 HPYVIAGQGTVAMEIL-----RQVYNSNKIGAVF-VPVGGGGLIAGVGAYLKRVTPHIKI 254

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET      +TSL+  K+
Sbjct: 255 IGVETHDAATLHTSLQRNKR 274

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 80/201 (39%), Gaps = 19/201 (9%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +  K   V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKL-----DENQKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K    +   N      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPFD 198

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPS-NIKGIVCSVXXXXXXXXXXXXXERHKLVDKIP 209
           +P +  G  ++  EI+     ++V  S  I  +   V             +R  +   I 
Sbjct: 199 HPYVIAGQGTVAMEIL-----RQVHNSLKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIK 251

Query: 210 VVGVETEGCHVFNTSLKLGKQ 230
           +VGVET      + S+K GK+
Sbjct: 252 IVGVETHDAPTLSASMKTGKR 272

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 78/204 (38%), Gaps = 17/204 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK + L P  SFK RG  N++ K       +G     V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHAQGVAYAAKHLKIP 143

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     +    +   N      + PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN------IPPFD 197

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     Q    S I  +   V             +R  +   I +
Sbjct: 198 HPYVIAGQGTVAMEIL----RQVHMSSKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 211 VGVETEGCHVFNTSLKLGKQVEFE 234
           +GVET       TSL+ GK+   E
Sbjct: 252 IGVETYDACALYTSLQSGKRAALE 275

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 95/264 (35%), Gaps = 17/264 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N+I K       +G     V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLNIP 145

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K    +   N      + PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 199

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     ++V  +N K     V                ++   I +
Sbjct: 200 HPYVIAGQGTVAMEIL-----RQVHNAN-KIGAVFVPVGGGGLVAGVGAYLKRIAPHIKI 253

Query: 211 VGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXXXXXXXXXXXFENALKYGTRSVIVKDAD 270
           +GVET       TSLK G++                      F  A +     V+V   +
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 271 VIETCLKYTKDYNMVTEPACGASI 294
           +        +D   + EP+   S+
Sbjct: 314 ICAAVKDVFEDTRSIVEPSGALSV 337

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 92/230 (40%), Gaps = 22/230 (9%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           V N++P+ +       S K NS  Q  LK E L P  SFK RG  N++ K      K+G 
Sbjct: 69  VINESPMTKGI---GLSSKLNS--QIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG- 122

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P +T     E +   G+ V++ G  +  
Sbjct: 123 ----VIACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDS 178

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
           +    ++         E   + + PFD+P +  G  ++    M+ LR+ K   + I  + 
Sbjct: 179 SKGECERLC------EERGLVNIPPFDHPYVIAGQGTVA---MEILRQVK-NSAKIGAVF 228

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEF 233
             V             +R  +   I +VGVET       TSL  GK+ E 
Sbjct: 229 VPVGGGGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTEL 276

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 105/291 (36%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           V N++P+ +    G  SR + ++    LK E L P  SFK RG  N+I K       +G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDE 184

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
           A     K    +   N      + PFD+P +  G  ++  EI+  +R      + I  + 
Sbjct: 185 AKAECAKLAEERGLTN------IPPFDHPYVIAGQGTVAMEILRQVR----TANKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXX 243
             V             +R  +   I V+GVET      + SL+  ++             
Sbjct: 235 VPVGGGGLIAGIGAYLKR--VAPHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGT 292

Query: 244 XXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASI 294
                    F  A +     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 105/291 (36%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           V N++P+ +    G  SR + ++    LK E L P  SFK RG  N+I K       +G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDE 184

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
           A     K    +   N      + PFD+P +  G  ++  EI+  +R      + I  + 
Sbjct: 185 AKAECAKLAEERGLTN------IPPFDHPYVIAGQGTVAMEILRQVR----TANKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXX 243
             V             +R  +   I ++GVET      + SL+  ++             
Sbjct: 235 VPVGGGGLIAGIGAYLKR--VAPHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGT 292

Query: 244 XXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASI 294
                    F  A +     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 88/223 (39%), Gaps = 22/223 (9%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           + N++P+ R  F    S + N+  Q  LK E L P  SFK RG  N+I      + KK  
Sbjct: 69  IINESPISRSEF---LSSRLNTDVQ--LKREDLLPVFSFKLRGAYNMI-SHLDDVQKKCG 122

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P +T     + +   GA V++ G     
Sbjct: 123 ----VIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYG----- 173

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
            D +    V       E     + PFD+P +  G  +I  EI+  ++      S I  + 
Sbjct: 174 -DNFDAAKVECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVF 228

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLK 226
           C+V             +R      I V+GVET      +TS++
Sbjct: 229 CAVGGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQ 269

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 105/291 (36%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           V N++P+ +    G  SR + ++    LK E L P  SFK RG  N+I K       +G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDE 184

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
           A     K    +   N      + PFD+P +  G  ++  EI+  +R      + I  + 
Sbjct: 185 AKAECTKLAEERGLTN------IPPFDHPYVIAGQGTVAMEILRQVRTV----NKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXX 243
             V             +R  +   I V+GVET      + SL+  ++             
Sbjct: 235 VPVGGGGLIAGIGAYLKR--IAPHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGT 292

Query: 244 XXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASI 294
                    F  A +     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 343

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 105/291 (36%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           V N++P+ +    G  SR + ++    LK E L P  SFK RG  N+I K       +G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDE 184

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
           A     K    +   N      + PFD+P +  G  ++  EI+  +R      + I  + 
Sbjct: 185 AKAECAKLAEERGLTN------IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXX 243
             V             +R  +   I V+GVET      + SL+  ++             
Sbjct: 235 VPVGGGGLIAGIGAYLKR--VAPHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGT 292

Query: 244 XXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASI 294
                    F  A +     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 343

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 82/200 (41%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N++ K       +G     V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHAQGVAFAAKHLDIP 152

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA     K+   K++K E     + PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA-----KAECTKLSK-ERGLTNIPPFD 206

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     ++V  +N K     V                ++   I +
Sbjct: 207 HPYVIAGQGTVAMEIL-----RQVHIAN-KIGAVFVPVGGGGLVAGVGAYLKRIAPHIKI 260

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET       TSL+ G++
Sbjct: 261 IGVETFDASTLYTSLQRGRR 280

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/285 (19%), Positives = 100/285 (35%), Gaps = 29/285 (10%)

Query: 6   NKTPLLRQFFPGTKSRKSNS--LPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           NKTP+L        SR  N+    + + K E  Q  G+FK RG  N +LK   +    G 
Sbjct: 21  NKTPVL-------TSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG- 72

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L +P T+V+P       +      GAN++    + ++
Sbjct: 73  ----VVAFSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTED 128

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIV 183
            +Q      + +    E     V P+D+P +  G  +   E+++ + E           +
Sbjct: 129 REQ------IGRALAEEKGLTLVPPYDHPDVIAGQGTAAKELIEEVGELD---------L 173

Query: 184 CSVXXXXXXXXXXXXXERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEXXXXXXXXX 243
             V                +L  +  ++GVE E  +    SL+ G  V  +         
Sbjct: 174 LFVPLGGGGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGA 233

Query: 244 XXXXXXXXXFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEP 288
                    FE         +   DA+++++   + +   +V EP
Sbjct: 234 QTQHLGQYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEP 278

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 76/198 (38%), Gaps = 17/198 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N++ K A     KG     V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLAEGQGNKG-----VIACSAGNHAQGVAFASRHLNIP 137

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
             +V+P  T     + +   G  V++ G  + EA     K    +I++ E     + PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA-----KIECARISE-ERGLTNIPPFD 191

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     Q    S I  +   V             +R  +   I +
Sbjct: 192 HPYVIAGQGTVAMEIL----RQVHNASKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 245

Query: 211 VGVETEGCHVFNTSLKLG 228
           VGVET       TSL  G
Sbjct: 246 VGVETYDSATLKTSLDAG 263

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 79/200 (39%), Gaps = 17/200 (8%)

Query: 31  LKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRLSLP 90
           LK E L P  SFK RG  N++ K +     +  K   V                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLS-----EAQKNQGVIACSAGNHAQGVAFASRHLNIP 148

Query: 91  CTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDPIYVHPFD 150
             +V+P  T     + +   G  V++ G  + EA     K+   +I++ E     + PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA-----KTECTRISE-ERGLTNIPPFD 202

Query: 151 NPLIWEGHSSIVDEIMDTLREQKVQPSNIKGIVCSVXXXXXXXXXXXXXERHKLVDKIPV 210
           +P +  G  ++  EI+     Q    + I  +   V             +R  +   I +
Sbjct: 203 HPYVIAGQGTVAMEIL----RQVHNAAKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 256

Query: 211 VGVETEGCHVFNTSLKLGKQ 230
           +GVET       TSL+ G +
Sbjct: 257 IGVETYDSATLKTSLEAGTR 276

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 20/164 (12%)

Query: 6   NKTPLLRQFFPGTKSRKSNSL--PQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63
           NKTP+L        SR  N     Q + K E  Q  G+FK RG  N + K + +   KG 
Sbjct: 21  NKTPVL-------TSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG- 72

Query: 64  KRPEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKE 123
               V                + L++P T+V+P       +      GA++I    + ++
Sbjct: 73  ----VIAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTED 128

Query: 124 ADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMD 167
            +Q  ++         E     + P+D+P +  G  +   E+++
Sbjct: 129 REQIGRQLAA------EHGFALIPPYDHPDVIAGQGTSAKELLE 166

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 67/166 (40%), Gaps = 16/166 (9%)

Query: 6   NKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKR 65
           NKTP+L      +++       + + K E  Q  G+FK RG  N + K + +  KKG   
Sbjct: 21  NKTPVLT-----SRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDKERKKG--- 72

Query: 66  PEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEAD 125
             V                +  ++P T+++P       +      GA+ II    + E  
Sbjct: 73  --VIAFSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAH-IIKYNRYTEDR 129

Query: 126 QYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLRE 171
           +++ + +  K        + + P+D+P +  G  +   E+ + + E
Sbjct: 130 EHIGRQLAAKHGY-----VLIPPYDHPDVIAGQGTSAKELFEEVGE 170

>KLLA0C18029g Chr3 complement(1601829..1602983) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53206 Saccharomyces cerevisiae
           YGR012W Hypothetical ORF
          Length = 384

 Score = 36.6 bits (83), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 58/154 (37%), Gaps = 8/154 (5%)

Query: 8   TPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT--KR 65
           TP++R      KS    +    F K E   P GS K R   N+I   + Q   KG+  K+
Sbjct: 51  TPMVR-----IKSLSDYTGLNVFAKMELNNPGGSAKDRVALNIIKTISSQEGIKGSSDKK 105

Query: 66  PEVFXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKQRMIEKIKDTGANV-IIDGAFWKEA 124
             +F              C  L   C + +P  T Q  +  +   GA V  +  A   + 
Sbjct: 106 NRIFEGTSGSTGISLAICCNALGYSCHISLPDDTSQEKLSLLTALGAIVNKVKPASIVDP 165

Query: 125 DQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGH 158
           +QY+  +        E   ++   F+N   W+ H
Sbjct: 166 NQYVNAAKSCSEEYTEGVGVFADQFENEANWKCH 199

>NDAI0J01760 Chr10 complement(432212..433558) [1347 bp, 448 aa] {ON}
           Anc_4.131 YLR321C
          Length = 448

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 11/91 (12%)

Query: 86  RLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWKEADQYLKKSVMNKINKNEIDP-- 143
           R+S+P   ++P++++Q+ I      G  +I      + A   +K S    IN + I P  
Sbjct: 168 RISIPTQTLLPSSSEQKSI------GPIIIPIHLNIEHAGHVIKDSFTWNINDHSISPAE 221

Query: 144 ---IYVHPFDNPLIWEGHSSIVDEIMDTLRE 171
              IY    D+P     HS+IV  I D + E
Sbjct: 222 FATIYCKDLDSPSNSSLHSTIVQSINDQINE 252

>KAFR0F03450 Chr6 (686311..687471) [1161 bp, 386 aa] {ON} 
          Length = 386

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 55/135 (40%), Gaps = 4/135 (2%)

Query: 28  QFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGTKRPEVFXXXXXXXXXXXXXXCQRL 87
           + + K E + P+GS K R   N++     Q   K  +   VF              C  L
Sbjct: 65  EVYAKLELVNPAGSAKDRVALNIVQTAEKQGLLKRGEPGWVFEGTSGSTGISIAMICNAL 124

Query: 88  SLPCTVVVPTATKQRMIEKIKDTGANV-IIDGAFWKEADQYL--KKSVMNKINKNEID-P 143
                + +P  T    +  ++  GA V ++  A   + +QY+   KS   ++N+  ++  
Sbjct: 125 GYKAHISLPDDTSNEKLALLESLGAVVNMVKPASIVDPNQYVNASKSACEELNRKGVERG 184

Query: 144 IYVHPFDNPLIWEGH 158
           ++   F+N   W+ H
Sbjct: 185 VFADQFENEANWKVH 199

>NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.103
           YGL018C
          Length = 188

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 280 KDYNMVTEPACGAS--IHLAYNIDILENALGTKLTKDDTVVVIACGGSSNTLQDM--EET 335
           K Y+++ EP   +   I L  N+D+ ++++  K+T+ D  +++        L D+  EE 
Sbjct: 67  KAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMDIDTEED 126

Query: 336 LLRLRSEENAAMT-----LPNPFLKVNKETFLK 363
           + ++R E    M      L N F K + ET +K
Sbjct: 127 VKKIRRENTERMATIEGQLENAFKKKDFETAIK 159

>Suva_6.33 Chr6 complement(57692..60781) [3090 bp, 1029 aa] {ON}
           YFL025C (REAL)
          Length = 1029

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 126 QYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHS--SIVDEIMDTLREQKVQPSNIKGIV 183
           +YL  +V   ++  E  P Y HP    +I  GHS   IV  +M TL+     P +I+ I+
Sbjct: 204 EYLNDAVRYILSLYETTPNYSHPIPESVIMVGHSMGGIVSRVMLTLKNHI--PGSIRSIL 261

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,393,805
Number of extensions: 1334599
Number of successful extensions: 3637
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3604
Number of HSP's successfully gapped: 62
Length of query: 365
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 254
Effective length of database: 40,753,473
Effective search space: 10351382142
Effective search space used: 10351382142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)