Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C054005.528ON48148118030.0
TDEL0A039205.528ON4662704193e-45
Suva_13.1555.528ON6453214273e-45
Smik_13.1445.528ON6393254256e-45
KNAG0B036805.528ON4823024109e-44
YML007W (YAP1)5.528ON6503084063e-42
ZYRO0D12584g5.528ON5793703929e-41
Skud_13.1475.528ON6653123941e-40
SAKL0G04950g5.528ON5672943654e-37
NDAI0C010605.528ON6373013515e-35
CAGL0H04631g5.528ON588623063e-29
NCAS0H025605.528ON587623031e-28
KLTH0G03784g5.528ON569622886e-27
Kwal_47.186315.528ON584622824e-26
TBLA0G009305.528ON608602826e-26
KLLA0A01760g5.528ON583612763e-25
Kpol_1023.975.528ON591622728e-25
Kpol_1004.225.528ON475622469e-22
TPHA0D023405.528ON506612461e-21
TPHA0K005205.528ON560612443e-21
TBLA0D016405.528ON599541911e-14
NCAS0F011005.528ON4752671695e-12
Ecym_40645.528ON4261421588e-11
NDAI0H016105.528ON519621411e-08
YDR423C (CAD1)5.528ON409531373e-08
KAFR0E032905.528ON2651021282e-07
Suva_2.600singletonOFF382531275e-07
CAGL0F03069g5.528ON486911251e-06
Smik_4.6985.528ON393531213e-06
ADR195C5.528ON288781167e-06
KNAG0C032105.528ON384551053e-04
YHL009C (YAP3)2.493ON330129800.28
ABR127C8.790ON35048751.2
ZYRO0B01254g2.500ON39962732.1
YPR199C (ARR1)na 1ON29455722.2
Smik_8.332.493ON331125722.5
Skud_16.2948.113ON120337714.2
Smik_16.2498.113ON120337714.2
Suva_8.432.493ON330129679.8
NOTE: 1 genes in the same pillar as KAFR0C05400 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C05400
         (481 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   699   0.0  
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   166   3e-45
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   169   3e-45
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   168   6e-45
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   162   9e-44
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   160   3e-42
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   155   9e-41
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   156   1e-40
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   145   4e-37
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   139   5e-35
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   122   3e-29
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   121   1e-28
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   115   6e-27
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   113   4e-26
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   113   6e-26
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   110   3e-25
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   109   8e-25
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    99   9e-22
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    99   1e-21
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    99   3e-21
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    78   1e-14
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    70   5e-12
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    65   8e-11
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    59   1e-08
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    57   3e-08
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    54   2e-07
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    54   5e-07
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    53   1e-06
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    51   3e-06
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    49   7e-06
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    45   3e-04
YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}  YAP...    35   0.28 
ABR127C Chr2 complement(634207..635259) [1053 bp, 350 aa] {ON} S...    33   1.2  
ZYRO0B01254g Chr2 (106790..107989) [1200 bp, 399 aa] {ON} simila...    33   2.1  
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    32   2.2  
Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON} YH...    32   2.5  
Skud_16.294 Chr16 complement(541842..545453) [3612 bp, 1203 aa] ...    32   4.2  
Smik_16.249 Chr16 complement(453693..457304) [3612 bp, 1203 aa] ...    32   4.2  
Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON} YH...    30   9.8  

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/481 (77%), Positives = 374/481 (77%)

Query: 1   MSALTASTKRPLEXXXXXXXXXXXKNAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQXX 60
           MSALTASTKRPLE           KNAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQ  
Sbjct: 1   MSALTASTKRPLESTTSTDNDTDDKNAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQRA 60

Query: 61  XXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNY 120
                          VDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNY
Sbjct: 61  FRERKERKMKELEAKVDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNY 120

Query: 121 LAKHENGNFNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDK 180
           LAKHENGNFNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDK
Sbjct: 121 LAKHENGNFNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDK 180

Query: 181 KNYPSSVXXXXXXXXXXXXXXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSN 240
           KNYPSSV                         GISPSINWLDNMLHTEDLFNEQLSSFSN
Sbjct: 181 KNYPSSVSSIEPLNQNNNNNISSLSPSLDDNDGISPSINWLDNMLHTEDLFNEQLSSFSN 240

Query: 241 TPISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSN 300
           TPISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSN
Sbjct: 241 TPISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSN 300

Query: 301 LPSTESTPLFTNTFDSPSFGQLNIQNIEXXXXXXXXXXXXXXXXGIFSFLNPSLAFPSST 360
           LPSTESTPLFTNTFDSPSFGQLNIQNIE                GIFSFLNPSLAFPSST
Sbjct: 301 LPSTESTPLFTNTFDSPSFGQLNIQNIESTNSDNTNNDTTPDDNGIFSFLNPSLAFPSST 360

Query: 361 SPEXXXXXXXXXXXXXXXXXXXXXXFRDTSIFDDFLKHEAEPSXXXXXXXXXXXXXXXXP 420
           SPE                      FRDTSIFDDFLKHEAEPS                P
Sbjct: 361 SPENSLSDGSINNNIDNNNNSSLNNFRDTSIFDDFLKHEAEPSVEDLINEEIDDINDVVP 420

Query: 421 SKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480
           SKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL
Sbjct: 421 SKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480

Query: 481 S 481
           S
Sbjct: 481 S 481

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  166 bits (419), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 138/270 (51%), Gaps = 29/270 (10%)

Query: 219 NWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDF 278
            W+DN+ +++D   ++L  F+     + DS       T   L SNEFNF+DQFDE+V+ F
Sbjct: 216 GWMDNVFYSDDA--QKLPQFA----IKGDS-------TADPLFSNEFNFDDQFDEQVSQF 262

Query: 279 CIKMNQVCGTRSNPIPKKSTSNL-PSTESTPLFTNTFD---SPSFGQLNIQNIEXXXXXX 334
           C KMN+ CGTR  PIP  +     P   S  + TN++D   SP+FGQ ++   +      
Sbjct: 263 CTKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWDTVASPAFGQQSLAPSKKQLTKT 322

Query: 335 XXXXXXXXXXGIFSFLNPSLAFPSSTSPEXXXXXXXXXXXXXXXXXXXXXXFRDTSIFDD 394
                         F++P++AFP+    E                        D +  ++
Sbjct: 323 PPSQPE------LPFIDPTMAFPTDDD-EGLFFRTHRDENSLFAELLDEVEPTDNNFVNE 375

Query: 395 FLKHEAEPSXXXXXXXXX----XXXXXXXPSKDKNLLRCSEVWDRITAHPKYSDIDIDGL 450
            L +E EPS                    PS+D  LL+CSEVWDRIT HPKYS IDIDGL
Sbjct: 376 NLINE-EPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGL 434

Query: 451 CGELMAKAKCSEKGVVVNAEDVQSALSKHL 480
           CGELM KAKCSEKGVVV AEDVQ  L KH+
Sbjct: 435 CGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  169 bits (427), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 160/321 (49%), Gaps = 46/321 (14%)

Query: 29  PKKNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEI 88
           P++  +  S + +LD E KLKRTAQNRAAQ                 V  L +IQ++NE+
Sbjct: 49  PRRKGSKTSKKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEV 108

Query: 89  ESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE--------------------NGN 128
           E+ FLR QL+TLV ELKKYRPET NDS+VL YLA+ +                    N +
Sbjct: 109 EATFLRDQLVTLVSELKKYRPETRNDSKVLEYLARRDPNLHPPNSNTNNNSEPIVTPNDD 168

Query: 129 FNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDKKNYPSSVX 188
             +N+ +K NF+F +P D++       DN        +PSP++   +A          + 
Sbjct: 169 IQKNVKQKMNFTFQYPLDND-------DNDGKNMEKQLPSPNDPNHSAHVPIAPTQKKLS 221

Query: 189 XXXXXXXXXXXXXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSNTPISRNDS 248
                                     S S++WLDN+++T        + F      +N S
Sbjct: 222 DATDSSTATLDSFSNNNDVLNITPNSSSSMDWLDNVMYT--------NKFVAGGDQKNAS 273

Query: 249 NESKN--PMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPS--- 303
           NESK+     DS + SN+FNFE+QFDE+V++FC KMNQ CGT+  PIPKKS   L     
Sbjct: 274 NESKSKPKGVDSNMFSNDFNFENQFDEQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVF 333

Query: 304 ------TESTPLFTNTFDSPS 318
                 + ++P+ TNT+DS S
Sbjct: 334 ASSSVLSANSPVLTNTWDSHS 354

 Score =  119 bits (297), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PSK+ +LLRCSE+WDRIT HPKYSDID+DGLC ELMAKAKCSE+GVV+NAEDVQ AL+KH
Sbjct: 584 PSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKH 643

Query: 480 L 480
           +
Sbjct: 644 M 644

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  168 bits (425), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 120/325 (36%), Positives = 159/325 (48%), Gaps = 53/325 (16%)

Query: 26  NAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQ 85
           N  PK+     S + +LD E K KRTAQNRAAQ                 V  L +IQ+Q
Sbjct: 46  NEQPKRKGTKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQ 105

Query: 86  NEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE-------------------- 125
           NE+E+ FLR QL+TLV ELKKYRPET NDS+VL YLAK +                    
Sbjct: 106 NEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIIT 165

Query: 126 -NGNFNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNIPSPD--NSPVTASNDKKN 182
            N    EN+ +K NF+F +P D+     D  +N N      +PSP+  N  V+    +K 
Sbjct: 166 PNDEIQENVKQKMNFTFQYPLDN-----DSDENKNKER--QLPSPNDPNHSVSIPIAQKQ 218

Query: 183 YPSSVXXXXXXXXXXXXXXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSNTP 242
             SS                            S S++WLDN+++T            N  
Sbjct: 219 KKSS--NTTDSSSATLDSLSNSNDVLNNTPNSSSSMDWLDNVIYT------------NKF 264

Query: 243 ISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLP 302
           +S +D  + +    DS L SN+FNFE+QFDE+V++FC KMNQVCGTR  PIPKK  S L 
Sbjct: 265 VSGDDGCKRETKNVDSNLFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPVSTLD 324

Query: 303 S---------TESTPLFTNTFDSPS 318
                     + ++P  TNT++S S
Sbjct: 325 KEVFASSSILSANSPSLTNTWESHS 349

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PSK+ +LLRCSE+WDRIT HPKYSDID+DGLC ELMAKAKCSE+GVV+NAEDVQ AL+KH
Sbjct: 578 PSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKH 637

Query: 480 L 480
           +
Sbjct: 638 M 638

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  162 bits (410), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 152/302 (50%), Gaps = 64/302 (21%)

Query: 26  NAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQ 85
            A P K     +S+  LD+EA++KRT QNRAAQ                 VD L+ IQKQ
Sbjct: 30  GAEPLKKRTHTASKP-LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQ 88

Query: 86  NEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFNEN-----LSKKSNFS 140
           NE+ESEFLR QL+TLV ELKKYRPET+NDS+VL YLAKH+N   N+         + +FS
Sbjct: 89  NEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLAKHDNVPPNQQGQAPAARDRGDFS 148

Query: 141 FAFPWDDNNATTDKSDN-LNTTTNNNIPSPDNSPVTASNDKKNYPSSVXXXXXXXXXXXX 199
           F FPW     T  + DN     T    PSP  SP T   D++  P+              
Sbjct: 149 FEFPW--KGRTAPEFDNSTTQETTTATPSP-VSPGT--KDQQGKPT-------------- 189

Query: 200 XXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKNPMT--- 256
                              +WLD +L + +L       ++     +   N S++P     
Sbjct: 190 -------------------DWLDEVLSSTEL-------YAKQQQQQLQGNRSESPFLAGY 223

Query: 257 -DSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPSTESTPLFTNTFD 315
            DS  +SNE  F+ QFDE+V+DFC++MN+ CG+++NP+PK    +        +F+N+  
Sbjct: 224 DDSLTVSNEITFDTQFDEQVSDFCVRMNEACGSKTNPVPKSKKGS--------VFSNSVL 275

Query: 316 SP 317
           SP
Sbjct: 276 SP 277

 Score =  117 bits (294), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (93%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PSKD  LL+CSE+WDRITAHPKYSD+DIDGLCGELM KAKCSE+GVVVNA+DV+ AL++H
Sbjct: 421 PSKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALNRH 480

Query: 480 LS 481
           ++
Sbjct: 481 IA 482

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  160 bits (406), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 152/308 (49%), Gaps = 47/308 (15%)

Query: 41  ELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLRSQLITL 100
           +LD E K KRTAQNRAAQ                 V  L +IQ+QNE+E+ FLR QLITL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITL 120

Query: 101 VKELKKYRPETANDSQVLNYLAKHE---------------------NGNFNENLSKKSNF 139
           V ELKKYRPET NDS+VL YLA+ +                     N +  EN+ +K NF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180

Query: 140 SFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDKKNYPSSVXXXXXXXXXXXX 199
           +F +P D++N   +  +         +PSP++   +A          +            
Sbjct: 181 TFQYPLDNDNDNDNSKN-----VGKQLPSPNDPSHSAPMPINQTQKKLSDATDSSSATLD 235

Query: 200 XXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKNPMTDSQ 259
                          S S++WLDN+++T            N  +S +D + SK    DS 
Sbjct: 236 SLSNSNDVLNNTPNSSTSMDWLDNVIYT------------NRFVSGDDGSNSKTKNLDSN 283

Query: 260 LISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNL---------PSTESTPLF 310
           + SN+FNFE+QFDE+V++FC KMNQVCGTR  PIPKK  S L           + ++P  
Sbjct: 284 MFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNSPAL 343

Query: 311 TNTFDSPS 318
           TNT++S S
Sbjct: 344 TNTWESHS 351

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PSK+ +LLRCSE+WDRIT HPKYSDID+DGLC ELMAKAKCSE+GVV+NAEDVQ AL+KH
Sbjct: 589 PSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKH 648

Query: 480 L 480
           +
Sbjct: 649 M 649

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  155 bits (392), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 125/370 (33%), Positives = 170/370 (45%), Gaps = 58/370 (15%)

Query: 5   TASTKRPLEXXXXXXXXXXXKNAIPK----KNNASKSSRTELDQEAKLKRTAQNRAAQXX 60
           T S KRPLE            +  P     +    K  R  LD EAK KRTAQNRAAQ  
Sbjct: 3   TTSAKRPLEPTVSLDFAEDEADDSPTSDEPRKKGGKPGRKPLDSEAKSKRTAQNRAAQRA 62

Query: 61  XXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNY 120
                          V  L  + +Q+ +E+EFLRSQL+TLV ELK+YRPE  NDSQVL Y
Sbjct: 63  FRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQY 122

Query: 121 LAKHENGN---------------FNENLSKKSNFSFAFPWDD--NNATTDKSDNLNTTT- 162
           LAK EN                   E++ +K +F+FAFPW +  NN   +  D  N ++ 
Sbjct: 123 LAKTENSKSDDSSQNKKDSESKEIEESVRRKMSFTFAFPWKNEFNNDHRNSEDKGNLSSH 182

Query: 163 -----------NNNI------------PSPDNSPVTASNDKKNYPSSVXXXXXXXXXXXX 199
                      NNNI             S  +S      +  + PS+             
Sbjct: 183 GEQQRSKQQHDNNNILMQFPSPGSSSKSSSQSSSSLKPKNGLSTPSNGDGIRKGSTGNNS 242

Query: 200 XXXXXXXXXXXXXGISP---SINWLDNMLHTEDLFNEQLSSF----SNTPISRNDSNESK 252
                        G +P   S  W+DN+ + +D    QL  F    +N   SR   + + 
Sbjct: 243 SINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDA--RQLPQFYQSNNNNENSRLFEDNTT 300

Query: 253 NPM-TDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNL--PSTESTPL 309
            P   DS   SN+FNF D+FDE+V++FC K+ QVCGT+  PIP+K  S+   P+   +P+
Sbjct: 301 MPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI 360

Query: 310 -FTNTFDSPS 318
            F+NT+D+PS
Sbjct: 361 VFSNTWDTPS 370

 Score =  109 bits (273), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (86%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS D  LL+CSEVWDRIT+HPKYSD+DIDGLC ELMAKAKCSE+GVVV AEDVQ AL+  
Sbjct: 518 PSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNR 577

Query: 480 L 480
           +
Sbjct: 578 V 578

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  156 bits (394), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 151/312 (48%), Gaps = 60/312 (19%)

Query: 41  ELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLRSQLITL 100
           +LD E K KRTAQNRAAQ                 V  L NIQ+QNE+E+ FLR QL+TL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTL 120

Query: 101 VKELKKYRPETANDSQVLNYLAKHE---------------------NGNFNENLSKKSNF 139
           V ELKKYRPET NDS+VL YLA  +                     +    EN+ +K NF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPTSNNSTNSSSNRPIITPSEEIQENVRQKMNF 180

Query: 140 SFAFPWDDNNATTDKSDNLNTTTNNNIPSPDN----SPVTASNDKKNYPSSVXXXXXXXX 195
           +F +  D+++   +K           +PSP++    +P+  +  +K    +         
Sbjct: 181 TFQYALDNDSKNLEKQ----------LPSPNDPSHSAPIPTTQAQKKSSDATDSSTATLD 230

Query: 196 XXXXXXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKNPM 255
                              S S++WLDN+++T            N  ++  D ++ +   
Sbjct: 231 SLSNSHDVLNNTPNS----SSSMDWLDNVIYT------------NRFVAGGDGSKLEVKN 274

Query: 256 TDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPS---------TES 306
            DS + SN FNFE+QFDE+V++FC KMNQVCGTR  PIPKK  S L           + +
Sbjct: 275 VDSNMFSNNFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSAN 334

Query: 307 TPLFTNTFDSPS 318
           +P  TNT++S S
Sbjct: 335 SPALTNTWESHS 346

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PSK+ +LLRCSE+WDRIT HPKYSDID+DGLC ELMAKAKCSE+GVV+NAEDVQ AL+KH
Sbjct: 604 PSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKH 663

Query: 480 L 480
           +
Sbjct: 664 M 664

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  145 bits (365), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 149/294 (50%), Gaps = 73/294 (24%)

Query: 34  ASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFL 93
           ASK  R  L  EAK KRTAQNRAAQ                 V HL  +++QNE+E+EFL
Sbjct: 46  ASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFL 105

Query: 94  RSQLITLVKELKKYRPETANDSQVLNYLAKHE-----------NGNFN------------ 130
           RSQL+TL+ ELKKYRPE + D+QVL YLAK E            G+ N            
Sbjct: 106 RSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSS 165

Query: 131 ------ENLSKKSNFSFAFPWDDNNATTD-KSDNLNTTTNNNIPS-PDNSPVTASNDKKN 182
                 +N+ KK +F+F FPW DN   T   S   ++ ++N+ PS   N+P  A+N   N
Sbjct: 166 SESHIRDNIQKKMDFTFEFPWKDNAGRTQFPSPGSSSVSSNHKPSFSSNAPFNATN---N 222

Query: 183 YPSSVXXXXXXXXXXXXXXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSFSNTP 242
            PS+                            S S+    +M + +D     L  F+++ 
Sbjct: 223 TPSTS---------------------------SASL----DMFYQDDA----LPKFTSSS 247

Query: 243 ISRNDSNESKNPMTDSQL-ISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPK 295
           + R +++ +   + D+   I+N+F+FE  FDE+V++FC +MNQ CGTR +P+P+
Sbjct: 248 LERGNNSGT---IADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQ 298

 Score =  113 bits (283), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 47/62 (75%), Positives = 55/62 (88%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS+D  LL+C E+WDRIT+HPKYSD+DIDGLC EL  KAKCSEKGVVVNA+DVQ AL+KH
Sbjct: 506 PSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKH 565

Query: 480 LS 481
           +S
Sbjct: 566 MS 567

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  139 bits (351), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 146/301 (48%), Gaps = 32/301 (10%)

Query: 30  KKNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIE 89
           +++N +   +  LD EA+ KRTAQNRAAQ                 V +L+ IQKQNEIE
Sbjct: 60  EQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIE 119

Query: 90  SEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENG-----NFNENLSKKSNFSFAFP 144
           SEFLRSQLITLV ELKKY+P   N S+VLNY++   +      N N   S   + + A  
Sbjct: 120 SEFLRSQLITLVNELKKYKPNNENASKVLNYISNSNSNSNPDLNLNSKFSPMESDASAMK 179

Query: 145 WDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDKKNYPSSVXXXXXXXXXXXXXXXXX 204
               + ++  S N  T T+ + PS   +    SN     P +                  
Sbjct: 180 RSTGSVSSGDS-NSRTMTSMDAPSMSTTTSVQSNPLNLKPHN------NMTLNDILPPAT 232

Query: 205 XXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSF-------------------SNTPISR 245
                     +PS    D++L  +DLF +QL SF                   SNT    
Sbjct: 233 TVASTSTLDANPSSTLFDSLLANDDLFTQQLMSFANNANNNNNNNDSVTTLDNSNTQQQN 292

Query: 246 NDSNESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPSTE 305
               +   P+ DS LISN F+F D+FDE+V+DFC KM+  CGTRSNPIP KS SN+ + +
Sbjct: 293 LQQPQITPPIEDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIP-KSKSNVSTPQ 351

Query: 306 S 306
           S
Sbjct: 352 S 352

 Score =  122 bits (306), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 50/62 (80%), Positives = 57/62 (91%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS+D  LLRCSE+WDRITAHPKYS++DIDGLC ELM KAKCSE+GVVVNAEDVQ AL+KH
Sbjct: 576 PSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKH 635

Query: 480 LS 481
           +S
Sbjct: 636 MS 637

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (93%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS+D  LLRCSE+WDRITAHPKYSDIDIDGLC ELMAKAKCSE+GVV+NA+DVQ AL+KH
Sbjct: 527 PSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALNKH 586

Query: 480 LS 481
           +S
Sbjct: 587 MS 588

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 60/101 (59%), Gaps = 1/101 (0%)

Query: 26  NAIPKKNNASKSSR-TELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQK 84
           N   +K++AS+  R  ELD E ++KR AQNRAAQ                 V  L N+ K
Sbjct: 6   NGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTK 65

Query: 85  QNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE 125
            NE+E+ FLR QL  LVKEL+KYRPET  D +VL YL KH+
Sbjct: 66  LNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKHK 106

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 30/110 (27%)

Query: 247 DSNESKNP---------------MTDSQLIS-----NEFNFEDQFDEKVTDFCIKMNQVC 286
           DSNESKN                MT  + IS     +  +F + FDE+V++FC K+NQ C
Sbjct: 201 DSNESKNTWNTDPTSSEDWLDDVMTSHKQISRGQSGSGIDFNNFFDEQVSEFCTKLNQAC 260

Query: 287 GTRSNPIPK---KSTSNLPSTES-----TPLFTNTFDSPSFGQLNIQNIE 328
           GT++ PIP+    +T+ LP T S     +P+  N  D+     LN+Q  E
Sbjct: 261 GTKACPIPQSKSAATTPLPGTSSNGNSNSPMIIN--DTMGDVSLNMQGNE 308

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 50/62 (80%), Positives = 57/62 (91%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS+D  LLRCSE+WDRI+AHPKYSD+DIDGLC ELM KAKCSE+GVVVNAEDVQ AL+KH
Sbjct: 526 PSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKH 585

Query: 480 LS 481
           +S
Sbjct: 586 MS 587

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 59/92 (64%), Gaps = 6/92 (6%)

Query: 217 SINWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKN-----PMTDSQLISNEFNFEDQF 271
           S+ W DNM + +DLFN+QL S SNT  +  ++  +        + D  LI+N F+  D+F
Sbjct: 231 SLEWFDNMFNNDDLFNQQLLSLSNTANANKNTTTTATNTSLLQLDDPNLITNNFDVTDKF 290

Query: 272 DEKVTDFCIKMNQVCGTRSNPIPK-KSTSNLP 302
           DE+V+DFC KMN  CGTR +P+PK KS ++ P
Sbjct: 291 DEQVSDFCGKMNMACGTRYDPVPKSKSNTSTP 322

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  115 bits (288), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (91%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           P++D  LL+CSE+WDRITAHPKYSDIDIDGLC EL  KAKCSEKGVVVN++DVQSAL+KH
Sbjct: 508 PARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALAKH 567

Query: 480 LS 481
           +S
Sbjct: 568 MS 569

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K   SK  R  LD EAK KRTAQNRAAQ                 V+ L  +++Q+E+ES
Sbjct: 19  KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMES 78

Query: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE 125
           EFLRSQL  L+ E++KYRP+ ++DSQVL YLA+ E
Sbjct: 79  EFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLAEAE 113

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 25/33 (75%)

Query: 263 NEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPK 295
            +F+F   FDE+V+ FC +MN+VCGTR  P+P+
Sbjct: 267 GDFDFNTHFDEQVSVFCTQMNEVCGTRECPLPQ 299

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  113 bits (282), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (88%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           P++D  LL+CSEVWDRIT+HPKYSDIDIDGLC EL  KAKCSEKGVVVN +DVQ AL+KH
Sbjct: 523 PARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALTKH 582

Query: 480 LS 481
           +S
Sbjct: 583 MS 584

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 60/95 (63%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K   SK  R  LD EAK KRTAQNRAAQ                 V+ L  +++Q+E+ES
Sbjct: 19  KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELES 78

Query: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE 125
           EFLRSQL  L+ E++KYRP  ++DSQVLN+LAK E
Sbjct: 79  EFLRSQLQKLLAEIQKYRPRQSSDSQVLNFLAKAE 113

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%)

Query: 249 NESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPI 293
           N+S      S+    EF+F   FDE+V++FC +MN+VCGTR  P+
Sbjct: 265 NQSLPKFVPSEPAKTEFDFNSHFDEQVSEFCTRMNEVCGTRECPV 309

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  113 bits (282), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%)

Query: 422 KDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHLS 481
           K KN ++CSEVWDRIT+HPKYSD+DIDGLC ELM KAKCSEKGVVV A+DVQ AL+KHLS
Sbjct: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608

 Score = 82.0 bits (201), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (58%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K  ++K  R   DQEAK KRTAQNRAAQ                 V  L  + K++EIES
Sbjct: 34  KKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKSEIES 93

Query: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE 125
           +FLR QL  L+ EL++YRPE  ND++V  YL+ H+
Sbjct: 94  QFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHK 128

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  110 bits (276), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 48/61 (78%), Positives = 52/61 (85%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS D  LL+CSEVWDRITAHP+YSD+DIDGLC EL  KAKCSEKGVVVNAEDVQ AL  H
Sbjct: 522 PSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISH 581

Query: 480 L 480
           +
Sbjct: 582 M 582

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K    K  R  L+ EAK KRTAQNRAAQ                 V  L ++ KQ+E+E+
Sbjct: 38  KRRERKPGRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELET 97

Query: 91  EFLRSQLITLVKELKKYRPE--TANDSQVLNYLAKHENGNFNEN---------------- 132
           +FLR+Q+  L+ ELK+Y PE     DS +L+YLAK    + + N                
Sbjct: 98  KFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFSAAANKAANSKDS 157

Query: 133 --LSKKSNFSFAFPW 145
                 SNF F FPW
Sbjct: 158 STAISSSNFQFEFPW 172

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%)

Query: 261 ISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPST 304
           +++EF+F+ QFDE V+ FC K++  CGT+SNPIPK S  + PS+
Sbjct: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSS 290

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  109 bits (272), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           P+ D  LL+CSEVWDRITAHP+YSDIDIDGLC ELM  AKCS+KGVVV+++DVQ ALS H
Sbjct: 530 PTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALSNH 589

Query: 480 LS 481
           +S
Sbjct: 590 MS 591

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 56/97 (57%), Gaps = 21/97 (21%)

Query: 220 WLDNMLHTEDLFN---------EQLSSFSNTPIS------------RNDSNESKNPMTDS 258
           W+DN+ + +D  N            ++F ++P++            +N++N +     DS
Sbjct: 227 WMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYDS 286

Query: 259 QLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPK 295
            L SN+FNF+D FD++V+ FC+KMNQ CGT+ NP+PK
Sbjct: 287 DLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPK 323

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 99.4 bits (246), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 51/62 (82%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           PS D  L+RCSE+WDRIT +P+Y+D+DIDGLC ELM  AKCS+KGVVV ++DV   L+KH
Sbjct: 414 PSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKH 473

Query: 480 LS 481
           ++
Sbjct: 474 MA 475

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 60/89 (67%)

Query: 34  ASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFL 93
           ++K  + ++D EA+++RTAQNRAAQ                 V+ L NI ++NE+E+EFL
Sbjct: 31  SNKIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFL 90

Query: 94  RSQLITLVKELKKYRPETANDSQVLNYLA 122
           RSQ++TLV ELKKYR ET +DS++L  ++
Sbjct: 91  RSQVLTLVNELKKYRSETTSDSKILKLVS 119

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 256 TDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPK 295
           +DS L SN+FNF +QFDE+V+ FC KMN     R   I K
Sbjct: 182 SDSGLFSNDFNFNNQFDEQVSTFCAKMNNNFENRKKIIKK 221

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 40/61 (65%), Positives = 49/61 (80%)

Query: 420 PSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKH 479
           P  D  LL C E+WDRIT +P+YSDIDIDGLC ELMA AKCS+KGV+V+++DVQ  LS+ 
Sbjct: 445 PLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLSRR 504

Query: 480 L 480
           L
Sbjct: 505 L 505

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 47  KLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLRSQLITLVKELKK 106
           ++KR AQNRAAQ                 V  L NI ++NEIE+ FLR+QL++LV ELKK
Sbjct: 19  RMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKK 78

Query: 107 YRPETANDSQV--LNYLAKHENGNFNE 131
           YR +  +D ++  +    KHE  N N+
Sbjct: 79  YRIDKNDDFRLKKIGSQLKHEKLNLNK 105

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 257 DSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPSTESTPLFTNTFDS 316
           DS L S EF+F ++FDE+V+ FC KMN+    R   I +  T  + ++ + P   +    
Sbjct: 260 DSNLFSTEFDFANEFDEQVSTFCAKMNKTFENRKEMIKQFYTEKVRNSNNKPRTVSIKQE 319

Query: 317 PSFG-QLNIQ 325
           P+   Q NIQ
Sbjct: 320 PTTTLQANIQ 329

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%)

Query: 421 SKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480
           ++D + L+CS+VW R+T HPKYS++DIDGLC ELM +AKCSEKGVVV + DVQ ALSK+L
Sbjct: 499 AEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALSKYL 558

Query: 481 S 481
           S
Sbjct: 559 S 559

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 43  DQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLRSQLITLVK 102
           D + K KRT QNR AQ                 V  L  + +  E+E+ FLRS+L ++  
Sbjct: 37  DSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMAD 96

Query: 103 ELKKYRPETANDSQVLNYLAKHEN-GNFNEN 132
           ELKKYRP  ++D +VL YLAK E    +N N
Sbjct: 97  ELKKYRPAQSSDLEVLEYLAKKEQLAKYNHN 127

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 257 DSQLISNEFNFEDQFDEKVTDFCIKMN 283
           DS L SN+FNF+D+F ++V+ FC K+N
Sbjct: 292 DSSLFSNDFNFDDKFSDQVSSFCDKVN 318

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (77%)

Query: 423 DKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSAL 476
           D  +L C+++WDRITA PKY+  DI+ LC ELM+KAKCS+KGVVV++ DV   L
Sbjct: 533 DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 37  SSRTELDQEAKLK--RTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFLR 94
           +S+ + D  A+LK  RTAQNRAAQ                 V  L  + + +E E+ FLR
Sbjct: 21  TSKVQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLR 80

Query: 95  SQLITLVKELKKYRPET---ANDSQVLNYLAKHE 125
           SQLI    EL+K        +N++ + NY  +H+
Sbjct: 81  SQLILFGTELRKQHNTGNTPSNNNSISNYRNRHK 114

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 265 FNFEDQFDEKVTDFCIKMNQVCGTRS 290
           FNF++QFDE+++ FC+K+N  CG  S
Sbjct: 356 FNFDNQFDEQISKFCLKLNSACGNLS 381

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 119/267 (44%), Gaps = 31/267 (11%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K    +  R  LD  AK +RTAQNRAAQ                 +  L  I+  NE+ES
Sbjct: 18  KRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVES 77

Query: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYLA-KHEN---------GNFNENLSKKSN-F 139
            FLR  ++ L+ +++KYRP  + DS+VL YL+ K +N          +  E  +KK++  
Sbjct: 78  TFLRDYMMDLICDMQKYRPNNSTDSKVLKYLSLKKKNQPSMKATSIDSLIEMENKKTDEI 137

Query: 140 SFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNSPVTASNDKKNYPSSVXXXXXXXXXXXX 199
           S   P    N   + ++N N    N +PSP+ S  T S+   + P S             
Sbjct: 138 SKESPDSTLNNNANNNNNNNNNDTNQVPSPNES--TGSH--ISSPDSQSLKHDEGLRLPS 193

Query: 200 XXXXXXXXXXXXXGISPSINWLDNMLHTEDLFNEQLSSF--------SNTPISRNDSNES 251
                        GI+ S NW+DN+   +    E L SF           P++ ND++ S
Sbjct: 194 FSNKYDINSHDGGGITSS-NWIDNIFDGDTA--EGLPSFPASISSSSETPPVNANDNDHS 250

Query: 252 K----NPMTDSQLI-SNEFNFEDQFDE 273
                N + D  +I +NEF+F +QFD+
Sbjct: 251 HVDFTNNLLDHNMIFTNEFSFHNQFDD 277

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 2/55 (3%)

Query: 428 RCSEVWDRI-TAHPKYSDIDIDGLCGELMAKAKCSEKG-VVVNAEDVQSALSKHL 480
           +CS +W R  T  PK+SD DID LC EL+ KAKCS++G +V+ + DV++ L KH 
Sbjct: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 71/142 (50%), Gaps = 12/142 (8%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           +   +K  R  LD EAK +RTAQNRAAQ                 V  L   + Q+E E 
Sbjct: 39  RRKGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREV 98

Query: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFNENLSKKSNFSFAFPWDDNNA 150
           + LR+Q+++L++ELKKYRP     S VL    +      +E +  K  F   FPW+ ++ 
Sbjct: 99  QSLRNQVVSLLRELKKYRP----GSPVL----QEPEPTGDEEIQGK--FGLNFPWEQSSG 148

Query: 151 TTDKSDNLNTTTNNNIPSPDNS 172
             D+ D+L+      +PSP +S
Sbjct: 149 EEDE-DSLSMVI-TQVPSPKSS 168

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 9/62 (14%)

Query: 428 RCSEVWDRIT--------AHPKYSDIDIDGLCGELMAKAKCSEKG-VVVNAEDVQSALSK 478
           +CS++W+RI         + P++ D DID LC ELM KA+CS  G +V+   D++ +L K
Sbjct: 458 KCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQSLMK 517

Query: 479 HL 480
           H 
Sbjct: 518 HF 519

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%)

Query: 76  VDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLA 122
           +  L  I+ +N IE+ FLRS +  L+ E+ K+RP+   DS++L YL+
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLS 54

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 10/73 (13%)

Query: 216 PSINWLDNMLH---TEDL---FN----EQLSSFSNTPISRNDSNESKNPMTDSQLISNEF 265
           P+ NW+DN+      E L    N    E++++ +N   + N+   + N + +S + SN+F
Sbjct: 209 PNKNWMDNVFENNIAEGLPPFLNNDDPEKIANMNNHTDTNNNLLTTGNLLDNSLMFSNDF 268

Query: 266 NFEDQFDEKVTDF 278
           NF +QFDE VT+ 
Sbjct: 269 NFNNQFDEHVTNL 281

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 429 CSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKG-VVVNAEDVQSALSKHL 480
           C  + + I++ PKYS +DID LC EL+ KAKC++   +VV A D+QSAL + L
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 64/147 (43%), Gaps = 7/147 (4%)

Query: 25  KNAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQK 84
           K+  PK+    +  R  +D EAK +RTAQNRAAQ                 V+ L     
Sbjct: 25  KDGTPKRK-VGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDA 83

Query: 85  QNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYL------AKHENGNFNENLSKKSN 138
           QN+  ++FL   L +L+ E+ KYR + ++D ++L +L       K EN         K+ 
Sbjct: 84  QNKTTTDFLLCSLKSLLSEITKYRAKNSDDERILAFLDDLQEQQKRENEKGTSTAVSKAA 143

Query: 139 FSFAFPWDDNNATTDKSDNLNTTTNNN 165
                P  D N T + S  +   T  N
Sbjct: 144 KELPSPNSDENMTVNTSIEVQPHTQEN 170

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVD--HLSNIQKQNEI 88
           K    +  R +LD +AK KRT QNR AQ                 VD   L N+ K   I
Sbjct: 6   KRRVGRPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEII 65

Query: 89  ESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFN 130
           E  FL+  ++TL+ E+K YR +T  D ++L+ + K EN   +
Sbjct: 66  E--FLKQNVMTLLGEIKNYRKQTNKDKKLLDTIGKLENDGMD 105

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 429 CSEVWDRITAHPKYSDIDIDGLCGELMAKAKCS-EKGVVVNAEDVQSALSKHL 480
           CS +   I++ PK+S +DID LC ELM KAKCS +  ++V A  +QS L++ L
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K    K+ R  +D EAK KRTAQNRAAQ                 +  L  +  +   E+
Sbjct: 6   KEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSET 65

Query: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYL 121
           E+L+  L  L+ E+ KYRP    D  +L  L
Sbjct: 66  EYLKECLSELLTEVTKYRPANEKDQGILKRL 96

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 10/71 (14%)

Query: 421 SKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKG----------VVVNAE 470
           S+ K +LRC ++   +     Y  +D + LC ELM KAK S+ G          VV+ A 
Sbjct: 415 SEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAG 474

Query: 471 DVQSALSKHLS 481
           D+Q  L+KH+S
Sbjct: 475 DLQRTLAKHIS 485

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 429 CSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKG-VVVNAEDVQSALSKHL 480
           C  +   I++ PKYS +DID LC ELM KA+ ++   +VV A D+Q+ L K L
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 25  KNAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQK 84
           K+ IPK+    +  R  +D EAK +RTAQNRAAQ                 ++ L     
Sbjct: 9   KDGIPKRK-VGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDA 67

Query: 85  QNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYL 121
           QN+   +FL+S L +L+ E+ KYR +  ND ++L +L
Sbjct: 68  QNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (48%)

Query: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIES 90
           K   +K  R  LD EAK +RTAQNRAAQ                 V  L   +   E E 
Sbjct: 23  KRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEV 82

Query: 91  EFLRSQLITLVKELKKYR 108
           + LR  +I LV+EL+++R
Sbjct: 83  QSLRGHVIALVRELRRWR 100

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 429 CSEVWDRITAHPKYSDIDIDGLCGELMAKAK--CSEKGVVVNAEDVQSALSKHLS 481
           C+ V   +T  P Y + D++ LC ELM K K    +  + V  EDV+SAL +H++
Sbjct: 329 CAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSALERHIA 383

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 36/88 (40%)

Query: 34  ASKSSRTELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQKQNEIESEFL 93
             +  R +LD EAK KRT QNR AQ                 +  L  +   NE  +E +
Sbjct: 15  VGRPGRRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRAELM 74

Query: 94  RSQLITLVKELKKYRPETANDSQVLNYL 121
            + L  L+ E  K+R E   D  V   L
Sbjct: 75  AAHLRDLLGEANKFRGEKPRDKTVRELL 102

>YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}
           YAP3Basic leucine zipper (bZIP) transcription factor
          Length = 330

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 26  NAIPKKNNASKSSRT-------ELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDH 78
           N   K N  S SSR+        +  ++K K+ AQNRAAQ                 +  
Sbjct: 119 NYFSKNNGISPSSRSPSVAHNENVPDDSKAKKKAQNRAAQKAFRERKEARMKELQDKL-- 176

Query: 79  LSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFNENLSKKSN 138
                    +ESE  R  L+  ++EL+K   E   ++++L    +  N NF++++   +N
Sbjct: 177 ---------LESERNRQSLLKEIEELRKANTEINAENRLL---LRSGNENFSKDIEDDTN 224

Query: 139 FSFAFPWDD 147
           + ++FP  D
Sbjct: 225 YKYSFPTKD 233

>ABR127C Chr2 complement(634207..635259) [1053 bp, 350 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR313C
           (SPS4)
          Length = 350

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 119 NYLAKHENGNFNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNI 166
           NY AKH N  FNENL K+ +  +A  WD   AT +    LN  T  ++
Sbjct: 253 NY-AKHVNDVFNENLDKQEDLYWAHSWD---ATKNAITELNAETIGHV 296

>ZYRO0B01254g Chr2 (106790..107989) [1200 bp, 399 aa] {ON} similar
           to uniprot|P32902 Saccharomyces cerevisiae YHL004W MRP4
           Mitochondrial ribosomal protein of the small subunit
          Length = 399

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 11/62 (17%)

Query: 226 HTEDLFNEQLSSFSNTPISRNDS--NESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMN 283
           H  D    QL + S TP+ + D   N +  P+T+          E Q DE++TDF  K +
Sbjct: 51  HFNDQIVSQLKALSETPLDKIDGLQNVTDQPLTEK---------EKQLDEELTDFLTKYS 101

Query: 284 QV 285
           Q+
Sbjct: 102 QL 103

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 26/55 (47%)

Query: 426 LLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480
           LL   ++W  +  HPK +  D++ L  EL   A CS   ++++ +      S  L
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

>Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON}
           YHL009C (REAL)
          Length = 331

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 21/125 (16%)

Query: 30  KKNNASKSSRT-------ELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNI 82
           +KN+ S SSRT        +  ++K K+ AQNRAAQ                    L  +
Sbjct: 123 EKNDNSPSSRTPSIPHSENISDDSKAKKKAQNRAAQKAFRERKEA----------RLKEL 172

Query: 83  QKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFNENLSKKSNFSFA 142
           Q +  +ESE  R  L+  ++EL+K   E   ++++   L +  N  F+ +L   +   ++
Sbjct: 173 QDK-LLESEKNRQSLLKEIEELRKVNTEINAENRL---LLRSGNERFSRDLIDGTGHKYS 228

Query: 143 FPWDD 147
           FP  D
Sbjct: 229 FPIKD 233

>Skud_16.294 Chr16 complement(541842..545453) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 86  NEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLA 122
           N+++  FL  +L  L++  KK  P+  N +QVL YL 
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLG 331

>Smik_16.249 Chr16 complement(453693..457304) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 86  NEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLA 122
           N+++  FL  +L  L++  KK  P+  N +QVL YL 
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLG 331

>Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON}
           YHL009C (REAL)
          Length = 330

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 17/129 (13%)

Query: 30  KKNNASKSSRT------ELDQEAKLKRTAQNRAAQXXXXXXXXXXXXXXXXXVDHLSNIQ 83
           +K ++S  SRT      +L  ++K K+ AQNRAAQ                 +       
Sbjct: 120 EKKDSSSGSRTPPVYSDDLSGDSKAKKKAQNRAAQKAFRERKEARLKELEDKL------- 172

Query: 84  KQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFNENLSKKSNFSFAF 143
               +ESE  R  L+  ++EL+K   E   ++++L      +      +L   SN  ++F
Sbjct: 173 ----LESEKNRQSLLKEIEELRKANTEINAENRLLLRNGSEKATKSRRDLIDDSNSKYSF 228

Query: 144 PWDDNNATT 152
           P  D  +T+
Sbjct: 229 PTKDEFSTS 237

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,108,725
Number of extensions: 1992103
Number of successful extensions: 15946
Number of sequences better than 10.0: 282
Number of HSP's gapped: 15485
Number of HSP's successfully gapped: 368
Length of query: 481
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 368
Effective length of database: 40,524,141
Effective search space: 14912883888
Effective search space used: 14912883888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)